F399840

General Info

Members Datasets Scaffolds Average Seq Length
308 203 616 259

Family's Representative Sequence

Representative Sequence 3300046472|Ga0495580_0010744|Ga0495580_0010744_3968_4801
Length 277
Sequence MVTDGGDKRLLAVDVGNTNTVLGLYEGSTLLRHWRLTSRRDMTSDEIALSVEGLLRAVPGAQPPDDVIVATVVPSLRFPMRQAFRQLFDKEPMFIEPGIKTGMPILYESPQEVGADRIVNAVAALAKVGGPCIVVDFGTATTFDVVTAKGEYLGGVIVPGIAISAEALFEKAARLWRVEIRRPDRVVGRTTSGSIQSGLYFGYLSLVDGVIDRIVREVGTDGQPKPRVIATGGLAELFAGASERIDEVDPLLTLTGLYLIHERNTHDRDIQDRRGPG

Samples

Sample ID Description Type Environment
1 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
2 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
3 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
72 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
76 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
121 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
122 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
123 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
126 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
130 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
131 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
132 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
133 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
134 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
135 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
136 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
137 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
138 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
139 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
140 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
141 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
142 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
143 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
144 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
145 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
146 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
147 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
148 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
149 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
150 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
154 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
155 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
156 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
157 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
158 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
159 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
160 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
161 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
162 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
163 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
164 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
166 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
167 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
168 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
169 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
170 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
171 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
172 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
173 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
174 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
175 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
176 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
177 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
