F399845

General Info

Members Datasets Scaffolds Average Seq Length
308 223 616 96

Family's Representative Sequence

Representative Sequence 3300046492|Ga0495585_0368280|Ga0495585_0368280_238_579
Length 113
Sequence LYREAGLRDDLLQGMLLTMDLEFSGEMWFWRGPAPWHFVTVPDDECQAIAAAAALVTYGWGMIPVSARIGRTGWTTSLWPKDGKYIVPVKTVVRRAEGLEVGDTVTVSLIVDA

Samples

Sample ID Description Type Environment
1 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
99 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
100 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
101 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
102 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
103 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
104 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
105 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
106 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
107 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
108 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
112 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
113 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
114 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
115 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
116 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
117 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
118 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
119 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
120 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
121 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
122 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
126 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
127 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
128 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
129 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
130 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
131 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
132 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
133 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
134 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
135 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
136 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
137 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
138 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
139 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
140 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
141 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
142 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
143 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
144 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
145 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
146 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
147 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
150 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
151 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
152 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
153 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
154 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
155 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
156 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
157 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
158 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
159 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
160 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
161 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
162 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
163 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
188 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
189 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
190 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
191 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
192 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
193 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
194 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
195 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
196 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
197 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
198 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
201 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
202 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
203 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
204 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
205 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
206 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
207 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
209 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
210 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
211 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
212 2643221549 Agromyces sp. Root1464 Isolate Unclassified
213 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
214 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
215 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
216 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
217 2858868258 Micromonospora sp. MH33 Isolate Unclassified
218 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
219 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
220 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
221 2902582711 Micromonospora sp. AP08 Isolate Unclassified
222 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
223 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.78
Metatranscriptomes 0.32
Isolates 3.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.62
Nodule 0
Rhizoplane 7.14
Rhizosphere 85.06
Stem 0
Stem Tuber 0
Unclassified 2.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495585_0368280 3300046492 Bacteria 696
2 rootH1_10042825 3300003316 Bacteria 2433
3 rootH1_10324674 3300003323 Bacteria 1439
4 Ga0070658_10385796 3300005327 Bacteria 1202
5 Ga0070683_100586010 3300005329 Bacteria 1067
6 Ga0070680_100166645 3300005336 Bacteria 1853
7 Ga0070680_101375652 3300005336 Bacteria 611
8 Ga0070682_100513350 3300005337 Bacteria 931
9 Ga0070682_101179661 3300005337 Bacteria 645
10 Ga0068868_100696834 3300005338 Bacteria 908
11 Ga0070660_100334642 3300005339 Bacteria 1245
12 Ga0070692_10078509 3300005345 Bacteria 1773
13 Ga0070692_11072803 3300005345 Bacteria 567
14 Ga0070668_100033382 3300005347 Bacteria 3919
15 Ga0070668_100146411 3300005347 Bacteria 1907
16 Ga0070675_100075951 3300005354 Bacteria 2794
17 Ga0070688_100499037 3300005365 Bacteria 918
18 Ga0070659_100035140 3300005366 Bacteria 3901
19 Ga0070667_100039022 3300005367 Bacteria 3980
20 Ga0070713_100645531 3300005436 Bacteria 1008
21 Ga0070700_100000124 3300005441 Bacteria 47077
22 Ga0070700_100031628 3300005441 Bacteria 3173
23 Ga0070700_100073486 3300005441 Bacteria 2189
24 Ga0070708_101478760 3300005445 Bacteria 633
25 Ga0070663_100200553 3300005455 Bacteria 1557
26 Ga0070678_100959636 3300005456 Bacteria 784
27 Ga0070681_10019919 3300005458 Bacteria 6722
28 Ga0070707_101645856 3300005468 Bacteria 609
29 Ga0070679_100091282 3300005530 Bacteria 3034
30 Ga0070684_100130829 3300005535 Bacteria 2264
31 Ga0070684_101375004 3300005535 Bacteria 665
