F400077

General Info

Members Datasets Scaffolds Average Seq Length
309 176 618 333

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100000016|Ga0070714_10000001663
Length 368
Sequence VSAVDDAARARQALQPDGARAPPGEESIGVARLLASWRYALATCNPPRGGVDPVTRWLVLTRACSQPMTLTAAAFAGLLAVRAPGFNAWLYALAAVGIVVAHASNNLMNDVFDMDVGADTQDYPRALYAPHAILSGMTTRAGLMRAAVATNVVDLAIMLVLLYYRGWPVVAFAVAGVLISAAYAAPPLRLKKRGLGEPSVLVIWGPLMVGGTYFAATGHIGWAVIAASIPYALLATAVLMGKHIDKLPWDRKRGIGTLPVRLGEALSRQVTMGLMVAFYVAVVGLVAVGWLPLAALVALLGITRLIPVLRNYSRPRPDQPPPGYPIWPLWYAASAFVHTRRAGALLVVGMIAGTVLTPLGPLHGLATQ

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
50 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
51 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
68 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
70 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
71 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
72 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
73 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
74 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
75 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
76 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
77 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
78 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
79 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
80 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
81 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
82 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
83 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
84 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
85 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
86 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
87 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
88 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
89 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
90 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
91 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
92 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
93 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
94 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
96 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
97 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
98 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
99 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
100 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
101 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
102 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
103 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
104 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
105 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
106 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
107 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
108 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
109 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
110 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
111 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
112 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
113 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
114 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
115 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
116 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
117 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
118 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
119 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
120 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
121 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
122 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
123 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
