F399775

General Info

Members Datasets Scaffolds Average Seq Length
308 213 283 170

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0004290|Ga0395899_0004290_6600_7130
Length 170
Sequence MTRYVAFLRAVNVGGTGKLPMAELRAMCERIGFSSVRTYIASGNVVFDSPHDAATVKRSLYAGKPVGVLIRTGPELAAVLAGNPFKTAAPNRTVAIFLDAPPPADALAKASGRQDEEMALGKREIYVHYGSGMARSKLKIPAAIAGTARNMNTVATLVEWTAVRSDATNG

Samples

Sample ID Description Type Environment
1 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
2 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
3 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
4 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
5 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
6 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
7 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
8 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
9 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
10 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
11 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
12 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
13 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
14 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
15 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
16 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
17 2885266251 Ralstonia sp. SET104 Isolate Nodule
18 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
19 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
20 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
21 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
22 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
23 2928058823 Ralstonia sp. 1138 Isolate Unclassified
24 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
25 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
26 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
27 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
28 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
29 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
30 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
31 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
32 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
33 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
34 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
36 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
37 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
38 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
39 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
40 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
41 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
42 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
43 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
44 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
45 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
46 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
47 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
48 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
49 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
50 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
51 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
96 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
98 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
99 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
102 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
103 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
105 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
106 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
131 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
132 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
133 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
134 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
135 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
136 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
143 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
144 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
145 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
146 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
147 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
148 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
149 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
150 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
151 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
152 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
153 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
154 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