32 Ga0070665_100120383 3300005548 Bacteria 2627
33 Ga0070665_101397036 3300005548 Bacteria 709
34 Ga0068855_100213443 3300005563 Bacteria 2168
35 Ga0070664_100099843 3300005564 Bacteria 2523
36 Ga0070664_101933688 3300005564 Bacteria 560
37 Ga0068864_100078864 3300005618 Bacteria 2883
38 Ga0068864_100537281 3300005618 Bacteria 1129
39 Ga0068861_100430114 3300005719 Bacteria 1178
40 Ga0068863_100048573 3300005841 Bacteria 4024
41 Ga0068863_100526961 3300005841 Bacteria 1165
42 Ga0068863_100631348 3300005841 Bacteria 1061
43 Ga0068858_100131852 3300005842 Bacteria 2344
44 Ga0068858_100336181 3300005842 Bacteria 1445
45 Ga0068862_100600806 3300005844 Bacteria 1056
46 Ga0081455_10014317 3300005937 Bacteria 7782
47 Ga0081539_10018164 3300005985 Bacteria 4895
48 Ga0070717_10244098 3300006028 Bacteria 1585
49 Ga0075365_10410641 3300006038 Bacteria 956
50 Ga0075363_100284335 3300006048 Bacteria 957
51 Ga0075366_10856776 3300006195 Bacteria 566
52 Ga0075428_100006805 3300006844 Bacteria 12722
53 Ga0075428_100595319 3300006844 Bacteria 1181
54 Ga0075430_100018085 3300006846 Bacteria 5998
55 Ga0075430_100212338 3300006846 Bacteria 1605
56 Ga0075431_100015126 3300006847 Bacteria 7816
57 Ga0075429_101869773 3300006880 Bacteria 520
58 Ga0105244_10051414 3300009036 Bacteria 2100
59 Ga0111539_11797804 3300009094 Bacteria 711
60 Ga0105245_10357565 3300009098 Bacteria 1448
61 Ga0105245_10899726 3300009098 Bacteria 927
62 Ga0105247_10581830 3300009101 Bacteria 828
63 Ga0114129_10026013 3300009147 Bacteria 8287
64 Ga0114129_10283712 3300009147 Bacteria 2212
65 Ga0114129_10454058 3300009147 Bacteria 1680
66 Ga0114129_10849562 3300009147 Bacteria 1161
67 Ga0105243_10251551 3300009148 Bacteria 1578
68 Ga0105243_10780957 3300009148 Bacteria 939
69 Ga0105242_13306286 3300009176 Bacteria 501
70 Ga0105237_10702889 3300009545 Bacteria 1017
71 Ga0105249_10107462 3300009553 Bacteria 2634
72 Ga0105249_11543541 3300009553 Bacteria 736
73 Ga0105239_13415148 3300010375 Bacteria 516
74 Ga0157370_12125826 3300013104 Bacteria 503
75 Ga0157369_11583969 3300013105 Bacteria 666
76 Ga0157374_12944552 3300013296 Bacteria 503
77 Ga0157378_12414535 3300013297 Bacteria 578
78 Ga0163162_11211552 3300013306 Bacteria 857
79 Ga0163163_10004013 3300014325 Bacteria 12555
80 Ga0163163_10768533 3300014325 Bacteria 1027
81 Ga0157380_10022259 3300014326 Bacteria 4767
82 Ga0182008_10922323 3300014497 Unclassified 515
83 Ga0157377_10484332 3300014745 Bacteria 861
84 Ga0157377_10550360 3300014745 Bacteria 815
85 Ga0157379_10049826 3300014968 Bacteria 3739
86 Ga0157379_10276814 3300014968 Bacteria 1527
87 Ga0157376_11122125 3300014969 Bacteria 813
88 Ga0224712_10063333 3300022467 Bacteria 1480
89 Ga0207688_10082459 3300025901 Bacteria 1838
90 Ga0207643_10166221 3300025908 Bacteria 1329
91 Ga0207705_10314737 3300025909 Bacteria 1202
92 Ga0207705_11416636 3300025909 Bacteria 528
93 Ga0207707_10032519 3300025912 Bacteria 4566
94 Ga0207693_10435833 3300025915 Bacteria 1024
95 Ga0207660_10279307 3300025917 Bacteria 1325
96 Ga0207652_10159469 3300025921 Bacteria 2022
97 Ga0207652_10631633 3300025921 Bacteria 959
98 Ga0207650_11264877 3300025925 Bacteria 628
99 Ga0207659_10058155 3300025926 Bacteria 2775
100 Ga0207687_10481087 3300025927 Bacteria 1034
101 Ga0207700_10081498 3300025928 Bacteria 2527
102 Ga0207690_10016824 3300025932 Bacteria 4456
103 Ga0207709_10189089 3300025935 Bacteria 1461
104 Ga0207689_10896475 3300025942 Bacteria 748
105 Ga0207661_10381445 3300025944 Bacteria 1276
106 Ga0207661_11692509 3300025944 Bacteria 578
107 Ga0207679_10052817 3300025945 Bacteria 2982
108 Ga0207667_10696720 3300025949 Bacteria 1018