124 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
125 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
126 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
127 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
128 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
129 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
130 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
131 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
132 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
133 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
134 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
135 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
138 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
139 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
140 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
146 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
147 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
148 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
149 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
150 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
151 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
152 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
153 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
154 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
155 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
156 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
157 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
158 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
159 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
160 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
161 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
162 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
163 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
164 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
165 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
166 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
167 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
168 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
169 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
170 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
171 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
172 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
173 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
174 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
175 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
176 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.41
Metatranscriptomes 1.62
Isolates 0.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.27
Nodule 0
Rhizoplane 4.85
Rhizosphere 86.73
Stem 0
Stem Tuber 0
Unclassified 4.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100000016 3300005435 Bacteria 196345
2 Ga0070658_10000362 3300005327 Bacteria 39469
3 Ga0070658_10149302 3300005327 Bacteria 1956
4 Ga0070680_100000303 3300005336 Bacteria 32891
5 Ga0070660_100341623 3300005339 Bacteria 1232
6 Ga0070669_100123580 3300005353 Bacteria 1978
7 Ga0070675_100092768 3300005354 Bacteria 2532
8 Ga0070714_100057982 3300005435 Bacteria 3316
9 Ga0070714_100061044 3300005435 Bacteria 3237
10 Ga0070714_100153159 3300005435 Bacteria 2079
11 Ga0070713_100327262 3300005436 Bacteria 1417
12 Ga0070694_100028431 3300005444 Unclassified 3638
13 Ga0070708_100007084 3300005445 Bacteria 8946
14 Ga0070708_100017983 3300005445 Bacteria 5910
15 Ga0070708_100074585 3300005445 Unclassified 3060
16 Ga0070708_100324889 3300005445 Bacteria 1449
17 Ga0070663_100061886 3300005455 Bacteria 2697
18 Ga0070681_10001225 3300005458 Bacteria 22321
19 Ga0070706_100005557 3300005467 Bacteria 12001