178 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
179 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
180 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
181 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
182 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
183 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
184 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
185 2671180694 Paenibacillus sp. A3 Isolate Unclassified
186 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
187 2857472729 Cohnella sp. R-74144 Isolate Unclassified
188 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
189 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
190 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
191 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
192 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
193 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
194 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
195 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
196 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
197 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
198 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
199 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
200 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
201 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
202 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere
203 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.86
Metatranscriptomes 0
Isolates 7.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.27
Nodule 0
Rhizoplane 3.9
Rhizosphere 86.36
Stem 0
Stem Tuber 0
Unclassified 1.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495580_0010744 3300046472 Bacteria 7111
2 Ga0055535_1008739 3300003761 Bacteria 1797
3 Ga0055541_1000233 3300003841 Bacteria 20828
4 Ga0070690_100000247 3300005330 Bacteria 27948
5 Ga0070670_100006340 3300005331 Bacteria 10012
6 Ga0070670_100047148 3300005331 Bacteria 3707
7 Ga0070670_100241112 3300005331 Bacteria 1574
8 Ga0070670_100258886 3300005331 Bacteria 1516
9 Ga0070677_10008515 3300005333 Bacteria 3455
10 Ga0068869_100067806 3300005334 Bacteria 2634
11 Ga0070666_10000162 3300005335 Bacteria 45416
12 Ga0070666_10000614 3300005335 Bacteria 21465
13 Ga0070666_10072771 3300005335 Bacteria 2340
14 Ga0068868_100009334 3300005338 Bacteria 7052
15 Ga0070660_100107969 3300005339 Bacteria 2212
16 Ga0070689_100029809 3300005340 Bacteria 4135
17 Ga0070689_100406235 3300005340 Bacteria 1152
18 Ga0070687_100109282 3300005343 Unclassified 1562
19 Ga0070661_100141888 3300005344 Bacteria 1811
20 Ga0070692_10011828 3300005345 Bacteria 4021
21 Ga0070668_100197497 3300005347 Bacteria 1650
22 Ga0070668_100453906 3300005347 Bacteria 1102
23 Ga0070669_100069374 3300005353 Bacteria 2603
24 Ga0070669_100191843 3300005353 Bacteria 1603
25 Ga0070675_100026472 3300005354 Bacteria 4655
26 Ga0070671_100038980 3300005355 Bacteria 3944
27 Ga0070674_100019002 3300005356 Bacteria 4359
28 Ga0070673_100024414 3300005364 Bacteria 4433
29 Ga0070688_100152128 3300005365 Bacteria 1583
30 Ga0070667_100000479 3300005367 Bacteria 40998
31 Ga0070667_100045151 3300005367 Bacteria 3704
32 Ga0070705_100019552 3300005440 Bacteria 3565
33 Ga0070694_100017779 3300005444 Bacteria 4495
34 Ga0070708_100002470 3300005445 Bacteria 14278
35 Ga0070708_100020579 3300005445 Bacteria 5567
36 Ga0070708_100020841 3300005445 Bacteria 5534
37 Ga0070708_100034868 3300005445 Bacteria 4381
38 Ga0070708_100133208 3300005445 Bacteria 2301
39 Ga0070678_100020707 3300005456 Bacteria 4321