155 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
156 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
157 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
158 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
159 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
162 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
163 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
164 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
165 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
166 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
167 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
168 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
169 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
170 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
171 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
172 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
173 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
174 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
175 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
179 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
180 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
181 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
193 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
194 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
195 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
196 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
197 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
198 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
199 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
200 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
201 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
202 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
203 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
206 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
207 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
208 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
209 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
210 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
211 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
212 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
213 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.91
Metatranscriptomes 0.97
Isolates 8.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.51
Nodule 1.95
Rhizoplane 1.62
Rhizosphere 65.91
Stem 0
Stem Tuber 0
Unclassified 12.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000708 3300001915 Bacteria 10049
2 JGI24740J21852_10000046 3300001979 Bacteria 40023
3 JGI24740J21852_10000958 3300001979 Bacteria 12848
4 JGI25156J39149_1000465 3300002705 Bacteria 24472
5 JGI25156J39149_1005584 3300002705 Bacteria 3596
6 JGI25156J39149_1006419 3300002705 Bacteria 3214
7 JGI25154J39366_1003220 3300002738 Bacteria 3571
8 JGI25164J39214_1007497 3300002772 Bacteria 1109
9 JGI25151J46595_10039026 3300003187 Bacteria 1759
10 JGI25165J46597_1000596 3300003214 Bacteria 31107
11 JGI25165J46597_1006921 3300003214 Bacteria 1953
12 rootH2_10158678 3300003320 Bacteria 1652
13 rootH2_10301640 3300003320 Unclassified 1733
14 Ga0006562J51391_1094088 3300003578 Bacteria 3480
15 JGI25404J52841_10014733 3300003659 Bacteria 1697
16 JGI25404J52841_10024580 3300003659 Bacteria 1298
17 Ga0055538_1003520 3300003751 Bacteria 1969
18 Ga0055539_1000108 3300003752 Bacteria 91377
19 Ga0055533_1001980 3300003756 Bacteria 5005
20 Ga0055532_1000014 3300003758 Bacteria 344702
21 Ga0055532_1000073 3300003758 Bacteria 131021
22 Ga0055525_1000259 3300003759 Bacteria 50588
23 Ga0055527_1000013 3300003760 Bacteria 347416
24 Ga0055527_1000638 3300003760 Bacteria 10762
25 Ga0055527_1005901 3300003760 Bacteria 1560
26 Ga0055535_1000011 3300003761 Bacteria 347416
27 Ga0055535_1000055 3300003761 Bacteria 131021
28 Ga0055542_1000018 3300003762 Bacteria 347416
29 Ga0055542_1000876 3300003762 Bacteria 20941
30 Ga0055529_1000017 3300003763 Bacteria 347416
31 Ga0055529_1000149 3300003763 Bacteria 100620
32 Ga0055541_1000244 3300003841 Bacteria 20295
33 Ga0065165_1000667 3300005262 Bacteria 49547
34 Ga0070658_10046331 3300005327 Bacteria 3519
35 Ga0070680_100167294 3300005336 Bacteria 1849
36 Ga0070680_100461581 3300005336 Bacteria 1085
37 Ga0070660_100196444 3300005339 Bacteria 1635
38 Ga0070660_100645921 3300005339 Bacteria 886
39 Ga0070661_100001467 3300005344 Bacteria 16384
40 Ga0070661_100033008 3300005344 Bacteria 3749
41 Ga0070661_100080494 3300005344 Bacteria 2404
42 Ga0070668_100155326 3300005347 Bacteria 1853
43 Ga0070674_100471280 3300005356 Unclassified 1040