20 Ga0070706_100020862 3300005467 Bacteria 6032
21 Ga0070706_100067984 3300005467 Unclassified 3294
22 Ga0070706_100103606 3300005467 Bacteria 2645
23 Ga0070707_100079011 3300005468 Bacteria 3175
24 Ga0070707_100188648 3300005468 Unclassified 2010
25 Ga0070698_100000043 3300005471 Bacteria 88744
26 Ga0070698_100003401 3300005471 Bacteria 17500
27 Ga0070698_100004804 3300005471 Bacteria 14832
28 Ga0070698_100025738 3300005471 Bacteria 6130
29 Ga0070698_100104235 3300005471 Bacteria 2806
30 Ga0070698_100326754 3300005471 Bacteria 1465
31 Ga0070698_100327521 3300005471 Unclassified 1463
32 Ga0070699_100000203 3300005518 Bacteria 58650
33 Ga0070699_100045966 3300005518 Bacteria 3778
34 Ga0070699_100156655 3300005518 Bacteria 2015
35 Ga0070699_100165657 3300005518 Bacteria 1958
36 Ga0070699_100413820 3300005518 Unclassified 1220
37 Ga0070679_100007012 3300005530 Bacteria 10513
38 Ga0070697_100022025 3300005536 Bacteria 5056
39 Ga0070697_100299786 3300005536 Bacteria 1381
40 Ga0070695_100004500 3300005545 Bacteria 8190
41 Ga0070696_100071530 3300005546 Bacteria 2441
42 Ga0070704_100171974 3300005549 Bacteria 1724
43 Ga0068856_100325243 3300005614 Bacteria 1555
44 Ga0081455_10048062 3300005937 Bacteria 3689
45 Ga0081455_10236209 3300005937 Bacteria 1346
46 Ga0070717_10012687 3300006028 Bacteria 6432
47 Ga0075363_100016958 3300006048 Bacteria 3605
48 Ga0070716_100024547 3300006173 Bacteria 3209
49 Ga0075428_100000002 3300006844 Bacteria 546374
50 Ga0075428_100019241 3300006844 Bacteria 7552
51 Ga0075428_100028312 3300006844 Bacteria 6197
52 Ga0075428_100068543 3300006844 Bacteria 3881
53 Ga0075428_100088117 3300006844 Bacteria 3385
54 Ga0075428_100150227 3300006844 Bacteria 2531
55 Ga0075428_100337070 3300006844 Bacteria 1620
56 Ga0075430_100008152 3300006846 Bacteria 8855
57 Ga0075430_100047037 3300006846 Bacteria 3643
58 Ga0075431_100002091 3300006847 Bacteria 19074
59 Ga0075431_100027340 3300006847 Bacteria 5851
60 Ga0075431_100076047 3300006847 Bacteria 3465
61 Ga0075433_10003698 3300006852 Bacteria 11834
62 Ga0075434_100019560 3300006871 Bacteria 6555
63 Ga0075434_100121054 3300006871 Bacteria 2633
64 Ga0075429_100006632 3300006880 Bacteria 10028
65 Ga0075436_100080175 3300006914 Bacteria 2261
66 Ga0075435_100003071 3300007076 Bacteria 11262
67 Ga0099794_10015203 3300007265 Bacteria 3392
68 Ga0111539_10022823 3300009094 Bacteria 7686
69 Ga0111539_10117204 3300009094 Bacteria 3122
70 Ga0111539_10242793 3300009094 Bacteria 2097
71 Ga0111539_10258543 3300009094 Bacteria 2027
72 Ga0111539_10319576 3300009094 Bacteria 1807
73 Ga0105245_10115421 3300009098 Bacteria 2502
74 Ga0105245_10607526 3300009098 Bacteria 1121
75 Ga0114129_10061433 3300009147 Bacteria 5250
76 Ga0114129_10159599 3300009147 Bacteria 3082
77 Ga0114129_10164218 3300009147 Bacteria 3031
78 Ga0114129_10259081 3300009147 Bacteria 2332
79 Ga0114129_10508684 3300009147 Bacteria 1572
80 Ga0114129_10545579 3300009147 Bacteria 1508
81 Ga0105243_10152461 3300009148 Bacteria 1984
82 Ga0105238_10478822 3300009551 Bacteria 1244
83 Ga0105249_10176414 3300009553 Bacteria 2076
84 Ga0105246_10066025 3300011119 Bacteria 2532
85 Ga0105246_10214897 3300011119 Bacteria 1503
86 Ga0157374_10185957 3300013296 Bacteria 2031
87 Ga0163162_10167548 3300013306 Bacteria 2321
88 Ga0157375_10349568 3300013308 Bacteria 1644
89 Ga0157375_10754031 3300013308 Bacteria 1124
90 Ga0157379_10000377 3300014968 Bacteria 36018
91 Ga0197907_10347100 3300020069 Bacteria 1412
92 Ga0206354_10590393 3300020081 Bacteria 1632
93 Ga0206354_11163324 3300020081 Bacteria 4332
94 Ga0206353_10051367 3300020082 Bacteria 50239
95 Ga0206353_11663917 3300020082 Bacteria 1587
96 Ga0213873_10000108 3300021358 Bacteria 16096
97 Ga0213876_10001978 3300021384 Bacteria 12254
98 Ga0213876_10009046 3300021384 Bacteria 5364
99 Ga0213876_10034682 3300021384 Bacteria 2662