109 Ga0207712_10051915 3300025961 Bacteria 2870
110 Ga0207668_10024122 3300025972 Bacteria 3921
111 Ga0207658_10093758 3300025986 Bacteria 2335
112 Ga0207658_10213108 3300025986 Bacteria 1620
113 Ga0207677_10819948 3300026023 Bacteria 834
114 Ga0207703_10123389 3300026035 Bacteria 2227
115 Ga0207703_11293434 3300026035 Bacteria 701
116 Ga0207639_11974213 3300026041 Bacteria 544
117 Ga0207678_10116585 3300026067 Bacteria 2279
118 Ga0207678_11345948 3300026067 Bacteria 631
119 Ga0207708_10000023 3300026075 Bacteria 176615
120 Ga0207708_10010239 3300026075 Bacteria 6963
121 Ga0207708_10099868 3300026075 Bacteria 2245
122 Ga0207708_10584107 3300026075 Bacteria 945
123 Ga0207676_10229034 3300026095 Bacteria 1660
124 Ga0207676_10846165 3300026095 Bacteria 895
125 Ga0207674_10027412 3300026116 Bacteria 6026
126 Ga0207674_10788239 3300026116 Bacteria 917
127 Ga0207674_10810339 3300026116 Bacteria 903
128 Ga0207675_101107664 3300026118 Bacteria 812
129 Ga0207675_101370780 3300026118 Bacteria 728
130 Ga0207683_10987914 3300026121 Bacteria 781
131 Ga0207683_11471580 3300026121 Bacteria 629
132 Ga0207428_10194828 3300027907 Bacteria 1526
133 Ga0268266_10093088 3300028379 Bacteria 2645
134 Ga0268265_10369666 3300028380 Bacteria 1316
135 Ga0268265_10799131 3300028380 Unclassified 919
136 Ga0268264_10623508 3300028381 Bacteria 1065
137 Ga0307515_10027944 3300028794 Bacteria 9611
138 Ga0307515_10037790 3300028794 Bacteria 7747
139 Ga0265338_10471200 3300028800 Bacteria 887
140 Ga0307512_10025324 3300030522 Bacteria 5260
141 Ga0307513_10004072 3300031456 Bacteria 19582
142 Ga0307509_10059992 3300031507 Bacteria 4023
143 Ga0307408_100950603 3300031548 Bacteria 789
144 Ga0307408_101596897 3300031548 Bacteria 619
145 Ga0307405_10010147 3300031731 Bacteria 4863
146 Ga0307413_10474200 3300031824 Bacteria 999
147 Ga0307413_10666258 3300031824 Bacteria 860
148 Ga0307413_10820643 3300031824 Bacteria 783
149 Ga0307410_12043702 3300031852 Unclassified 512
150 Ga0307406_10015598 3300031901 Bacteria 4400
151 Ga0307407_10008484 3300031903 Bacteria 4721
152 Ga0307407_10130257 3300031903 Bacteria 1608
153 Ga0307407_11455097 3300031903 Bacteria 541
154 Ga0307409_100000459 3300031995 Bacteria 17343
155 Ga0307409_100303713 3300031995 Bacteria 1486
156 Ga0307409_100562189 3300031995 Bacteria 1122
157 Ga0307409_100599263 3300031995 Bacteria 1089
158 Ga0307409_101401992 3300031995 Bacteria 725
159 Ga0307409_101526215 3300031995 Bacteria 696
160 Ga0307416_100002396 3300032002 Bacteria 10742
161 Ga0307416_102133195 3300032002 Bacteria 662
162 Ga0307416_102346989 3300032002 Bacteria 633
163 Ga0307411_11189847 3300032005 Bacteria 691
164 Ga0307415_100000084 3300032126 Bacteria 38884
165 Ga0307415_100286217 3300032126 Bacteria 1358
166 Ga0307415_100557130 3300032126 Bacteria 1013
167 Ga0307415_100994127 3300032126 Bacteria 779
168 Ga0307507_10194025 3300033179 Bacteria 1420
169 Ga0373948_0006341 3300034817 Bacteria 1952
170 Ga0373950_0003137 3300034818 Bacteria 2337
171 Ga0373941_0022150 3300035115 Bacteria 1800
172 Ga0373960_0397745 3300035121 Bacteria 531
173 Ga0373943_0035128 3300035170 Bacteria 2394
174 Ga0373942_0004025 3300035207 Bacteria 3432
175 Ga0373935_0257755 3300035692 Bacteria 1222
176 Ga0316584_0819188 3300036712 Bacteria 631
177 Ga0373925_1019932 3300037068 Bacteria 681
178 Ga0373925_1588548 3300037068 Bacteria 535
179 Ga0395898_1031195 3300037466 Unclassified 758
180 Ga0395898_1412033 3300037466 Bacteria 624
181 Ga0395901_0120437 3300038443 Unclassified 2758
182 Ga0395901_0424679 3300038443 Bacteria 1363
183 Ga0439447_018071 3300041407 Bacteria 1909
184 Ga0439466_0150799 3300041411 Bacteria 712
185 Ga0451839_0812853 3300041496 Bacteria 611