44 Ga0070674_101272379 3300005356 Bacteria 655
45 Ga0070659_100026949 3300005366 Bacteria 4424
46 Ga0070659_100088343 3300005366 Bacteria 2482
47 Ga0070659_100544581 3300005366 Bacteria 993
48 Ga0070663_100000061 3300005455 Bacteria 46745
49 Ga0070681_10020849 3300005458 Bacteria 6563
50 Ga0070707_100045842 3300005468 Bacteria 4184
51 Ga0070679_100187952 3300005530 Bacteria 2035
52 Ga0070679_100289411 3300005530 Bacteria 1590
53 Ga0070679_100726868 3300005530 Bacteria 936
54 Ga0070665_100000187 3300005548 Bacteria 110095
55 Ga0068855_100003028 3300005563 Bacteria 20568
56 Ga0068855_101000609 3300005563 Bacteria 878
57 Ga0070664_100000010 3300005564 Bacteria 165664
58 Ga0068857_100003693 3300005577 Bacteria 12838
59 Ga0068854_100003098 3300005578 Bacteria 10352
60 Ga0068856_100000045 3300005614 Bacteria 110625
61 Ga0068856_100000451 3300005614 Bacteria 45442
62 Ga0070702_100033839 3300005615 Bacteria 2813
63 Ga0068866_10033504 3300005718 Bacteria 2493
64 Ga0068866_10219181 3300005718 Unclassified 1147
65 Ga0068860_100487456 3300005843 Unclassified 1229
66 Ga0068862_100344482 3300005844 Bacteria 1381
67 Ga0081540_1001267 3300005983 Bacteria 22006
68 Ga0081540_1013239 3300005983 Bacteria 5375
69 Ga0070716_101349550 3300006173 Bacteria 578
70 Ga0068871_100302535 3300006358 Bacteria 1404
71 Ga0075434_101098554 3300006871 Bacteria 809
72 Ga0105240_10054596 3300009093 Bacteria 5006
73 Ga0105240_10322763 3300009093 Bacteria 1759
74 Ga0105240_10557676 3300009093 Bacteria 1267
75 Ga0105245_10146580 3300009098 Bacteria 2227
76 Ga0105247_10308869 3300009101 Bacteria 1099
77 Ga0105241_10501651 3300009174 Bacteria 1082
78 Ga0105237_10010103 3300009545 Bacteria 10065
79 Ga0105237_10022910 3300009545 Bacteria 6405
80 Ga0105237_10549827 3300009545 Bacteria 1161
81 Ga0105237_11811420 3300009545 Unclassified 618
82 Ga0105238_10088081 3300009551 Bacteria 3091
83 Ga0157373_10001786 3300013100 Bacteria 16343
84 Ga0157371_10000088 3300013102 Bacteria 145526
85 Ga0157370_10000041 3300013104 Bacteria 133912
86 Ga0157370_10004703 3300013104 Bacteria 15562
87 Ga0157370_10051834 3300013104 Bacteria 3919
88 Ga0157369_10000472 3300013105 Bacteria 53307
89 Ga0157369_10002013 3300013105 Bacteria 24489
90 Ga0157369_10057480 3300013105 Bacteria 4197
91 Ga0157378_10011676 3300013297 Bacteria 7688
92 Ga0157378_10144407 3300013297 Bacteria 2212
93 Ga0157372_10000097 3300013307 Bacteria 90742
94 Ga0157372_10056854 3300013307 Bacteria 4372
95 Ga0182008_10023627 3300014497 Bacteria 3136
96 Ga0157379_10402440 3300014968 Unclassified 1258
97 Ga0182006_1000898 3300015261 Bacteria 19947
98 Ga0182006_1001299 3300015261 Bacteria 15405
99 Ga0163161_10583115 3300017792 Bacteria 920
100 Ga0154015_1486453 3300020610 Bacteria 5208
101 Ga0224712_10004095 3300022467 Bacteria 3892
102 Ga0209784_100008 3300025224 Bacteria 740293
103 Ga0209784_100180 3300025224 Bacteria 52470
104 Ga0209784_101653 3300025224 Bacteria 2728
105 Ga0209784_101822 3300025224 Bacteria 2486
106 Ga0209566_100006 3300025225 Bacteria 789272
107 Ga0209566_100502 3300025225 Bacteria 27146
108 Ga0209566_102032 3300025225 Bacteria 4255
109 Ga0209674_100045 3300025226 Bacteria 362387
110 Ga0209674_100049 3300025226 Bacteria 346969
111 Ga0209674_100116 3300025226 Bacteria 135937
112 Ga0209674_104971 3300025226 Bacteria 2054
113 Ga0209672_100027 3300025228 Bacteria 344500
114 Ga0209672_100128 3300025228 Bacteria 77946
115 Ga0209672_100575 3300025228 Bacteria 19521
116 Ga0209147_100005 3300025229 Bacteria 1036530
117 Ga0209147_100035 3300025229 Bacteria 344500
118 Ga0209563_100016 3300025230 Bacteria 802091
119 Ga0209563_101711 3300025230 Bacteria 5550
120 Ga0209563_108568 3300025230 Bacteria 1604
121 Ga0207427_101079 3300025231 Bacteria 11187
122 Ga0209258_100007 3300025242 Bacteria 1036530
123 Ga0209258_100052 3300025242 Bacteria 344500
124 Ga0209646_1000027 3300025246 Bacteria 395141
125 Ga0209646_1013692 3300025246 Bacteria 1228
126 Ga0209026_1007608 3300025250 Bacteria 2400
127 Ga0209026_1031644 3300025250 Bacteria 783
128 Ga0209677_100008 3300025253 Bacteria 802091
129 Ga0209677_100693 3300025253 Bacteria 17214
130 Ga0209148_1000019 3300025254 Bacteria 748518
131 Ga0209148_1000064 3300025254 Bacteria 344500
132 Ga0209148_1006253 3300025254 Bacteria 2602
133 Ga0209759_1000041 3300025256 Bacteria 252893
134 Ga0209759_1003171 3300025256 Bacteria 6705
135 Ga0209759_1008256 3300025256 Bacteria 3260
136 Ga0209233_1000073 3300025261 Bacteria 362383
137 Ga0209233_1010764 3300025261 Bacteria 2722
138 Ga0209455_1000011 3300025272 Bacteria 947242
139 Ga0209455_1000057 3300025272 Bacteria 344500
140 Ga0209130_1000106 3300025284 Bacteria 134559
141 Ga0209025_1005644 3300025294 Bacteria 10089