100 Ga0213876_10039641 3300021384 Bacteria 2489
101 Ga0213876_10074622 3300021384 Bacteria 1792
102 Ga0207643_10047977 3300025908 Bacteria 2418
103 Ga0207705_10002639 3300025909 Bacteria 13752
104 Ga0207684_10093118 3300025910 Bacteria 2569
105 Ga0207707_10000518 3300025912 Bacteria 39471
106 Ga0207693_10260773 3300025915 Bacteria 1359
107 Ga0207660_10005495 3300025917 Bacteria 8231
108 Ga0207652_10001743 3300025921 Bacteria 18981
109 Ga0207646_10060704 3300025922 Bacteria 3376
110 Ga0207646_10394883 3300025922 Unclassified 1249
111 Ga0207646_10456021 3300025922 Bacteria 1153
112 Ga0207681_10182207 3300025923 Bacteria 1601
113 Ga0207681_10256421 3300025923 Bacteria 1368
114 Ga0207659_10171318 3300025926 Bacteria 1713
115 Ga0207664_10000011 3300025929 Bacteria 279264
116 Ga0207665_10047278 3300025939 Bacteria 2885
117 Ga0207678_10044236 3300026067 Bacteria 3852
118 Ga0207702_10362860 3300026078 Bacteria 1389
119 Ga0207675_100374692 3300026118 Bacteria 1399
120 Ga0207683_10445714 3300026121 Bacteria 1193
121 Ga0207428_10038331 3300027907 Bacteria 3897
122 Ga0268265_10276696 3300028380 Bacteria 1500
123 Ga0265322_10001062 3300028654 Bacteria 9533
124 Ga0265338_10000267 3300028800 Bacteria 95163
125 Ga0265330_10001083 3300031235 Bacteria 16404
126 Ga0265332_10000288 3300031238 Bacteria 39554
127 Ga0265332_10009100 3300031238 Unclassified 4439
128 Ga0265325_10001938 3300031241 Bacteria 14276
129 Ga0265329_10000927 3300031242 Bacteria 14722
130 Ga0265329_10006556 3300031242 Bacteria 4608
131 Ga0265329_10041659 3300031242 Bacteria 1472
132 Ga0265339_10001810 3300031249 Bacteria 15687
133 Ga0265331_10017351 3300031250 Bacteria 3757
134 Ga0265327_10012089 3300031251 Bacteria 5859
135 Ga0265316_10000112 3300031344 Bacteria 87681
136 Ga0265313_10000281 3300031595 Bacteria 55832
137 Ga0265342_10000183 3300031712 Bacteria 70222
138 Ga0316576_10008679 3300031727 Bacteria 6503
139 Ga0316578_10064016 3300031728 Bacteria 2170
140 Ga0373926_0011063 3300035083 Bacteria 3032
141 Ga0373934_0006282 3300035086 Bacteria 4405
142 Ga0373954_0022073 3300035118 Bacteria 2886
143 Ga0373956_0003328 3300035119 Bacteria 6473
144 Ga0316574_0073730 3300035398 Bacteria 2159
145 Ga0316574_0228806 3300035398 Bacteria 1190
146 Ga0373924_0013927 3300035410 Bacteria 3029
147 Ga0373935_0016297 3300035692 Bacteria 4498
148 Ga0373935_0035811 3300035692 Bacteria 3098
149 Ga0373927_0004452 3300035695 Bacteria 9815
150 Ga0373927_0172529 3300035695 Bacteria 1418
151 Ga0373947_0004467 3300035725 Bacteria 8209
152 Ga0373947_0085594 3300035725 Bacteria 1958
153 Ga0373947_0165259 3300035725 Bacteria 1433
154 Ga0373937_0102516 3300036401 Bacteria 2657
155 Ga0373937_0122807 3300036401 Bacteria 2421
156 Ga0316584_0035947 3300036712 Unclassified 3675
157 Ga0316584_0122107 3300036712 Unclassified 1946
158 Ga0373925_0024971 3300037068 Bacteria 4364
159 Ga0436364_0745069 3300037853 Bacteria 913
160 Ga0436364_0888171 3300037853 Bacteria 8702
161 Ga0395901_0235520 3300038443 Bacteria 1911
162 Ga0436365_0151618 3300039437 Bacteria 2672
163 Ga0436365_0191946 3300039437 Bacteria 6653
164 Ga0436365_0293426 3300039437 Bacteria 4298
165 Ga0436365_0305834 3300039437 Bacteria 14509
166 Ga0436365_0316840 3300039437 Bacteria 9510
167 Ga0436365_1017373 3300039437 Bacteria 11123
168 Ga0436360_1110662 3300039438 Bacteria 3523
169 Ga0436363_0535625 3300039450 Bacteria 1528
170 Ga0436363_0950365 3300039450 Bacteria 1677
171 Ga0436362_0366100 3300039453 Bacteria 12544
172 Ga0436362_0388883 3300039453 Bacteria 29572
173 Ga0436362_0739437 3300039453 Bacteria 8326
174 Ga0451802_1325762 3300041460 Bacteria 1169
175 Ga0466969_0014114 3300044656 Bacteria 4203
176 Ga0466969_0024749 3300044656 Bacteria 3088
177 Ga0466965_0110538 3300044683 Bacteria 1412
178 Ga0466966_0003287 3300044684 Bacteria 10661