186 Ga0451847_0441214 3300041503 Bacteria 586
187 Ga0451853_1584159 3300041512 Bacteria 1044
188 Ga0439431_0011836 3300041997 Bacteria 1998
189 Ga0439433_0150909 3300041999 Bacteria 598
190 Ga0439442_062853 3300042002 Bacteria 788
191 Ga0439445_0134161 3300042004 Bacteria 715
192 Ga0439432_140073 3300042006 Bacteria 712
193 Ga0439446_0014694 3300042156 Bacteria 2164
194 Ga0439434_0004202 3300042435 Bacteria 4205
195 Ga0466969_0259590 3300044656 Bacteria 787
196 Ga0466969_0455434 3300044656 Bacteria 582
197 Ga0466966_0110690 3300044684 Bacteria 1693
198 Ga0466961_0806400 3300044693 Bacteria 560
199 Ga0466963_0062443 3300044694 Bacteria 2492
200 Ga0466963_0379746 3300044694 Bacteria 996
201 Ga0466964_0474182 3300044706 Bacteria 668
202 Ga0466971_0400135 3300044719 Bacteria 669
203 Ga0466968_0700451 3300044735 Unclassified 517
204 Ga0466957_0071125 3300044842 Bacteria 2151
205 Ga0466957_0082313 3300044842 Bacteria 2006
206 Ga0466960_0023033 3300044901 Bacteria 2792
207 Ga0466960_0435141 3300044901 Bacteria 760
208 Ga0466959_0501678 3300045049 Bacteria 820
209 Ga0466958_0087014 3300045836 Bacteria 1929
210 Ga0466958_0092936 3300045836 Bacteria 1868
211 Ga0466958_0807247 3300045836 Bacteria 612
212 Ga0466967_0418131 3300045976 Bacteria 1306
213 Ga0466967_1121072 3300045976 Bacteria 784
214 Ga0495603_0282992 3300046455 Bacteria 953
215 Ga0495629_0022997 3300046459 Bacteria 4443
216 Ga0495638_0335174 3300046460 Bacteria 803
217 Ga0495582_0153441 3300046473 Bacteria 1308
218 Ga0495606_0006881 3300046507 Bacteria 10363
219 Ga0495608_0556099 3300046511 Bacteria 691
220 Ga0495656_0452046 3300046615 Bacteria 677
221 Ga0495668_0000208 3300046616 Bacteria 84956
222 Ga0495625_0002667 3300046660 Bacteria 18987
223 Ga0495670_0451887 3300046691 Bacteria 696
224 Ga0495670_0679267 3300046691 Bacteria 561
225 Ga0495676_0380537 3300047321 Bacteria 939
226 Ga0495683_0014547 3300047323 Bacteria 4100
227 Ga0495626_0000479 3300048091 Bacteria 40352
228 Ga0496100_0415007 3300048903 Bacteria 1027
229 Ga0496101_1439218 3300048904 Bacteria 537
230 Ga0496102_0025114 3300048905 Bacteria 5300
231 Ga0496102_0027463 3300048905 Bacteria 5083
232 Ga0496103_0069476 3300048906 Bacteria 2202
233 Ga0496103_0148664 3300048906 Bacteria 1500
234 Ga0496104_0007709 3300048907 Bacteria 9533
235 Ga0496105_0171475 3300048908 Bacteria 1778
236 Ga0496106_0373070 3300048909 Bacteria 1147
237 Ga0496107_0222001 3300048910 Bacteria 1406
238 Ga0496107_0969995 3300048910 Bacteria 618
239 Ga0496108_0005184 3300048911 Bacteria 10529
240 Ga0496109_0112661 3300048912 Bacteria 2530
241 Ga0496109_0584495 3300048912 Bacteria 1052
242 Ga0496110_0017124 3300048913 Bacteria 6059
243 Ga0496111_0009119 3300048914 Bacteria 6603
244 Ga0496112_0113330 3300048915 Bacteria 2682
245 Ga0496113_0003938 3300048916 Bacteria 9006
246 Ga0496113_1078689 3300048916 Bacteria 630
247 Ga0496113_1439804 3300048916 Unclassified 533
248 Ga0496114_0339510 3300048917 Bacteria 1328
249 Ga0496114_0363107 3300048917 Bacteria 1281
250 Ga0501031_0003686 3300049568 Bacteria 9853
251 Ga0501033_0103142 3300049570 Bacteria 2080
252 Ga0501036_0036729 3300049572 Bacteria 4146
253 Ga0501037_0015243 3300049573 Bacteria 5655
254 Ga0501040_0037325 3300049576 Bacteria 3300
255 Ga0501041_0006357 3300049577 Bacteria 6913
256 Ga0501042_0008662 3300049578 Bacteria 6740
257 Ga0501043_0096599 3300049579 Bacteria 2322
258 Ga0501046_0172598 3300049580 Bacteria 1621
259 Ga0501048_0016896 3300049582 Bacteria 5379
260 Ga0501068_0062918 3300049584 Bacteria 2257
261 Ga0501068_0456295 3300049584 Bacteria 827
262 Ga0501068_0639298 3300049584 Bacteria 694
263 Ga0501071_0756888 3300049587 Bacteria 748