142 Ga0207426_1027387 3300025302 Bacteria 1899
143 Ga0207688_10245523 3300025901 Bacteria 1083
144 Ga0207705_10018891 3300025909 Bacteria 4928
145 Ga0207707_10013883 3300025912 Bacteria 7023
146 Ga0207695_10001416 3300025913 Bacteria 40402
147 Ga0207695_10273308 3300025913 Bacteria 1585
148 Ga0207660_10032734 3300025917 Bacteria 3590
149 Ga0207660_10437378 3300025917 Bacteria 1056
150 Ga0207657_10024118 3300025919 Bacteria 5647
151 Ga0207657_10208828 3300025919 Bacteria 1568
152 Ga0207649_10000170 3300025920 Bacteria 53356
153 Ga0207649_10061998 3300025920 Bacteria 2356
154 Ga0207652_10023367 3300025921 Bacteria 5121
155 Ga0207652_10088449 3300025921 Bacteria 2718
156 Ga0207652_10710567 3300025921 Bacteria 896
157 Ga0207646_10203151 3300025922 Bacteria 1790
158 Ga0207664_10514011 3300025929 Bacteria 1073
159 Ga0207690_10175184 3300025932 Bacteria 1610
160 Ga0207690_10490139 3300025932 Bacteria 993
161 Ga0207669_10199160 3300025937 Bacteria 1452
162 Ga0207691_10926821 3300025940 Bacteria 729
163 Ga0207679_10000024 3300025945 Bacteria 204787
164 Ga0207667_10026365 3300025949 Bacteria 6352
165 Ga0207640_10002272 3300025981 Bacteria 10352
166 Ga0207678_10000018 3300026067 Bacteria 135549
167 Ga0207678_10055548 3300026067 Bacteria 3411
168 Ga0207702_10000053 3300026078 Bacteria 137538
169 Ga0207674_10001884 3300026116 Bacteria 26717
170 Ga0207698_10129879 3300026142 Bacteria 2151
171 Ga0268266_10000003 3300028379 Bacteria 1701703
172 Ga0268266_10008069 3300028379 Bacteria 9405
173 Ga0268265_10474144 3300028380 Bacteria 1174
174 Ga0268265_10939252 3300028380 Bacteria 851
175 Ga0268264_11325253 3300028381 Unclassified 730
176 Ga0265338_10434429 3300028800 Bacteria 931
177 Ga0316183_1007381 3300030742 Bacteria 940
178 Ga0265340_10057162 3300031247 Bacteria 1875
179 Ga0307513_10005321 3300031456 Bacteria 17020
180 Ga0373945_0052554 3300035116 Bacteria 1501
181 Ga0373946_0004814 3300035171 Bacteria 4858
182 Ga0373927_0635580 3300035695 Bacteria 705
183 Ga0373925_0701324 3300037068 Bacteria 834
184 Ga0395899_0004290 3300037312 Bacteria 11140
185 Ga0395900_0030046 3300037418 Bacteria 5577
186 Ga0395898_0109194 3300037466 Bacteria 2652
187 Ga0395905_0678358 3300037471 Bacteria 933
188 Ga0395901_0000529 3300038443 Bacteria 43995
189 Ga0451793_0747671 3300041452 Bacteria 903
190 Ga0451797_1455590 3300041453 Bacteria 989
191 Ga0466986_0089581 3300044650 Bacteria 2127
192 Ga0466986_0235485 3300044650 Bacteria 1179
193 Ga0466969_0010359 3300044656 Bacteria 4942
194 Ga0466969_0084318 3300044656 Bacteria 1512
195 Ga0466972_0000317 3300044658 Bacteria 27751
196 Ga0466978_0204757 3300044671 Bacteria 1173
197 Ga0466982_0000600 3300044672 Bacteria 10989
198 Ga0466966_0054356 3300044684 Bacteria 2538
199 Ga0466961_0000030 3300044693 Bacteria 86108
200 Ga0466961_0223708 3300044693 Bacteria 1159
201 Ga0466963_0005020 3300044694 Bacteria 7729
202 Ga0466964_0003078 3300044706 Bacteria 6062
203 Ga0466971_0010025 3300044719 Bacteria 4138
204 Ga0466971_0088608 3300044719 Bacteria 1416
205 Ga0466970_0001069 3300044765 Bacteria 13267
206 Ga0466957_0120260 3300044842 Bacteria 1673
207 Ga0466960_0009797 3300044901 Bacteria 3961
208 Ga0466959_0000550 3300045049 Bacteria 21804
209 Ga0466958_0063252 3300045836 Bacteria 2256
210 Ga0466967_0006318 3300045976 Bacteria 8366
211 Ga0466967_1720302 3300045976 Bacteria 624
212 Ga0495629_0359780 3300046459 Bacteria 992
213 Ga0495641_0037677 3300046461 Bacteria 2264
214 Ga0495580_0249928 3300046472 Bacteria 1214
215 Ga0495582_0068138 3300046473 Bacteria 1967
216 Ga0495662_0030065 3300046476 Bacteria 2622
217 Ga0495628_0035147 3300046516 Bacteria 4028
218 Ga0495648_0161273 3300046524 Bacteria 1159
219 Ga0495666_0052200 3300046526 Bacteria 1963
220 Ga0495647_0004178 3300046681 Bacteria 4677
221 Ga0495613_0671434 3300046689 Bacteria 684
222 Ga0495624_0027364 3300046690 Bacteria 3733
223 Ga0495671_0120038 3300046692 Bacteria 1283
224 Ga0495649_0019824 3300046694 Bacteria 3777
225 Ga0495676_0156992 3300047321 Bacteria 1613
226 Ga0495675_0105380 3300047444 Bacteria 1762
227 Ga0496112_1861965 3300048915 Unclassified 513
228 Ga0496115_0240383 3300048918 Bacteria 1492
229 Ga0496117_0040645 3300048920 Bacteria 3417
230 Ga0496118_0156413 3300048921 Bacteria 1417
231 Ga0496125_0002069 3300048928 Bacteria 27080
232 Ga0496125_0547260 3300048928 Unclassified 642
233 Ga0501031_0154900 3300049568 Bacteria 1497
234 Ga0501032_0037856 3300049569 Bacteria 3287
235 Ga0501032_0082530 3300049569 Bacteria 2138
236 Ga0501032_0225522 3300049569 Bacteria 1219
237 Ga0501033_0002863 3300049570 Bacteria 14457
238 Ga0501033_0004994 3300049570 Bacteria 10553
239 Ga0501033_0322344 3300049570 Bacteria 1085