40 Ga0068867_100059107 3300005459 Bacteria 2842
41 Ga0070706_100000427 3300005467 Bacteria 50722
42 Ga0070706_100011410 3300005467 Bacteria 8255
43 Ga0070706_100021301 3300005467 Bacteria 5971
44 Ga0070706_100026607 3300005467 Bacteria 5322
45 Ga0070706_100516606 3300005467 Bacteria 1111
46 Ga0070707_100010227 3300005468 Bacteria 8738
47 Ga0070707_100127111 3300005468 Bacteria 2477
48 Ga0070707_100152042 3300005468 Bacteria 2254
49 Ga0070698_100000369 3300005471 Bacteria 46745
50 Ga0070698_100225196 3300005471 Bacteria 1808
51 Ga0070698_100298353 3300005471 Bacteria 1542
52 Ga0070698_100333140 3300005471 Bacteria 1449
53 Ga0070699_100251210 3300005518 Bacteria 1580
54 Ga0070699_100296296 3300005518 Bacteria 1451
55 Ga0070697_100011623 3300005536 Bacteria 6881
56 Ga0070697_100022955 3300005536 Bacteria 4961
57 Ga0070672_100050724 3300005543 Bacteria 3234
58 Ga0070672_100156180 3300005543 Bacteria 1890
59 Ga0070672_100419262 3300005543 Bacteria 1149
60 Ga0070696_100020074 3300005546 Bacteria 4531
61 Ga0070665_100008694 3300005548 Bacteria 10277
62 Ga0070704_100017088 3300005549 Bacteria 4604
63 Ga0070704_100084875 3300005549 Bacteria 2342
64 Ga0068855_100186009 3300005563 Bacteria 2346
65 Ga0070664_100005165 3300005564 Bacteria 10479
66 Ga0070664_100021642 3300005564 Bacteria 5302
67 Ga0070664_100361138 3300005564 Bacteria 1323
68 Ga0068856_100003374 3300005614 Bacteria 16168
69 Ga0068856_100236034 3300005614 Bacteria 1844
70 Ga0070702_100024333 3300005615 Bacteria 3230
71 Ga0068852_100636289 3300005616 Bacteria 1073
72 Ga0068859_100061344 3300005617 Bacteria 3789
73 Ga0068859_100112838 3300005617 Bacteria 2782
74 Ga0068859_100280486 3300005617 Bacteria 1759
75 Ga0068864_100061967 3300005618 Bacteria 3240
76 Ga0068861_100011218 3300005719 Bacteria 6221
77 Ga0068861_100125809 3300005719 Bacteria 2073
78 Ga0068870_10014120 3300005840 Bacteria 3767
79 Ga0068863_100003443 3300005841 Bacteria 15600
80 Ga0068863_100126856 3300005841 Bacteria 2435
81 Ga0068863_100575411 3300005841 Bacteria 1113
82 Ga0068858_100050984 3300005842 Bacteria 3829
83 Ga0068858_100209145 3300005842 Bacteria 1846
84 Ga0068858_100654424 3300005842 Bacteria 1021
85 Ga0068860_100000487 3300005843 Bacteria 48973
86 Ga0068860_100087172 3300005843 Bacteria 2972
87 Ga0068860_100129294 3300005843 Bacteria 2422
88 Ga0068862_100042847 3300005844 Bacteria 3857
89 Ga0068862_100172948 3300005844 Bacteria 1934
90 Ga0081455_10006094 3300005937 Bacteria 13040
91 Ga0070716_100043697 3300006173 Bacteria 2507
92 Ga0075433_10002926 3300006852 Bacteria 13104
93 Ga0075433_10120321 3300006852 Bacteria 2331
94 Ga0075433_10343281 3300006852 Bacteria 1320
95 Ga0075434_100000574 3300006871 Bacteria 28276
96 Ga0075434_100018600 3300006871 Bacteria 6714
97 Ga0075434_100231754 3300006871 Bacteria 1866
98 Ga0075436_100172897 3300006914 Bacteria 1525
99 Ga0097620_100061353 3300006931 Bacteria 3789
100 Ga0097620_100112831 3300006931 Bacteria 2782
101 Ga0097620_100280488 3300006931 Bacteria 1759
102 Ga0075435_100000866 3300007076 Bacteria 18957
103 Ga0075435_100020897 3300007076 Bacteria 5026
104 Ga0111539_10052530 3300009094 Bacteria 4851
105 Ga0105245_10882448 3300009098 Bacteria 935
106 Ga0114129_10014794 3300009147 Bacteria 11116
107 Ga0114129_10017785 3300009147 Bacteria 10123
108 Ga0114129_10027725 3300009147 Bacteria 8019
109 Ga0105241_10061194 3300009174 Bacteria 2899
110 Ga0105248_10002776 3300009177 Bacteria 19471
111 Ga0105248_10053224 3300009177 Bacteria 4542
112 Ga0105249_10159449 3300009553 Bacteria 2179
113 Ga0105249_10190300 3300009553 Bacteria 2002
114 Ga0157374_10008826 3300013296 Bacteria 8629