264 Ga0501072_0047576 3300049588 Bacteria 3377
265 Ga0501073_0313644 3300049589 Bacteria 1082
266 Ga0501073_0415194 3300049589 Bacteria 930
267 Ga0501074_0457947 3300049590 Bacteria 904
268 Ga0501075_0003711 3300049591 Bacteria 10257
269 Ga0501075_0813706 3300049591 Bacteria 711
270 Ga0501076_0015817 3300049592 Bacteria 5708
271 Ga0501076_1293433 3300049592 Bacteria 600
272 Ga0501077_0012160 3300049593 Bacteria 5387
273 Ga0501079_0060575 3300049741 Bacteria 2919
274 Ga0501080_0053251 3300049742 Bacteria 3767
275 Ga0501081_0035217 3300049743 Bacteria 3407
276 Ga0501035_0179168 3300049822 Bacteria 1827
277 Ga0501035_0657397 3300049822 Bacteria 849
278 Ga0501044_0157242 3300049823 Bacteria 2252
279 Ga0501045_0017130 3300049824 Bacteria 5145
280 Ga0501045_0203643 3300049824 Bacteria 1474
281 Ga0501045_0970007 3300049824 Bacteria 624
282 nmdc:mga0yw44_680769_c1 3300050492 Bacteria 699
283 nmdc:mga05p37_255669_c1 3300050507 Bacteria 2099
284 nmdc:mga05p37_5333_c1 3300050507 Bacteria 15102
285 nmdc:mga09592_1435201_c1 3300050508 Bacteria 563
286 nmdc:mga0qj67_1146941_c1 3300050509 Bacteria 606
287 nmdc:mga06r32_105302_c1 3300050510 Bacteria 2771
288 nmdc:mga06r32_269378_c1 3300050510 Bacteria 1690
289 nmdc:mga08y16_1313856_c1 3300050511 Bacteria 689
290 nmdc:mga08y16_187090_c1 3300050511 Bacteria 2148
291 Ga0500583_0238405 3300053092 Bacteria 900
292 Ga0501084_0011272 3300054114 Bacteria 7399
293 Ga0501082_0051789 3300060353 Bacteria 3538
294 Ga0466962_0194846 3300061719 Bacteria 989
295 Ga0530510_0004299 3300061734 Bacteria 9856
296 Ga0530510_0154150 3300061734 Bacteria 1697
297 2643766258 2643221549 Bacteria 4042819
298 2643850063 2643221567 Bacteria 4163945
299 2644136065 2643221624 Bacteria 4384879
300 2816421667 2816332119 Bacteria 8120218
301 2827629112 2827628540 Bacteria 6858585
302 2858868845 2858868258 Bacteria 7683772
303 2867308072 2867302475 Bacteria 7087181
304 2868091078 2868088558 Bacteria 7609351
305 2887484073 2887478801 Bacteria 8972725
306 2902583307 2902582711 Bacteria 6187705
307 8001783291 8001781756 Bacteria 9586736
308 8055181342 8055172936 Bacteria 9305943
309 Ga0495585_0368280
310 rootH1_10042825
311 rootH1_10324674
312 Ga0070658_10385796
313 Ga0070683_100586010
314 Ga0070680_100166645
315 Ga0070680_101375652
316 Ga0070682_100513350
317 Ga0070682_101179661
318 Ga0068868_100696834
319 Ga0070660_100334642
320 Ga0070692_10078509
321 Ga0070692_11072803
322 Ga0070668_100033382
323 Ga0070668_100146411
324 Ga0070675_100075951
325 Ga0070688_100499037
326 Ga0070659_100035140
327 Ga0070667_100039022
328 Ga0070713_100645531
329 Ga0070700_100000124
330 Ga0070700_100031628
331 Ga0070700_100073486
332 Ga0070708_101478760
333 Ga0070663_100200553
334 Ga0070678_100959636
335 Ga0070681_10019919
336 Ga0070707_101645856
337 Ga0070679_100091282
338 Ga0070684_100130829
339 Ga0070684_101375004
340 Ga0070665_100120383
341 Ga0070665_101397036
342 Ga0068855_100213443
343 Ga0070664_100099843
344 Ga0070664_101933688
345 Ga0068864_100078864
346 Ga0068864_100537281
347 Ga0068861_100430114
348 Ga0068863_100048573
349 Ga0068863_100526961
350 Ga0068863_100631348
351 Ga0068858_100131852
352 Ga0068858_100336181
353 Ga0068862_100600806
354 Ga0081455_10014317
355 Ga0081539_10018164
356 Ga0070717_10244098
357 Ga0075365_10410641
358 Ga0075363_100284335
359 Ga0075366_10856776
360 Ga0075428_100006805
361 Ga0075428_100595319
362 Ga0075430_100018085
363 Ga0075430_100212338
364 Ga0075431_100015126
365 Ga0075429_101869773
366 Ga0105244_10051414
367 Ga0111539_11797804
368 Ga0105245_10357565
369 Ga0105245_10899726
370 Ga0105247_10581830
371 Ga0114129_10026013
372 Ga0114129_10283712
373 Ga0114129_10454058
374 Ga0114129_10849562