240 Ga0501034_0010507 3300049571 Bacteria 9641
241 Ga0501034_0523568 3300049571 Bacteria 1097
242 Ga0501036_0016279 3300049572 Bacteria 6211
243 Ga0501036_0760484 3300049572 Unclassified 799
244 Ga0501038_0002164 3300049574 Bacteria 18263
245 Ga0501039_0517144 3300049575 Bacteria 937
246 Ga0501039_0885666 3300049575 Bacteria 695
247 Ga0501042_0200810 3300049578 Bacteria 1438
248 Ga0501046_0005671 3300049580 Bacteria 11142
249 Ga0501046_0178068 3300049580 Bacteria 1591
250 Ga0501047_0144912 3300049581 Bacteria 2252
251 Ga0501047_0148179 3300049581 Bacteria 2223
252 Ga0501048_0013094 3300049582 Bacteria 6157
253 Ga0501048_0077225 3300049582 Bacteria 2350
254 Ga0501067_0017402 3300049583 Bacteria 3973
255 Ga0501067_0044817 3300049583 Bacteria 2457
256 Ga0501068_0020170 3300049584 Bacteria 3880
257 Ga0501069_0079509 3300049585 Bacteria 1845
258 Ga0501070_0006507 3300049586 Bacteria 9932
259 Ga0501070_0139671 3300049586 Bacteria 2000
260 Ga0501072_0143500 3300049588 Bacteria 1904
261 Ga0501073_0001159 3300049589 Bacteria 19209
262 Ga0501073_0164307 3300049589 Bacteria 1537
263 Ga0501076_0166330 3300049592 Bacteria 1797
264 Ga0501079_0003971 3300049741 Bacteria 10930
265 Ga0501079_0025664 3300049741 Bacteria 4517
266 Ga0501079_1488259 3300049741 Bacteria 533
267 Ga0501080_0019335 3300049742 Bacteria 6310
268 Ga0501080_0045902 3300049742 Bacteria 4068
269 Ga0501081_0400712 3300049743 Unclassified 1016
270 Ga0501083_0009479 3300049744 Bacteria 6876
271 Ga0501035_0003827 3300049822 Bacteria 14343
272 Ga0501035_0084861 3300049822 Bacteria 2792
273 Ga0501044_0468310 3300049823 Bacteria 1164
274 Ga0501045_0010661 3300049824 Bacteria 6442
275 nmdc:mga07m45_576380_c1 3300050496 Bacteria 650
276 nmdc:mga08x19_181371_c1 3300050514 Bacteria 1437
277 Ga0495601_0438877 3300053077 Bacteria 845
278 Ga0495619_0014212 3300053085 Bacteria 5028
279 Ga0500578_0137927 3300053086 Bacteria 1526
280 Ga0501084_0007425 3300054114 Bacteria 9035
281 Ga0501084_0265327 3300054114 Bacteria 1450
282 Ga0501082_0008588 3300060353 Bacteria 8811
283 Ga0466962_0089848 3300061719 Bacteria 1471

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005530 Ga0070679_100289411 Ga0070679_1002894112 143
2 3300048915 Ga0496112_1861965 Ga0496112_1861965_32_496 143
3 3300005344 Ga0070661_100080494 Ga0070661_1000804942 149
4 3300009101 Ga0105247_10308869 Ga0105247_103088691 149
5 3300009545 Ga0105237_11811420 Ga0105237_118114201 149
6 3300009551 Ga0105238_10088081 Ga0105238_100880814 149
7 3300013104 Ga0157370_10051834 Ga0157370_100518343 149
8 3300013105 Ga0157369_10000472 Ga0157369_100004722 149
9 3300014968 Ga0157379_10402440 Ga0157379_104024402 149
10 3300022467 Ga0224712_10004095 Ga0224712_100040951 149
11 3300046692 Ga0495671_0120038 Ga0495671_0120038_522_971 149
12 3300048928 Ga0496125_0547260 Ga0496125_0547260_118_600 149
13 3300049741 Ga0501079_1488259 Ga0501079_1488259_10_462 149
14 3300053077 Ga0495601_0438877 Ga0495601_0438877_14_466 149
15 3300005468 Ga0070707_100045842 Ga0070707_1000458424 159
16 3300025922 Ga0207646_10203151 Ga0207646_102031512 159
17 3300047444 Ga0495675_0105380 Ga0495675_0105380_308_787 159
18 3300037312 Ga0395899_0004290 Ga0395899_0004290_6600_7130 163
19 3300037466 Ga0395898_0109194 Ga0395898_0109194_71_601 163
20 3300038443 Ga0395901_0000529 Ga0395901_0000529_18478_19008 163
21 iso_pu_bacteria 2501025502 2501083048 165
22 iso_pu_bacteria 2508501125 2509126732 165
23 iso_pu_bacteria 2510917013 2511090976 165
24 iso_pu_bacteria 2515154189 2516020951 165
25 iso_pu_bacteria 2526164713 2527078167 165
26 iso_pu_bacteria 2596583598 2597032489 165
27 iso_pu_bacteria 2599185178 2599447736 165
28 iso_pu_bacteria 2738541296 2738819561 165
29 iso_pu_bacteria 2738541298 2738832040 165
30 iso_pu_bacteria 2738541306 2738873568 165
31 iso_pu_bacteria 2738543002 2739185198 165
32 iso_pu_bacteria 2738543008 2739220167 165
33 iso_pu_bacteria 2791355197 2793067411 165
34 iso_pu_bacteria 2821443989 2821445893 165
35 iso_pu_bacteria 2844533157 2844535001 165
36 iso_pu_bacteria 2885266251 2885266556 165
37 iso_pu_bacteria 2900577576 2900578842 165
38 iso_pu_bacteria 2900577576 2900580323 165
39 iso_pu_bacteria 2903727486 2903729083 165
40 iso_pu_bacteria 2904483920 2904489439 165
41 iso_pu_bacteria 2908739725 2908747125 165
42 iso_pu_bacteria 2919527303 2919531808 165
43 iso_pu_bacteria 2928058823 2928059597 165
44 iso_pu_bacteria 3005718088 3005722224 165
45 iso_pu_bacteria 2600255067 2600811806 166
46 3300005843 Ga0068860_100487456 Ga0068860_1004874561 168
47 3300001915 JGI24741J21665_1000708 JGI24741J21665_10007088 169
48 3300001979 JGI24740J21852_10000046 JGI24740J21852_1000004627 169
49 3300001979 JGI24740J21852_10000958 JGI24740J21852_100009587 169