179 Ga0466966_0006273 3300044684 Bacteria 7866
180 Ga0466966_0007267 3300044684 Bacteria 7341
181 Ga0466961_0007216 3300044693 Bacteria 7068
182 Ga0466961_0007758 3300044693 Bacteria 6831
183 Ga0466963_0005630 3300044694 Bacteria 7352
184 Ga0466963_0104226 3300044694 Bacteria 1943
185 Ga0466963_0121920 3300044694 Bacteria 1795
186 Ga0466963_0288570 3300044694 Bacteria 1153
187 Ga0466963_0347442 3300044694 Bacteria 1044
188 Ga0466971_0013252 3300044719 Bacteria 3618
189 Ga0466971_0026395 3300044719 Bacteria 2596
190 Ga0466971_0028577 3300044719 Bacteria 2494
191 Ga0466971_0046428 3300044719 Bacteria 1952
192 Ga0466971_0083373 3300044719 Bacteria 1459
193 Ga0466968_0001736 3300044735 Bacteria 7857
194 Ga0466968_0005961 3300044735 Bacteria 4569
195 Ga0466970_0100455 3300044765 Bacteria 1575
196 Ga0466957_0001881 3300044842 Bacteria 11110
197 Ga0466957_0009864 3300044842 Bacteria 5460
198 Ga0466957_0048456 3300044842 Bacteria 2583
199 Ga0466959_0001049 3300045049 Bacteria 16572
200 Ga0466959_0022031 3300045049 Bacteria 4706
201 Ga0466959_0023710 3300045049 Bacteria 4542
202 Ga0466959_0130045 3300045049 Bacteria 1784
203 Ga0466958_0001334 3300045836 Bacteria 11653
204 Ga0466958_0002174 3300045836 Bacteria 9776
205 Ga0466958_0003162 3300045836 Bacteria 8477
206 Ga0466958_0003841 3300045836 Bacteria 7852
207 Ga0466958_0147780 3300045836 Bacteria 1482
208 Ga0466967_0019613 3300045976 Bacteria 5443
209 Ga0466967_0028014 3300045976 Bacteria 4696
210 Ga0466967_0115427 3300045976 Bacteria 2473
211 Ga0466967_0260799 3300045976 Bacteria 1658
212 Ga0466967_0260814 3300045976 Bacteria 1658
213 Ga0495603_0037312 3300046455 Bacteria 2916
214 Ga0495629_0085401 3300046459 Bacteria 2202
215 Ga0495641_0067269 3300046461 Bacteria 1611
216 Ga0495653_0326759 3300046463 Bacteria 993
217 Ga0495580_0007667 3300046472 Bacteria 8656
218 Ga0495630_0289429 3300046517 Unclassified 1252
219 Ga0495666_0067939 3300046526 Bacteria 1698
220 Ga0495640_0026798 3300046533 Bacteria 4160
221 Ga0495621_0062030 3300046539 Bacteria 1359
222 Ga0495647_0031043 3300046681 Bacteria 1986
223 Ga0495658_0026319 3300046683 Bacteria 3117
224 Ga0495624_0120894 3300046690 Bacteria 1608
225 Ga0495581_0062078 3300047315 Bacteria 2159
226 Ga0495674_0151700 3300047319 Bacteria 1942
227 Ga0495676_0112258 3300047321 Bacteria 1998
228 Ga0495593_0007452 3300047673 Bacteria 6401
229 Ga0496102_0074959 3300048905 Bacteria 3110
230 Ga0496104_0664095 3300048907 Bacteria 951
231 Ga0496108_0193349 3300048911 Bacteria 1764
232 Ga0496108_0346381 3300048911 Bacteria 1296
233 Ga0496109_0061727 3300048912 Bacteria 3427
234 Ga0496109_0324116 3300048912 Bacteria 1454
235 Ga0496109_0346224 3300048912 Bacteria 1404
236 Ga0496110_0125492 3300048913 Bacteria 2316
237 Ga0496111_0187909 3300048914 Bacteria 1536
238 Ga0496112_0021467 3300048915 Bacteria 6141
239 Ga0496112_0118296 3300048915 Bacteria 2620
240 Ga0496112_0175285 3300048915 Bacteria 2109
241 Ga0496112_0253935 3300048915 Bacteria 1709
242 Ga0496115_0112143 3300048918 Bacteria 2241
243 Ga0496117_0038593 3300048920 Bacteria 3537
244 Ga0496118_0000067 3300048921 Bacteria 207219
245 Ga0501032_0005861 3300049569 Bacteria 9087
246 Ga0501034_0193710 3300049571 Bacteria 1994
247 Ga0501034_0568594 3300049571 Unclassified 1042
248 Ga0501037_0026585 3300049573 Bacteria 4277
249 Ga0501040_0137015 3300049576 Bacteria 1724
250 Ga0501047_0160592 3300049581 Bacteria 2119
251 Ga0501068_0013972 3300049584 Bacteria 4581
252 Ga0501069_0001530 3300049585 Bacteria 11434
253 Ga0501070_0001134 3300049586 Bacteria 23896
254 Ga0501070_0002163 3300049586 Bacteria 17260
255 Ga0501070_0008553 3300049586 Bacteria 8654
256 Ga0501070_0011179 3300049586 Bacteria 7578
257 Ga0501073_0070074 3300049589 Bacteria 2443
258 Ga0501073_0126799 3300049589 Bacteria 1769
259 Ga0501074_0001493 3300049590 Bacteria 15746