115 Ga0157378_10022861 3300013297 Bacteria 5503
116 Ga0157378_10202956 3300013297 Bacteria 1876
117 Ga0163162_10194487 3300013306 Bacteria 2157
118 Ga0163162_10491004 3300013306 Bacteria 1359
119 Ga0157375_10001318 3300013308 Bacteria 21404
120 Ga0157375_10001891 3300013308 Bacteria 18001
121 Ga0157375_10174787 3300013308 Bacteria 2297
122 Ga0157375_10672835 3300013308 Bacteria 1190
123 Ga0163163_10044103 3300014325 Bacteria 4374
124 Ga0157380_10064669 3300014326 Bacteria 2937
125 Ga0157379_10006853 3300014968 Bacteria 9849
126 Ga0157379_10087536 3300014968 Bacteria 2792
127 Ga0157376_10060683 3300014969 Bacteria 3177
128 Ga0157376_10082460 3300014969 Bacteria 2763
129 Ga0182007_10074273 3300015262 Bacteria 1114
130 Ga0209566_100116 3300025225 Bacteria 107510
131 Ga0209566_100196 3300025225 Bacteria 62620
132 Ga0209258_106283 3300025242 Bacteria 1882
133 Ga0209676_1011003 3300025292 Bacteria 3698
134 Ga0209025_1004132 3300025294 Bacteria 12884
135 Ga0207682_10012327 3300025893 Bacteria 3338
136 Ga0207688_10201513 3300025901 Bacteria 1193
137 Ga0207680_10006974 3300025903 Bacteria 5481
138 Ga0207645_10009484 3300025907 Bacteria 6728
139 Ga0207643_10035954 3300025908 Bacteria 2778
140 Ga0207684_10005048 3300025910 Bacteria 12298
141 Ga0207684_10039484 3300025910 Bacteria 4004
142 Ga0207684_10111738 3300025910 Bacteria 2339
143 Ga0207654_10042796 3300025911 Bacteria 2564
144 Ga0207657_10400876 3300025919 Bacteria 1079
145 Ga0207646_10112845 3300025922 Bacteria 2439
146 Ga0207646_10393960 3300025922 Bacteria 1251
147 Ga0207646_10700544 3300025922 Bacteria 906
148 Ga0207650_10028836 3300025925 Bacteria 3984
149 Ga0207644_10345557 3300025931 Bacteria 1207
150 Ga0207690_10136467 3300025932 Bacteria 1802
151 Ga0207706_10000704 3300025933 Bacteria 34863
152 Ga0207670_10087776 3300025936 Bacteria 2192
153 Ga0207670_10358438 3300025936 Bacteria 1157
154 Ga0207669_10235570 3300025937 Bacteria 1354
155 Ga0207665_10110882 3300025939 Bacteria 1928
156 Ga0207665_10177216 3300025939 Bacteria 1542
157 Ga0207691_10000104 3300025940 Bacteria 75014
158 Ga0207691_10057518 3300025940 Bacteria 3538
159 Ga0207691_10076031 3300025940 Bacteria 3026
160 Ga0207711_10001494 3300025941 Bacteria 21777
161 Ga0207711_10044167 3300025941 Bacteria 3803
162 Ga0207689_10031874 3300025942 Bacteria 4384
163 Ga0207661_10097342 3300025944 Bacteria 2464
164 Ga0207679_10042067 3300025945 Bacteria 3281
165 Ga0207679_10299896 3300025945 Bacteria 1385
166 Ga0207667_10191621 3300025949 Bacteria 2098
167 Ga0207651_10129511 3300025960 Bacteria 1929
168 Ga0207668_10357567 3300025972 Bacteria 1223
169 Ga0207658_10027883 3300025986 Bacteria 3972
170 Ga0207658_10068133 3300025986 Bacteria 2684
171 Ga0207658_10361730 3300025986 Bacteria 1266
172 Ga0207658_10649484 3300025986 Bacteria 951
173 Ga0207658_10703165 3300025986 Bacteria 913
174 Ga0207677_10025559 3300026023 Bacteria 3686
175 Ga0207703_10060722 3300026035 Bacteria 3092
176 Ga0207703_10093002 3300026035 Bacteria 2539
177 Ga0207703_10171401 3300026035 Bacteria 1909
178 Ga0207678_10082550 3300026067 Bacteria 2750
179 Ga0207708_10012420 3300026075 Bacteria 6349
180 Ga0207702_10198207 3300026078 Bacteria 1859
181 Ga0207641_10005700 3300026088 Bacteria 10599
182 Ga0207641_10052715 3300026088 Bacteria 3446
183 Ga0207641_10467875 3300026088 Bacteria 1220
184 Ga0207648_10006854 3300026089 Bacteria 11291
185 Ga0207648_10030339 3300026089 Bacteria 4789
186 Ga0207676_10045395 3300026095 Bacteria 3395
187 Ga0207675_100014388 3300026118 Bacteria 7376
188 Ga0207683_10003883 3300026121 Bacteria 12958
189 Ga0207683_10046588 3300026121 Bacteria 3795