50 3300002705 JGI25156J39149_1000465 JGI25156J39149_10004653 169
51 3300002705 JGI25156J39149_1005584 JGI25156J39149_10055842 169
52 3300002705 JGI25156J39149_1006419 JGI25156J39149_10064192 169
53 3300002738 JGI25154J39366_1003220 JGI25154J39366_10032203 169
54 3300002772 JGI25164J39214_1007497 JGI25164J39214_10074972 169
55 3300003187 JGI25151J46595_10039026 JGI25151J46595_100390263 169
56 3300003214 JGI25165J46597_1000596 JGI25165J46597_100059627 169
57 3300003214 JGI25165J46597_1006921 JGI25165J46597_10069213 169
58 3300003320 rootH2_10158678 rootH2_101586782 169
59 3300003320 rootH2_10301640 rootH2_103016401 169
60 3300003578 Ga0006562J51391_1094088 Ga0006562J51391_10940882 169
61 3300003659 JGI25404J52841_10014733 JGI25404J52841_100147332 169
62 3300003659 JGI25404J52841_10024580 JGI25404J52841_100245802 169
63 3300003751 Ga0055538_1003520 Ga0055538_10035203 169
64 3300003752 Ga0055539_1000108 Ga0055539_100010846 169
65 3300003756 Ga0055533_1001980 Ga0055533_10019804 169
66 3300003758 Ga0055532_1000014 Ga0055532_1000014168 169
67 3300003758 Ga0055532_1000073 Ga0055532_100007374 169
68 3300003759 Ga0055525_1000259 Ga0055525_100025946 169
69 3300003760 Ga0055527_1000013 Ga0055527_1000013172 169
70 3300003760 Ga0055527_1000638 Ga0055527_10006389 169
71 3300003760 Ga0055527_1005901 Ga0055527_10059013 169
72 3300003761 Ga0055535_1000011 Ga0055535_1000011170 169
73 3300003761 Ga0055535_1000055 Ga0055535_100005574 169
74 3300003762 Ga0055542_1000018 Ga0055542_1000018172 169
75 3300003762 Ga0055542_1000876 Ga0055542_100087613 169
76 3300003763 Ga0055529_1000017 Ga0055529_1000017170 169
77 3300003763 Ga0055529_1000149 Ga0055529_100014947 169
78 3300003841 Ga0055541_1000244 Ga0055541_10002449 169
79 3300005262 Ga0065165_1000667 Ga0065165_100066746 169
80 3300005327 Ga0070658_10046331 Ga0070658_100463311 169
81 3300005336 Ga0070680_100167294 Ga0070680_1001672942 169
82 3300005336 Ga0070680_100461581 Ga0070680_1004615812 169
83 3300005339 Ga0070660_100196444 Ga0070660_1001964442 169
84 3300005339 Ga0070660_100645921 Ga0070660_1006459211 169
85 3300005344 Ga0070661_100001467 Ga0070661_1000014674 169
86 3300005344 Ga0070661_100033008 Ga0070661_1000330082 169
87 3300005347 Ga0070668_100155326 Ga0070668_1001553262 169
88 3300005356 Ga0070674_100471280 Ga0070674_1004712801 169
89 3300005356 Ga0070674_101272379 Ga0070674_1012723791 169
90 3300005366 Ga0070659_100026949 Ga0070659_1000269493 169
91 3300005366 Ga0070659_100088343 Ga0070659_1000883432 169
92 3300005366 Ga0070659_100544581 Ga0070659_1005445811 169
93 3300005455 Ga0070663_100000061 Ga0070663_1000000612 169
94 3300005458 Ga0070681_10020849 Ga0070681_100208494 169
95 3300005530 Ga0070679_100187952 Ga0070679_1001879522 169
96 3300005530 Ga0070679_100726868 Ga0070679_1007268682 169
97 3300005548 Ga0070665_100000187 Ga0070665_10000018736 169
98 3300005563 Ga0068855_100003028 Ga0068855_10000302820 169
99 3300005563 Ga0068855_101000609 Ga0068855_1010006091 169
100 3300005564 Ga0070664_100000010 Ga0070664_10000001098 169
101 3300005577 Ga0068857_100003693 Ga0068857_1000036936 169
102 3300005578 Ga0068854_100003098 Ga0068854_1000030987 169
103 3300005614 Ga0068856_100000045 Ga0068856_10000004554 169
104 3300005614 Ga0068856_100000451 Ga0068856_1000004511 169
105 3300005615 Ga0070702_100033839 Ga0070702_1000338392 169
106 3300005718 Ga0068866_10033504 Ga0068866_100335042 169
107 3300005718 Ga0068866_10219181 Ga0068866_102191812 169
108 3300005844 Ga0068862_100344482 Ga0068862_1003444823 169
109 3300005983 Ga0081540_1001267 Ga0081540_10012678 169
110 3300005983 Ga0081540_1013239 Ga0081540_10132392 169
111 3300006173 Ga0070716_101349550 Ga0070716_1013495501 169
112 3300006358 Ga0068871_100302535 Ga0068871_1003025353 169
113 3300006871 Ga0075434_101098554 Ga0075434_1010985542 169
114 3300009093 Ga0105240_10054596 Ga0105240_100545965 169
115 3300009093 Ga0105240_10322763 Ga0105240_103227632 169
116 3300009093 Ga0105240_10557676 Ga0105240_105576761 169
117 3300009098 Ga0105245_10146580 Ga0105245_101465802 169
118 3300009174 Ga0105241_10501651 Ga0105241_105016511 169
119 3300009545 Ga0105237_10010103 Ga0105237_100101032 169
120 3300009545 Ga0105237_10022910 Ga0105237_100229104 169
121 3300009545 Ga0105237_10549827 Ga0105237_105498271 169
122 3300013100 Ga0157373_10001786 Ga0157373_100017864 169
123 3300013102 Ga0157371_10000088 Ga0157371_1000008849 169
124 3300013104 Ga0157370_10000041 Ga0157370_1000004146 169
125 3300013104 Ga0157370_10004703 Ga0157370_1000470315 169
126 3300013105 Ga0157369_10002013 Ga0157369_100020133 169
127 3300013105 Ga0157369_10057480 Ga0157369_100574803 169
128 3300013297 Ga0157378_10011676 Ga0157378_100116764 169