260 Ga0501076_0052325 3300049592 Bacteria 3235
261 Ga0501079_0000113 3300049741 Bacteria 41839
262 Ga0501080_0002912 3300049742 Bacteria 15056
263 Ga0501080_0007512 3300049742 Bacteria 9844
264 Ga0501080_0360668 3300049742 Bacteria 1311
265 Ga0501044_0048125 3300049823 Bacteria 4406
266 Ga0501044_0105615 3300049823 Bacteria 2829
267 nmdc:mga03n38_4647_c1 3300050490 Bacteria 4578
268 nmdc:mga00v17_44799_c1 3300050491 Bacteria 2670
269 nmdc:mga07m45_31945_c1 3300050496 Bacteria 2919
270 nmdc:mga05p37_116300_c1 3300050507 Bacteria 3286
271 nmdc:mga05p37_322484_c1 3300050507 Bacteria 1828
272 nmdc:mga05p37_349800_c1 3300050507 Unclassified 1740
273 nmdc:mga05p37_48575_c1 3300050507 Bacteria 5218
274 nmdc:mga05p37_50635_c1 3300050507 Bacteria 5109
275 nmdc:mga09592_10977_c1 3300050508 Bacteria 7369
276 nmdc:mga09592_39415_c1 3300050508 Bacteria 3969
277 nmdc:mga0qj67_25933_c1 3300050509 Bacteria 4534
278 nmdc:mga0qj67_32219_c1 3300050509 Bacteria 4086
279 nmdc:mga0qj67_40660_c1 3300050509 Bacteria 3654
280 nmdc:mga06r32_168477_c1 3300050510 Bacteria 2174
281 nmdc:mga06r32_24357_c1 3300050510 Bacteria 5616
282 nmdc:mga06r32_257148_c1 3300050510 Bacteria 1734
283 nmdc:mga06r32_267919_c1 3300050510 Bacteria 1695
284 nmdc:mga08y16_130936_c1 3300050511 Bacteria 2608
285 nmdc:mga08y16_210853_c1 3300050511 Bacteria 2012
286 nmdc:mga08y16_64168_c1 3300050511 Bacteria 3835
287 nmdc:mga0n895_114894_c1 3300050512 Bacteria 2710
288 nmdc:mga0n895_119268_c1 3300050512 Bacteria 2659
289 nmdc:mga0n895_264850_c1 3300050512 Unclassified 1744
290 nmdc:mga0n895_68529_c1 3300050512 Bacteria 3515
291 nmdc:mga0rr50_121501_c1 3300050513 Bacteria 2079
292 nmdc:mga0rr50_12303_c1 3300050513 Bacteria 5524
293 nmdc:mga08x19_37100_c1 3300050514 Bacteria 3091
294 nmdc:mga08x19_66190_c1 3300050514 Unclassified 2348
295 nmdc:mga0a205_15559_c1 3300050515 Bacteria 7109
296 Ga0495601_0090457 3300053077 Bacteria 1969
297 Ga0495612_0081257 3300053078 Bacteria 1362
298 Ga0500562_049733 3300053108 Bacteria 1121
299 Ga0500616_0001702 3300053153 Bacteria 20227
300 Ga0500616_0003999 3300053153 Bacteria 10754
301 Ga0501084_0000010 3300054114 Bacteria 187712
302 Ga0501084_0273264 3300054114 Bacteria 1427
303 Ga0501082_0306227 3300060353 Bacteria 1384
304 Ga0501082_0340596 3300060353 Bacteria 1307
305 Ga0466962_0037682 3300061719 Bacteria 2316
306 Ga0530510_0003267 3300061734 Bacteria 11147
307 2558908250 2558860112 Bacteria 9931328
308 2676482468 2675903059 Bacteria 8644972
309 2870789534 2870782633 Bacteria 9624083
310 Ga0070714_100000016
311 Ga0070658_10000362
312 Ga0070658_10149302
313 Ga0070680_100000303
314 Ga0070660_100341623
315 Ga0070669_100123580
316 Ga0070675_100092768
317 Ga0070714_100057982
318 Ga0070714_100061044
319 Ga0070714_100153159
320 Ga0070713_100327262
321 Ga0070694_100028431
322 Ga0070708_100007084
323 Ga0070708_100017983
324 Ga0070708_100074585
325 Ga0070708_100324889
326 Ga0070663_100061886
327 Ga0070681_10001225
328 Ga0070706_100005557
329 Ga0070706_100020862
330 Ga0070706_100067984
331 Ga0070706_100103606
332 Ga0070707_100079011
333 Ga0070707_100188648
334 Ga0070698_100000043
335 Ga0070698_100003401
336 Ga0070698_100004804
337 Ga0070698_100025738
338 Ga0070698_100104235
339 Ga0070698_100326754
340 Ga0070698_100327521
341 Ga0070699_100000203
342 Ga0070699_100045966
343 Ga0070699_100156655
344 Ga0070699_100165657
345 Ga0070699_100413820
346 Ga0070679_100007012
347 Ga0070697_100022025
348 Ga0070697_100299786
349 Ga0070695_100004500
350 Ga0070696_100071530
351 Ga0070704_100171974
352 Ga0068856_100325243
353 Ga0081455_10048062
354 Ga0081455_10236209
355 Ga0070717_10012687
356 Ga0075363_100016958
357 Ga0070716_100024547
358 Ga0075428_100000002
359 Ga0075428_100019241
360 Ga0075428_100028312
361 Ga0075428_100068543
362 Ga0075428_100088117
363 Ga0075428_100150227