375 Ga0105243_10251551
376 Ga0105243_10780957
377 Ga0105242_13306286
378 Ga0105237_10702889
379 Ga0105249_10107462
380 Ga0105249_11543541
381 Ga0105239_13415148
382 Ga0157370_12125826
383 Ga0157369_11583969
384 Ga0157374_12944552
385 Ga0157378_12414535
386 Ga0163162_11211552
387 Ga0163163_10004013
388 Ga0163163_10768533
389 Ga0157380_10022259
390 Ga0182008_10922323
391 Ga0157377_10484332
392 Ga0157377_10550360
393 Ga0157379_10049826
394 Ga0157379_10276814
395 Ga0157376_11122125
396 Ga0224712_10063333
397 Ga0207688_10082459
398 Ga0207643_10166221
399 Ga0207705_10314737
400 Ga0207705_11416636
401 Ga0207707_10032519
402 Ga0207693_10435833
403 Ga0207660_10279307
404 Ga0207652_10159469
405 Ga0207652_10631633
406 Ga0207650_11264877
407 Ga0207659_10058155
408 Ga0207687_10481087
409 Ga0207700_10081498
410 Ga0207690_10016824
411 Ga0207709_10189089
412 Ga0207689_10896475
413 Ga0207661_10381445
414 Ga0207661_11692509
415 Ga0207679_10052817
416 Ga0207667_10696720
417 Ga0207712_10051915
418 Ga0207668_10024122
419 Ga0207658_10093758
420 Ga0207658_10213108
421 Ga0207677_10819948
422 Ga0207703_10123389
423 Ga0207703_11293434
424 Ga0207639_11974213
425 Ga0207678_10116585
426 Ga0207678_11345948
427 Ga0207708_10000023
428 Ga0207708_10010239
429 Ga0207708_10099868
430 Ga0207708_10584107
431 Ga0207676_10229034
432 Ga0207676_10846165
433 Ga0207674_10027412
434 Ga0207674_10788239
435 Ga0207674_10810339
436 Ga0207675_101107664
437 Ga0207675_101370780
438 Ga0207683_10987914
439 Ga0207683_11471580
440 Ga0207428_10194828
441 Ga0268266_10093088
442 Ga0268265_10369666
443 Ga0268265_10799131
444 Ga0268264_10623508
445 Ga0307515_10027944
446 Ga0307515_10037790
447 Ga0265338_10471200
448 Ga0307512_10025324
449 Ga0307513_10004072
450 Ga0307509_10059992
451 Ga0307408_100950603
452 Ga0307408_101596897
453 Ga0307405_10010147
454 Ga0307413_10474200
455 Ga0307413_10666258
456 Ga0307413_10820643
457 Ga0307410_12043702
458 Ga0307406_10015598
459 Ga0307407_10008484
460 Ga0307407_10130257
461 Ga0307407_11455097
462 Ga0307409_100000459
463 Ga0307409_100303713
464 Ga0307409_100562189
465 Ga0307409_100599263
466 Ga0307409_101401992
467 Ga0307409_101526215
468 Ga0307416_100002396
469 Ga0307416_102133195
470 Ga0307416_102346989
471 Ga0307411_11189847
472 Ga0307415_100000084
473 Ga0307415_100286217
474 Ga0307415_100557130
475 Ga0307415_100994127
476 Ga0307507_10194025
477 Ga0373948_0006341
478 Ga0373950_0003137
479 Ga0373941_0022150
480 Ga0373960_0397745
481 Ga0373943_0035128
482 Ga0373942_0004025
483 Ga0373935_0257755
484 Ga0316584_0819188
485 Ga0373925_1019932
486 Ga0373925_1588548
487 Ga0395898_1031195
488 Ga0395898_1412033
489 Ga0395901_0120437
490 Ga0395901_0424679
491 Ga0439447_018071
492 Ga0439466_0150799
493 Ga0451839_0812853
494 Ga0451847_0441214
495 Ga0451853_1584159
496 Ga0439431_0011836
497 Ga0439433_0150909
498 Ga0439442_062853
499 Ga0439445_0134161
500 Ga0439432_140073
501 Ga0439446_0014694
502 Ga0439434_0004202
503 Ga0466969_0259590
504 Ga0466969_0455434
505 Ga0466966_0110690
506 Ga0466961_0806400
507 Ga0466963_0062443
508 Ga0466963_0379746
509 Ga0466964_0474182
510 Ga0466971_0400135
511 Ga0466968_0700451
512 Ga0466957_0071125
513 Ga0466957_0082313
514 Ga0466960_0023033
515 Ga0466960_0435141
516 Ga0466959_0501678
517 Ga0466958_0087014
518 Ga0466958_0092936
519 Ga0466958_0807247
520 Ga0466967_0418131
521 Ga0466967_1121072
522 Ga0495603_0282992
523 Ga0495629_0022997
524 Ga0495638_0335174
525 Ga0495582_0153441
526 Ga0495606_0006881
527 Ga0495608_0556099
528 Ga0495656_0452046
529 Ga0495668_0000208
530 Ga0495625_0002667
531 Ga0495670_0451887
532 Ga0495670_0679267
533 Ga0495676_0380537
534 Ga0495683_0014547
535 Ga0495626_0000479