129 3300013297 Ga0157378_10144407 Ga0157378_101444072 169
130 3300013307 Ga0157372_10000097 Ga0157372_1000009775 169
131 3300013307 Ga0157372_10056854 Ga0157372_100568543 169
132 3300014497 Ga0182008_10023627 Ga0182008_100236272 169
133 3300015261 Ga0182006_1000898 Ga0182006_100089817 169
134 3300015261 Ga0182006_1001299 Ga0182006_100129917 169
135 3300017792 Ga0163161_10583115 Ga0163161_105831152 169
136 3300020610 Ga0154015_1486453 Ga0154015_14864532 169
137 3300025224 Ga0209784_100008 Ga0209784_100008147 169
138 3300025224 Ga0209784_100180 Ga0209784_10018020 169
139 3300025224 Ga0209784_101653 Ga0209784_1016533 169
140 3300025224 Ga0209784_101822 Ga0209784_1018223 169
141 3300025225 Ga0209566_100006 Ga0209566_100006147 169
142 3300025225 Ga0209566_100502 Ga0209566_10050223 169
143 3300025225 Ga0209566_102032 Ga0209566_1020323 169
144 3300025226 Ga0209674_100045 Ga0209674_100045164 169
145 3300025226 Ga0209674_100049 Ga0209674_100049113 169
146 3300025226 Ga0209674_100116 Ga0209674_10011648 169
147 3300025226 Ga0209674_104971 Ga0209674_1049712 169
148 3300025228 Ga0209672_100027 Ga0209672_100027163 169
149 3300025228 Ga0209672_100128 Ga0209672_10012846 169
150 3300025228 Ga0209672_100575 Ga0209672_10057522 169
151 3300025229 Ga0209147_100005 Ga0209147_100005144 169
152 3300025229 Ga0209147_100035 Ga0209147_100035163 169
153 3300025230 Ga0209563_100016 Ga0209563_100016147 169
154 3300025230 Ga0209563_101711 Ga0209563_1017115 169
155 3300025230 Ga0209563_108568 Ga0209563_1085682 169
156 3300025231 Ga0207427_101079 Ga0207427_1010792 169
157 3300025242 Ga0209258_100007 Ga0209258_100007144 169
158 3300025242 Ga0209258_100052 Ga0209258_100052156 169
159 3300025246 Ga0209646_1000027 Ga0209646_1000027120 169
160 3300025246 Ga0209646_1013692 Ga0209646_10136921 169
161 3300025250 Ga0209026_1007608 Ga0209026_10076083 169
162 3300025250 Ga0209026_1031644 Ga0209026_10316441 169
163 3300025253 Ga0209677_100008 Ga0209677_100008545 169
164 3300025253 Ga0209677_100693 Ga0209677_10069314 169
165 3300025254 Ga0209148_1000019 Ga0209148_1000019214 169
166 3300025254 Ga0209148_1000064 Ga0209148_1000064156 169
167 3300025254 Ga0209148_1006253 Ga0209148_10062533 169
168 3300025256 Ga0209759_1000041 Ga0209759_1000041119 169
169 3300025256 Ga0209759_1003171 Ga0209759_10031719 169
170 3300025256 Ga0209759_1008256 Ga0209759_10082562 169
171 3300025261 Ga0209233_1000073 Ga0209233_1000073174 169
172 3300025261 Ga0209233_1010764 Ga0209233_10107644 169
173 3300025272 Ga0209455_1000011 Ga0209455_100001169 169
174 3300025272 Ga0209455_1000057 Ga0209455_1000057156 169
175 3300025284 Ga0209130_1000106 Ga0209130_1000106114 169
176 3300025294 Ga0209025_1005644 Ga0209025_10056448 169
177 3300025302 Ga0207426_1027387 Ga0207426_10273871 169
178 3300025901 Ga0207688_10245523 Ga0207688_102455232 169
179 3300025909 Ga0207705_10018891 Ga0207705_100188916 169
180 3300025912 Ga0207707_10013883 Ga0207707_100138839 169
181 3300025913 Ga0207695_10001416 Ga0207695_1000141627 169
182 3300025913 Ga0207695_10273308 Ga0207695_102733082 169
183 3300025917 Ga0207660_10032734 Ga0207660_100327343 169
184 3300025917 Ga0207660_10437378 Ga0207660_104373782 169
185 3300025919 Ga0207657_10024118 Ga0207657_100241182 169
186 3300025919 Ga0207657_10208828 Ga0207657_102088282 169
187 3300025920 Ga0207649_10000170 Ga0207649_1000017016 169
188 3300025920 Ga0207649_10061998 Ga0207649_100619982 169
189 3300025921 Ga0207652_10023367 Ga0207652_100233674 169
190 3300025921 Ga0207652_10088449 Ga0207652_100884492 169
191 3300025921 Ga0207652_10710567 Ga0207652_107105671 169
192 3300025929 Ga0207664_10514011 Ga0207664_105140112 169
193 3300025932 Ga0207690_10175184 Ga0207690_101751842 169
194 3300025932 Ga0207690_10490139 Ga0207690_104901391 169
195 3300025937 Ga0207669_10199160 Ga0207669_101991602 169
196 3300025940 Ga0207691_10926821 Ga0207691_109268211 169
197 3300025945 Ga0207679_10000024 Ga0207679_10000024151 169
198 3300025949 Ga0207667_10026365 Ga0207667_100263654 169
199 3300025981 Ga0207640_10002272 Ga0207640_100022727 169
200 3300026067 Ga0207678_10000018 Ga0207678_1000001846 169
201 3300026067 Ga0207678_10055548 Ga0207678_100555482 169
202 3300026078 Ga0207702_10000053 Ga0207702_10000053112 169
203 3300026116 Ga0207674_10001884 Ga0207674_100018845 169
204 3300026142 Ga0207698_10129879 Ga0207698_101298792 169
205 3300028379 Ga0268266_10000003 Ga0268266_100000031275 169
206 3300028379 Ga0268266_10008069 Ga0268266_1000806910 169
207 3300028380 Ga0268265_10474144 Ga0268265_104741442 169
208 3300028380 Ga0268265_10939252 Ga0268265_109392521 169
209 3300028381 Ga0268264_11325253 Ga0268264_113252532 169
210 3300028800 Ga0265338_10434429 Ga0265338_104344292 169