190 Ga0207698_10386330 3300026142 Bacteria 1333
191 Ga0209995_1002057 3300027471 Bacteria 3157
192 Ga0209970_1006256 3300027614 Bacteria 1949
193 Ga0209983_1004989 3300027665 Bacteria 2771
194 Ga0209971_1001235 3300027682 Bacteria 6405
195 Ga0209974_10015986 3300027876 Bacteria 2491
196 Ga0268266_10010758 3300028379 Bacteria 7972
197 Ga0268266_10236804 3300028379 Bacteria 1683
198 Ga0268265_10091769 3300028380 Bacteria 2429
199 Ga0268264_10028715 3300028381 Bacteria 4552
200 Ga0268264_10101858 3300028381 Bacteria 2497
201 Ga0268264_10171157 3300028381 Bacteria 1964
202 Ga0268264_10441077 3300028381 Bacteria 1259
203 Ga0265332_10029201 3300031238 Bacteria 2412
204 Ga0265316_10181882 3300031344 Bacteria 1565
205 Ga0316576_10042662 3300031727 Bacteria 3270
206 Ga0307413_10239002 3300031824 Bacteria 1340
207 Ga0307416_100120877 3300032002 Unclassified 2334
208 Ga0373943_0203423 3300035170 Bacteria 1097
209 Ga0373935_0050656 3300035692 Bacteria 2636
210 Ga0373937_0216102 3300036401 Bacteria 1804
211 Ga0373937_0711272 3300036401 Bacteria 951
212 Ga0373925_0071323 3300037068 Bacteria 2627
213 Ga0439436_0029512 3300041404 Bacteria 1597
214 Ga0439449_0000011 3300042007 Bacteria 57369
215 Ga0439449_0215670 3300042007 Bacteria 719
216 Ga0439457_011999 3300042014 Bacteria 1958
217 Ga0439462_0000025 3300042015 Bacteria 22569
218 Ga0439462_0006464 3300042015 Bacteria 2914
219 Ga0451577_0176825 3300042876 Bacteria 1924
220 Ga0453683_0502078 3300044673 Bacteria 787
221 Ga0453684_0620260 3300044712 Bacteria 1183
222 Ga0451576_0074502 3300045051 Bacteria 3533
223 Ga0451576_0399545 3300045051 Bacteria 1441
224 Ga0495629_0052153 3300046459 Bacteria 2862
225 Ga0495580_0000290 3300046472 Bacteria 40840
226 Ga0495580_0156165 3300046472 Bacteria 1580
227 Ga0495582_0058718 3300046473 Bacteria 2122
228 Ga0495662_0168684 3300046476 Bacteria 1079
229 Ga0495585_0070149 3300046492 Bacteria 1912
230 Ga0495594_0169794 3300046499 Bacteria 1241
231 Ga0495586_0005410 3300046535 Bacteria 6828
232 Ga0495661_0121678 3300046665 Bacteria 1441
233 Ga0495647_0028250 3300046681 Bacteria 2067
234 Ga0495658_0081560 3300046683 Bacteria 1899
235 Ga0495658_0149738 3300046683 Bacteria 1433
236 Ga0495649_0135568 3300046694 Bacteria 1298
237 Ga0495602_0050576 3300048088 Bacteria 3712
238 Ga0496100_0183843 3300048903 Bacteria 1513
239 Ga0496101_0023033 3300048904 Bacteria 4297
240 Ga0496103_0039442 3300048906 Bacteria 2902
241 Ga0496103_0259970 3300048906 Bacteria 1117
242 Ga0496104_0056303 3300048907 Bacteria 3718
243 Ga0496104_0070247 3300048907 Bacteria 3329
244 Ga0496106_0004920 3300048909 Bacteria 9886
245 Ga0496107_0020568 3300048910 Bacteria 4663
246 Ga0496109_0079575 3300048912 Bacteria 3020
247 Ga0496110_0308470 3300048913 Bacteria 1441
248 Ga0496112_0323408 3300048915 Unclassified 1487
249 Ga0496112_0325062 3300048915 Bacteria 1482
250 Ga0496116_0041553 3300048919 Bacteria 3154
251 Ga0496116_0098231 3300048919 Bacteria 1757
252 Ga0496116_0151036 3300048919 Bacteria 1290
253 Ga0496116_0217463 3300048919 Bacteria 983
254 Ga0496119_0154561 3300048922 Bacteria 1226
255 Ga0496120_0053204 3300048923 Bacteria 2301
256 Ga0496122_0001621 3300048925 Bacteria 35157
257 Ga0496122_0019715 3300048925 Bacteria 6145
258 Ga0496123_0013200 3300048926 Bacteria 6963
259 Ga0496123_0279280 3300048926 Bacteria 808
260 Ga0496124_0000211 3300048927 Bacteria 113824
261 Ga0496125_0007811 3300048928 Bacteria 11306
262 Ga0501038_0091169 3300049574 Unclassified 2554
263 Ga0501067_0083485 3300049583 Bacteria 1772
264 Ga0501069_0072289 3300049585 Bacteria 1934
265 Ga0501070_0392707 3300049586 Bacteria 1123