364 Ga0075428_100337070
365 Ga0075430_100008152
366 Ga0075430_100047037
367 Ga0075431_100002091
368 Ga0075431_100027340
369 Ga0075431_100076047
370 Ga0075433_10003698
371 Ga0075434_100019560
372 Ga0075434_100121054
373 Ga0075429_100006632
374 Ga0075436_100080175
375 Ga0075435_100003071
376 Ga0099794_10015203
377 Ga0111539_10022823
378 Ga0111539_10117204
379 Ga0111539_10242793
380 Ga0111539_10258543
381 Ga0111539_10319576
382 Ga0105245_10115421
383 Ga0105245_10607526
384 Ga0114129_10061433
385 Ga0114129_10159599
386 Ga0114129_10164218
387 Ga0114129_10259081
388 Ga0114129_10508684
389 Ga0114129_10545579
390 Ga0105243_10152461
391 Ga0105238_10478822
392 Ga0105249_10176414
393 Ga0105246_10066025
394 Ga0105246_10214897
395 Ga0157374_10185957
396 Ga0163162_10167548
397 Ga0157375_10349568
398 Ga0157375_10754031
399 Ga0157379_10000377
400 Ga0197907_10347100
401 Ga0206354_10590393
402 Ga0206354_11163324
403 Ga0206353_10051367
404 Ga0206353_11663917
405 Ga0213873_10000108
406 Ga0213876_10001978
407 Ga0213876_10009046
408 Ga0213876_10034682
409 Ga0213876_10039641
410 Ga0213876_10074622
411 Ga0207643_10047977
412 Ga0207705_10002639
413 Ga0207684_10093118
414 Ga0207707_10000518
415 Ga0207693_10260773
416 Ga0207660_10005495
417 Ga0207652_10001743
418 Ga0207646_10060704
419 Ga0207646_10394883
420 Ga0207646_10456021
421 Ga0207681_10182207
422 Ga0207681_10256421
423 Ga0207659_10171318
424 Ga0207664_10000011
425 Ga0207665_10047278
426 Ga0207678_10044236
427 Ga0207702_10362860
428 Ga0207675_100374692
429 Ga0207683_10445714
430 Ga0207428_10038331
431 Ga0268265_10276696
432 Ga0265322_10001062
433 Ga0265338_10000267
434 Ga0265330_10001083
435 Ga0265332_10000288
436 Ga0265332_10009100
437 Ga0265325_10001938
438 Ga0265329_10000927
439 Ga0265329_10006556
440 Ga0265329_10041659
441 Ga0265339_10001810
442 Ga0265331_10017351
443 Ga0265327_10012089
444 Ga0265316_10000112
445 Ga0265313_10000281
446 Ga0265342_10000183
447 Ga0316576_10008679
448 Ga0316578_10064016
449 Ga0373926_0011063
450 Ga0373934_0006282
451 Ga0373954_0022073
452 Ga0373956_0003328
453 Ga0316574_0073730
454 Ga0316574_0228806
455 Ga0373924_0013927
456 Ga0373935_0016297
457 Ga0373935_0035811
458 Ga0373927_0004452
459 Ga0373927_0172529
460 Ga0373947_0004467
461 Ga0373947_0085594
462 Ga0373947_0165259
463 Ga0373937_0102516
464 Ga0373937_0122807
465 Ga0316584_0035947
466 Ga0316584_0122107
467 Ga0373925_0024971
468 Ga0436364_0745069
469 Ga0436364_0888171
470 Ga0395901_0235520
471 Ga0436365_0151618
472 Ga0436365_0191946
473 Ga0436365_0293426
474 Ga0436365_0305834
475 Ga0436365_0316840
476 Ga0436365_1017373
477 Ga0436360_1110662
478 Ga0436363_0535625
479 Ga0436363_0950365
480 Ga0436362_0366100
481 Ga0436362_0388883
482 Ga0436362_0739437
483 Ga0451802_1325762
484 Ga0466969_0014114
485 Ga0466969_0024749
486 Ga0466965_0110538
487 Ga0466966_0003287
488 Ga0466966_0006273
489 Ga0466966_0007267
490 Ga0466961_0007216
491 Ga0466961_0007758
492 Ga0466963_0005630
493 Ga0466963_0104226
494 Ga0466963_0121920
495 Ga0466963_0288570
496 Ga0466963_0347442
497 Ga0466971_0013252
498 Ga0466971_0026395
499 Ga0466971_0028577
500 Ga0466971_0046428
501 Ga0466971_0083373
502 Ga0466968_0001736
503 Ga0466968_0005961
504 Ga0466970_0100455
505 Ga0466957_0001881
506 Ga0466957_0009864
507 Ga0466957_0048456
508 Ga0466959_0001049
509 Ga0466959_0022031
510 Ga0466959_0023710
511 Ga0466959_0130045
512 Ga0466958_0001334
513 Ga0466958_0002174
514 Ga0466958_0003162
515 Ga0466958_0003841
516 Ga0466958_0147780
517 Ga0466967_0019613
518 Ga0466967_0028014
519 Ga0466967_0115427
520 Ga0466967_0260799
521 Ga0466967_0260814
522 Ga0495603_0037312
523 Ga0495629_0085401
524 Ga0495641_0067269
525 Ga0495653_0326759
526 Ga0495580_0007667
527 Ga0495630_0289429
528 Ga0495666_0067939
529 Ga0495640_0026798
530 Ga0495621_0062030
531 Ga0495647_0031043
532 Ga0495658_0026319