536 Ga0496100_0415007
537 Ga0496101_1439218
538 Ga0496102_0025114
539 Ga0496102_0027463
540 Ga0496103_0069476
541 Ga0496103_0148664
542 Ga0496104_0007709
543 Ga0496105_0171475
544 Ga0496106_0373070
545 Ga0496107_0222001
546 Ga0496107_0969995
547 Ga0496108_0005184
548 Ga0496109_0112661
549 Ga0496109_0584495
550 Ga0496110_0017124
551 Ga0496111_0009119
552 Ga0496112_0113330
553 Ga0496113_0003938
554 Ga0496113_1078689
555 Ga0496113_1439804
556 Ga0496114_0339510
557 Ga0496114_0363107
558 Ga0501031_0003686
559 Ga0501033_0103142
560 Ga0501036_0036729
561 Ga0501037_0015243
562 Ga0501040_0037325
563 Ga0501041_0006357
564 Ga0501042_0008662
565 Ga0501043_0096599
566 Ga0501046_0172598
567 Ga0501048_0016896
568 Ga0501068_0062918
569 Ga0501068_0456295
570 Ga0501068_0639298
571 Ga0501071_0756888
572 Ga0501072_0047576
573 Ga0501073_0313644
574 Ga0501073_0415194
575 Ga0501074_0457947
576 Ga0501075_0003711
577 Ga0501075_0813706
578 Ga0501076_0015817
579 Ga0501076_1293433
580 Ga0501077_0012160
581 Ga0501079_0060575
582 Ga0501080_0053251
583 Ga0501081_0035217
584 Ga0501035_0179168
585 Ga0501035_0657397
586 Ga0501044_0157242
587 Ga0501045_0017130
588 Ga0501045_0203643
589 Ga0501045_0970007
590 nmdc:mga0yw44_680769_c1
591 nmdc:mga05p37_255669_c1
592 nmdc:mga05p37_5333_c1
593 nmdc:mga09592_1435201_c1
594 nmdc:mga0qj67_1146941_c1
595 nmdc:mga06r32_105302_c1
596 nmdc:mga06r32_269378_c1
597 nmdc:mga08y16_1313856_c1
598 nmdc:mga08y16_187090_c1
599 Ga0500583_0238405
600 Ga0501084_0011272
601 Ga0501082_0051789
602 Ga0466962_0194846
603 Ga0530510_0004299
604 Ga0530510_0154150
605 2643766258
606 2643850063
607 2644136065
608 2816421667
609 2827629112
610 2858868845
611 2867308072
612 2868091078
613 2887484073
614 2902583307
615 8001783291
616 8055181342

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08922

DUF1905

Domain of unknown function (DUF1905)

23

109

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d9r-assembly1.cif.gz_A structure of conserved protein of unknown function pg0164 from porphyromonas gingivalis [w83] 0.7983 1 93
2d9r-assembly1.cif.gz_A structure of conserved protein of unknown function pg0164 from porphyromonas gingivalis [w83] 0.7812 1 93
5trd-assembly1.cif.gz_B structure of rbkr (riboflavin kinase) from thermoplasma acidophilum determined in complex with ctp and its cognate dna operator 0.6074 1 94
5trd-assembly1.cif.gz_B structure of rbkr (riboflavin kinase) from thermoplasma acidophilum determined in complex with ctp and its cognate dna operator 0.5926 1 94
2d3v-assembly1.cif.gz_A crystal structure of leukocyte ig-like receptor a5 (lilra5/lir9/ilt11) 0.5607 44 73
ID Description Score Start End Superfamily
2d9rA00 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;AF2212/PG0164-like 0.7975 1 93 2.40.30.100
2d9rA00 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;AF2212/PG0164-like 0.7799 1 93 2.40.30.100
af_Q851V5_317_412_2.40.330.10 Mainly Beta;Beta Barrel;At1g16640 B3 domain;DNA-binding pseudobarrel domain 0.6463 20 85 2.40.330.10
af_K7MX04_2_88_2.40.330.10 Mainly Beta;Beta Barrel;At1g16640 B3 domain;DNA-binding pseudobarrel domain 0.6408 20 86 2.40.330.10
af_A0A2R8Q7F5_344_478_2.40.70.10 Mainly Beta;Beta Barrel;Cathepsin D, subunit A; domain 1;Acid Proteases 0.6137 44 59 2.40.70.10
ID Description Score Start End GO Terms
AF-A0A1I2YY33-F1-model_v4 DUF1905 domain-containing protein 0.9876 44 95
AF-A0A7W1GNI9-F1-model_v4 DUF1905 domain-containing protein 0.9793 45 93
AF-F0M7M0-F1-model_v4 DUF1905 domain-containing protein 0.9715 21 95
AF-A0A1R4EZD4-F1-model_v4 DUF1905 domain-containing protein 0.9714 1 93
AF-A0A4R8XUY6-F1-model_v4 DUF1905 domain-containing protein 0.9696 1 94

Map