266 Ga0501072_0194453 3300049588 Bacteria 1618
267 Ga0501077_0071463 3300049593 Bacteria 2200
268 Ga0501217_016978 3300049661 Bacteria 1674
269 Ga0501233_043196 3300049668 Bacteria 1067
270 nmdc:mga05p37_31761_c1 3300050507 Bacteria 6453
271 nmdc:mga05p37_518_c1 3300050507 Bacteria 17205
272 nmdc:mga05p37_69521_c1 3300050507 Bacteria 4331
273 nmdc:mga08y16_155488_c1 3300050511 Bacteria 2376
274 nmdc:mga0n895_10091_c1 3300050512 Bacteria 8314
275 nmdc:mga0n895_17824_c1 3300050512 Bacteria 6556
276 nmdc:mga0rr50_124845_c1 3300050513 Bacteria 2053
277 nmdc:mga0rr50_33779_c1 3300050513 Bacteria 3657
278 nmdc:mga0rr50_491_c1 3300050513 Bacteria 21035
279 nmdc:mga08x19_154562_c1 3300050514 Bacteria 1555
280 nmdc:mga0a205_10927_c1 3300050515 Bacteria 7867
281 nmdc:mga0a205_22538_c1 3300050515 Bacteria 5967
282 nmdc:mga0a205_565_c1 3300050515 Bacteria 29440
283 Ga0495595_0020310 3300053084 Bacteria 2891
284 Ga0495619_0017207 3300053085 Bacteria 4578
285 Ga0501084_0287756 3300054114 Bacteria 1388
286 Ga0501082_0385350 3300060353 Bacteria 1223
287 2512736580 2512564039 Bacteria 8739048
288 2524191658 2524023129 Bacteria 6762600
289 2595320822 2593339198 Bacteria 7267884
290 2673822939 2671180694 Bacteria 7506943
291 2793182015 2791355222 Bacteria 5898266
292 2857477551 2857472729 Bacteria 6568124
293 2865002672 2864997549 Bacteria 5139696
294 2865008232 2865002811 Bacteria 6333767
295 2888578995 2888578766 Bacteria 6743310
296 2889052462 2889049205 Bacteria 7524325
297 2889299006 2889295896 Bacteria 4704906
298 2904119470 2904113452 Bacteria 7796941
299 2980129806 2980125574 Bacteria 5567337
300 2981289613 2981284811 Bacteria 4641497
301 2981294558 2981289755 Bacteria 4641509
302 2981985174 2981980479 Bacteria 4641628
303 2981990108 2981985349 Bacteria 4641497
304 8002323389 8002317523 Bacteria 8051857
305 8046992218 8046991243 Bacteria 8497463
306 8055634073 8055632911 Bacteria 5283357
307 8057735812 8057733483 Bacteria 6578323
308 8057979810 8057977335 Bacteria 5694872
309 Ga0495580_0010744
310 Ga0055535_1008739
311 Ga0055541_1000233
312 Ga0070690_100000247
313 Ga0070670_100006340
314 Ga0070670_100047148
315 Ga0070670_100241112
316 Ga0070670_100258886
317 Ga0070677_10008515
318 Ga0068869_100067806
319 Ga0070666_10000162
320 Ga0070666_10000614
321 Ga0070666_10072771
322 Ga0068868_100009334
323 Ga0070660_100107969
324 Ga0070689_100029809
325 Ga0070689_100406235
326 Ga0070687_100109282
327 Ga0070661_100141888
328 Ga0070692_10011828
329 Ga0070668_100197497
330 Ga0070668_100453906
331 Ga0070669_100069374
332 Ga0070669_100191843
333 Ga0070675_100026472
334 Ga0070671_100038980
335 Ga0070674_100019002
336 Ga0070673_100024414
337 Ga0070688_100152128
338 Ga0070667_100000479
339 Ga0070667_100045151
340 Ga0070705_100019552
341 Ga0070694_100017779
342 Ga0070708_100002470
343 Ga0070708_100020579
344 Ga0070708_100020841
345 Ga0070708_100034868
346 Ga0070708_100133208
347 Ga0070678_100020707
348 Ga0068867_100059107
349 Ga0070706_100000427
350 Ga0070706_100011410
351 Ga0070706_100021301
352 Ga0070706_100026607
353 Ga0070706_100516606
354 Ga0070707_100010227
355 Ga0070707_100127111
356 Ga0070707_100152042
357 Ga0070698_100000369
358 Ga0070698_100225196
359 Ga0070698_100298353
360 Ga0070698_100333140
361 Ga0070699_100251210
362 Ga0070699_100296296
363 Ga0070697_100011623
364 Ga0070697_100022955
365 Ga0070672_100050724
366 Ga0070672_100156180
367 Ga0070672_100419262
368 Ga0070696_100020074
369 Ga0070665_100008694
370 Ga0070704_100017088
371 Ga0070704_100084875
372 Ga0068855_100186009
373 Ga0070664_100005165
374 Ga0070664_100021642
375 Ga0070664_100361138
376 Ga0068856_100003374