533 Ga0495624_0120894
534 Ga0495581_0062078
535 Ga0495674_0151700
536 Ga0495676_0112258
537 Ga0495593_0007452
538 Ga0496102_0074959
539 Ga0496104_0664095
540 Ga0496108_0193349
541 Ga0496108_0346381
542 Ga0496109_0061727
543 Ga0496109_0324116
544 Ga0496109_0346224
545 Ga0496110_0125492
546 Ga0496111_0187909
547 Ga0496112_0021467
548 Ga0496112_0118296
549 Ga0496112_0175285
550 Ga0496112_0253935
551 Ga0496115_0112143
552 Ga0496117_0038593
553 Ga0496118_0000067
554 Ga0501032_0005861
555 Ga0501034_0193710
556 Ga0501034_0568594
557 Ga0501037_0026585
558 Ga0501040_0137015
559 Ga0501047_0160592
560 Ga0501068_0013972
561 Ga0501069_0001530
562 Ga0501070_0001134
563 Ga0501070_0002163
564 Ga0501070_0008553
565 Ga0501070_0011179
566 Ga0501073_0070074
567 Ga0501073_0126799
568 Ga0501074_0001493
569 Ga0501076_0052325
570 Ga0501079_0000113
571 Ga0501080_0002912
572 Ga0501080_0007512
573 Ga0501080_0360668
574 Ga0501044_0048125
575 Ga0501044_0105615
576 nmdc:mga03n38_4647_c1
577 nmdc:mga00v17_44799_c1
578 nmdc:mga07m45_31945_c1
579 nmdc:mga05p37_116300_c1
580 nmdc:mga05p37_322484_c1
581 nmdc:mga05p37_349800_c1
582 nmdc:mga05p37_48575_c1
583 nmdc:mga05p37_50635_c1
584 nmdc:mga09592_10977_c1
585 nmdc:mga09592_39415_c1
586 nmdc:mga0qj67_25933_c1
587 nmdc:mga0qj67_32219_c1
588 nmdc:mga0qj67_40660_c1
589 nmdc:mga06r32_168477_c1
590 nmdc:mga06r32_24357_c1
591 nmdc:mga06r32_257148_c1
592 nmdc:mga06r32_267919_c1
593 nmdc:mga08y16_130936_c1
594 nmdc:mga08y16_210853_c1
595 nmdc:mga08y16_64168_c1
596 nmdc:mga0n895_114894_c1
597 nmdc:mga0n895_119268_c1
598 nmdc:mga0n895_264850_c1
599 nmdc:mga0n895_68529_c1
600 nmdc:mga0rr50_121501_c1
601 nmdc:mga0rr50_12303_c1
602 nmdc:mga08x19_37100_c1
603 nmdc:mga08x19_66190_c1
604 nmdc:mga0a205_15559_c1
605 Ga0495601_0090457
606 Ga0495612_0081257
607 Ga0500562_049733
608 Ga0500616_0001702
609 Ga0500616_0003999
610 Ga0501084_0000010
611 Ga0501084_0273264
612 Ga0501082_0306227
613 Ga0501082_0340596
614 Ga0466962_0037682
615 Ga0530510_0003267
616 2558908250
617 2676482468
618 2870789534

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01040

UbiA

UbiA prenyltransferase family

70

329

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
8djm-assembly1.cif.gz_B hmgcr-ubiad1 complex state 1 0.8039 62 344
4od4-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7578 60 346
4od4-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7408 60 346
8djm-assembly1.cif.gz_B hmgcr-ubiad1 complex state 1 0.7233 62 344
7bpu-assembly1.cif.gz_A structural and mechanistic insights into the biosynthesis of digeranylgeranylglyceryl phosphate synthase in membranes 0.7014 48 348
ID Description Score Start End Superfamily
af_Q2FZM0_17_182_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.8748 55 215 1.10.357.140
af_Q2FZM0_184_310_1.20.120.1780 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);UbiA prenyltransferase 0.8687 220 350 1.20.120.1780
af_A0A0R0HE87_7_161_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.8671 164 306 1.20.1070.10
af_Q54K99_53_319_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.8584 64 344 1.10.357.140
af_P9WIP3_19_264_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.8503 62 306 1.10.357.140
ID Description Score Start End GO Terms
AF-A0A7J9VZ23-F1-model_v4 Prenyltransferase 0.9928 37 352 GO:0004659
GO:0009234
GO:0016020
GO:0032194
GO:0042371
AF-A0A2E9GLU1-F1-model_v4 Prenyltransferase 0.9842 45 353 GO:0004659
GO:0009234
GO:0016020
GO:0032194
GO:0042371
AF-X8DLF5-F1-model_v4 UbiA prenyltransferase family protein 0.9836 203 351 GO:0004659
GO:0009234
GO:0016020
GO:0032194
GO:0042371
AF-A0A7J9VZ23-F1-model_v4 Prenyltransferase 0.9835 37 352 GO:0004659
GO:0009234
GO:0016020
GO:0032194
GO:0042371
AF-A0A1F8NQL7-F1-model_v4 Prenyltransferase 0.9814 28 253 GO:0004659
GO:0009234
GO:0016020
GO:0032194
GO:0042371

Map