377 Ga0068856_100236034
378 Ga0070702_100024333
379 Ga0068852_100636289
380 Ga0068859_100061344
381 Ga0068859_100112838
382 Ga0068859_100280486
383 Ga0068864_100061967
384 Ga0068861_100011218
385 Ga0068861_100125809
386 Ga0068870_10014120
387 Ga0068863_100003443
388 Ga0068863_100126856
389 Ga0068863_100575411
390 Ga0068858_100050984
391 Ga0068858_100209145
392 Ga0068858_100654424
393 Ga0068860_100000487
394 Ga0068860_100087172
395 Ga0068860_100129294
396 Ga0068862_100042847
397 Ga0068862_100172948
398 Ga0081455_10006094
399 Ga0070716_100043697
400 Ga0075433_10002926
401 Ga0075433_10120321
402 Ga0075433_10343281
403 Ga0075434_100000574
404 Ga0075434_100018600
405 Ga0075434_100231754
406 Ga0075436_100172897
407 Ga0097620_100061353
408 Ga0097620_100112831
409 Ga0097620_100280488
410 Ga0075435_100000866
411 Ga0075435_100020897
412 Ga0111539_10052530
413 Ga0105245_10882448
414 Ga0114129_10014794
415 Ga0114129_10017785
416 Ga0114129_10027725
417 Ga0105241_10061194
418 Ga0105248_10002776
419 Ga0105248_10053224
420 Ga0105249_10159449
421 Ga0105249_10190300
422 Ga0157374_10008826
423 Ga0157378_10022861
424 Ga0157378_10202956
425 Ga0163162_10194487
426 Ga0163162_10491004
427 Ga0157375_10001318
428 Ga0157375_10001891
429 Ga0157375_10174787
430 Ga0157375_10672835
431 Ga0163163_10044103
432 Ga0157380_10064669
433 Ga0157379_10006853
434 Ga0157379_10087536
435 Ga0157376_10060683
436 Ga0157376_10082460
437 Ga0182007_10074273
438 Ga0209566_100116
439 Ga0209566_100196
440 Ga0209258_106283
441 Ga0209676_1011003
442 Ga0209025_1004132
443 Ga0207682_10012327
444 Ga0207688_10201513
445 Ga0207680_10006974
446 Ga0207645_10009484
447 Ga0207643_10035954
448 Ga0207684_10005048
449 Ga0207684_10039484
450 Ga0207684_10111738
451 Ga0207654_10042796
452 Ga0207657_10400876
453 Ga0207646_10112845
454 Ga0207646_10393960
455 Ga0207646_10700544
456 Ga0207650_10028836
457 Ga0207644_10345557
458 Ga0207690_10136467
459 Ga0207706_10000704
460 Ga0207670_10087776
461 Ga0207670_10358438
462 Ga0207669_10235570
463 Ga0207665_10110882
464 Ga0207665_10177216
465 Ga0207691_10000104
466 Ga0207691_10057518
467 Ga0207691_10076031
468 Ga0207711_10001494
469 Ga0207711_10044167
470 Ga0207689_10031874
471 Ga0207661_10097342
472 Ga0207679_10042067
473 Ga0207679_10299896
474 Ga0207667_10191621
475 Ga0207651_10129511
476 Ga0207668_10357567
477 Ga0207658_10027883
478 Ga0207658_10068133
479 Ga0207658_10361730
480 Ga0207658_10649484
481 Ga0207658_10703165
482 Ga0207677_10025559
483 Ga0207703_10060722
484 Ga0207703_10093002
485 Ga0207703_10171401
486 Ga0207678_10082550
487 Ga0207708_10012420
488 Ga0207702_10198207
489 Ga0207641_10005700
490 Ga0207641_10052715
491 Ga0207641_10467875
492 Ga0207648_10006854
493 Ga0207648_10030339
494 Ga0207676_10045395
495 Ga0207675_100014388
496 Ga0207683_10003883
497 Ga0207683_10046588
498 Ga0207698_10386330
499 Ga0209995_1002057
500 Ga0209970_1006256
501 Ga0209983_1004989
502 Ga0209971_1001235
503 Ga0209974_10015986
504 Ga0268266_10010758
505 Ga0268266_10236804
506 Ga0268265_10091769
507 Ga0268264_10028715
508 Ga0268264_10101858
509 Ga0268264_10171157
510 Ga0268264_10441077
511 Ga0265332_10029201
512 Ga0265316_10181882
513 Ga0316576_10042662
514 Ga0307413_10239002
515 Ga0307416_100120877
516 Ga0373943_0203423
517 Ga0373935_0050656
518 Ga0373937_0216102
519 Ga0373937_0711272
520 Ga0373925_0071323
521 Ga0439436_0029512
522 Ga0439449_0000011
523 Ga0439449_0215670
524 Ga0439457_011999
525 Ga0439462_0000025
526 Ga0439462_0006464
527 Ga0451577_0176825
528 Ga0453683_0502078
529 Ga0453684_0620260
530 Ga0451576_0074502
531 Ga0451576_0399545
532 Ga0495629_0052153
533 Ga0495580_0000290
534 Ga0495580_0156165
535 Ga0495582_0058718
536 Ga0495662_0168684
537 Ga0495585_0070149
538 Ga0495594_0169794
539 Ga0495586_0005410
540 Ga0495661_0121678
541 Ga0495647_0028250
542 Ga0495658_0081560
543 Ga0495658_0149738
544 Ga0495649_0135568
545 Ga0495602_0050576
546 Ga0496100_0183843
547 Ga0496101_0023033
548 Ga0496103_0039442
549 Ga0496103_0259970
550 Ga0496104_0056303
551 Ga0496104_0070247
552 Ga0496106_0004920
553 Ga0496107_0020568
554 Ga0496109_0079575
555 Ga0496110_0308470
556 Ga0496112_0323408
557 Ga0496112_0325062
558 Ga0496116_0041553
559 Ga0496116_0098231
560 Ga0496116_0151036
561 Ga0496116_0217463
562 Ga0496119_0154561
563 Ga0496120_0053204
564 Ga0496122_0001621
565 Ga0496122_0019715
566 Ga0496123_0013200
567 Ga0496123_0279280
568 Ga0496124_0000211
569 Ga0496125_0007811
570 Ga0501038_0091169
571 Ga0501067_0083485
572 Ga0501069_0072289
573 Ga0501070_0392707
574 Ga0501072_0194453
575 Ga0501077_0071463
576 Ga0501217_016978
577 Ga0501233_043196
578 nmdc:mga05p37_31761_c1
579 nmdc:mga05p37_518_c1
580 nmdc:mga05p37_69521_c1
581 nmdc:mga08y16_155488_c1
582 nmdc:mga0n895_10091_c1
583 nmdc:mga0n895_17824_c1
584 nmdc:mga0rr50_124845_c1
585 nmdc:mga0rr50_33779_c1
586 nmdc:mga0rr50_491_c1
587 nmdc:mga08x19_154562_c1
588 nmdc:mga0a205_10927_c1
589 nmdc:mga0a205_22538_c1
590 nmdc:mga0a205_565_c1
591 Ga0495595_0020310
592 Ga0495619_0017207
593 Ga0501084_0287756
594 Ga0501082_0385350
595 2512736580
596 2524191658
597 2595320822
598 2673822939
599 2793182015
600 2857477551
601 2865002672
602 2865008232
603 2888578995
604 2889052462
605 2889299006
606 2904119470
607 2980129806
608 2981289613
609 2981294558
610 2981985174
611 2981990108
612 8002323389
613 8046992218
614 8055634073
615 8057735812
616 8057979810

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03309

Pan_kinase

Type III pantothenate kinase

10

213

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2h3g-assembly1.cif.gz_X-2 structure of the type iii pantothenate kinase (coax) from bacillus anthracis 0.9585 1 256
2h3g-assembly1.cif.gz_X-2 structure of the type iii pantothenate kinase (coax) from bacillus anthracis 0.9548 1 256
3djc-assembly2.cif.gz_D crystal structure of pantothenate kinase from legionella pneumophila 0.9298 2 256
3djc-assembly2.cif.gz_E crystal structure of pantothenate kinase from legionella pneumophila 0.9287 1 256
3djc-assembly1.cif.gz_K crystal structure of pantothenate kinase from legionella pneumophila 0.9272 1 256
ID Description Score Start End Superfamily
2h3gX01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.964 1 88 3.30.420.40
2h3gX01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9535 1 88 3.30.420.40
3djcB01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9458 2 87 3.30.420.40
2h3gX02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9327 89 256 3.30.420.40
2h3gX02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9269 89 256 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A3B8V8R2-F1-model_v4 Type III pantothenate kinase (EC 2.7.1.33) 0.9749 1 118 GO:0004594
GO:0005524
GO:0005737
GO:0015937
AF-A0A662DXK9-F1-model_v4 Type III pantothenate kinase (EC 2.7.1.33) 0.9738 1 97 GO:0004594
GO:0005737
GO:0015937
AF-A0A535J5I2-F1-model_v4 Type III pantothenate kinase (EC 2.7.1.33) 0.9728 1 83 GO:0004594
GO:0005524
GO:0005737
GO:0015937
AF-A0A371IMB4-F1-model_v4 pantothenate kinase (EC 2.7.1.33) 0.9707 1 72 GO:0004594
GO:0005737
GO:0015937
AF-A0A0S8EEQ9-F1-model_v4 Type III pantothenate kinase (EC 2.7.1.33) (PanK-III) (Pantothenic acid kinase) 0.9706 1 256 GO:0004594
GO:0005524
GO:0005737
GO:0015937
GO:0046872

Map