211 3300030742 Ga0316183_1007381 Ga0316183_10073811 169
212 3300031247 Ga0265340_10057162 Ga0265340_100571622 169
213 3300031456 Ga0307513_10005321 Ga0307513_1000532112 169
214 3300035116 Ga0373945_0052554 Ga0373945_0052554_112_624 169
215 3300035171 Ga0373946_0004814 Ga0373946_0004814_1046_1558 169
216 3300035695 Ga0373927_0635580 Ga0373927_0635580_136_648 169
217 3300037068 Ga0373925_0701324 Ga0373925_0701324_142_654 169
218 3300037418 Ga0395900_0030046 Ga0395900_0030046_3228_3737 169
219 3300037471 Ga0395905_0678358 Ga0395905_0678358_364_873 169
220 3300041452 Ga0451793_0747671 Ga0451793_0747671_100_717 169
221 3300041453 Ga0451797_1455590 Ga0451797_1455590_189_806 169
222 3300044650 Ga0466986_0089581 Ga0466986_0089581_1442_1951 169
223 3300044650 Ga0466986_0235485 Ga0466986_0235485_654_1163 169
224 3300044656 Ga0466969_0010359 Ga0466969_0010359_4328_4837 169
225 3300044656 Ga0466969_0084318 Ga0466969_0084318_843_1352 169
226 3300044658 Ga0466972_0000317 Ga0466972_0000317_11651_12160 169
227 3300044671 Ga0466978_0204757 Ga0466978_0204757_449_958 169
228 3300044672 Ga0466982_0000600 Ga0466982_0000600_6266_6775 169
229 3300044684 Ga0466966_0054356 Ga0466966_0054356_1803_2312 169
230 3300044693 Ga0466961_0000030 Ga0466961_0000030_68972_69481 169
231 3300044693 Ga0466961_0223708 Ga0466961_0223708_624_1133 169
232 3300044694 Ga0466963_0005020 Ga0466963_0005020_1909_2418 169
233 3300044706 Ga0466964_0003078 Ga0466964_0003078_1261_1770 169
234 3300044719 Ga0466971_0010025 Ga0466971_0010025_135_644 169
235 3300044719 Ga0466971_0088608 Ga0466971_0088608_889_1404 169
236 3300044765 Ga0466970_0001069 Ga0466970_0001069_2836_3345 169
237 3300044842 Ga0466957_0120260 Ga0466957_0120260_217_726 169
238 3300044901 Ga0466960_0009797 Ga0466960_0009797_1337_1846 169
239 3300045049 Ga0466959_0000550 Ga0466959_0000550_16443_16952 169
240 3300045836 Ga0466958_0063252 Ga0466958_0063252_15_524 169
241 3300045976 Ga0466967_0006318 Ga0466967_0006318_754_1263 169
242 3300045976 Ga0466967_1720302 Ga0466967_1720302_50_559 169
243 3300046459 Ga0495629_0359780 Ga0495629_0359780_367_879 169
244 3300046461 Ga0495641_0037677 Ga0495641_0037677_1638_2150 169
245 3300046472 Ga0495580_0249928 Ga0495580_0249928_515_1027 169
246 3300046473 Ga0495582_0068138 Ga0495582_0068138_158_670 169
247 3300046476 Ga0495662_0030065 Ga0495662_0030065_1545_2057 169
248 3300046516 Ga0495628_0035147 Ga0495628_0035147_2772_3281 169
249 3300046524 Ga0495648_0161273 Ga0495648_0161273_48_560 169
250 3300046526 Ga0495666_0052200 Ga0495666_0052200_1316_1828 169
251 3300046681 Ga0495647_0004178 Ga0495647_0004178_922_1434 169
252 3300046689 Ga0495613_0671434 Ga0495613_0671434_113_625 169
253 3300046690 Ga0495624_0027364 Ga0495624_0027364_160_672 169
254 3300046694 Ga0495649_0019824 Ga0495649_0019824_204_713 169
255 3300047321 Ga0495676_0156992 Ga0495676_0156992_1017_1529 169
256 3300048918 Ga0496115_0240383 Ga0496115_0240383_330_842 169
257 3300048920 Ga0496117_0040645 Ga0496117_0040645_2197_2706 169
258 3300048921 Ga0496118_0156413 Ga0496118_0156413_184_693 169
259 3300048928 Ga0496125_0002069 Ga0496125_0002069_7897_8406 169
260 3300049568 Ga0501031_0154900 Ga0501031_0154900_563_1084 169
261 3300049569 Ga0501032_0037856 Ga0501032_0037856_1138_1680 169
262 3300049569 Ga0501032_0082530 Ga0501032_0082530_1238_1750 169
263 3300049569 Ga0501032_0225522 Ga0501032_0225522_469_981 169
264 3300049570 Ga0501033_0002863 Ga0501033_0002863_12504_13046 169
265 3300049570 Ga0501033_0004994 Ga0501033_0004994_6895_7407 169
266 3300049570 Ga0501033_0322344 Ga0501033_0322344_337_858 169
267 3300049571 Ga0501034_0010507 Ga0501034_0010507_5508_6050 169
268 3300049571 Ga0501034_0523568 Ga0501034_0523568_453_974 169
269 3300049572 Ga0501036_0016279 Ga0501036_0016279_4761_5303 169
270 3300049572 Ga0501036_0760484 Ga0501036_0760484_36_557 169
271 3300049574 Ga0501038_0002164 Ga0501038_0002164_1605_2147 169
272 3300049575 Ga0501039_0517144 Ga0501039_0517144_312_854 169
273 3300049575 Ga0501039_0885666 Ga0501039_0885666_42_554 169
274 3300049578 Ga0501042_0200810 Ga0501042_0200810_161_673 169
275 3300049580 Ga0501046_0005671 Ga0501046_0005671_8387_8929 169
276 3300049580 Ga0501046_0178068 Ga0501046_0178068_52_564 169
277 3300049581 Ga0501047_0144912 Ga0501047_0144912_1153_1695 169
278 3300049581 Ga0501047_0148179 Ga0501047_0148179_1339_1851 169
279 3300049582 Ga0501048_0013094 Ga0501048_0013094_2069_2581 169
280 3300049582 Ga0501048_0077225 Ga0501048_0077225_660_1202 169
281 3300049583 Ga0501067_0017402 Ga0501067_0017402_3365_3907 169
282 3300049583 Ga0501067_0044817 Ga0501067_0044817_596_1108 169
283 3300049584 Ga0501068_0020170 Ga0501068_0020170_2196_2708 169
284 3300049585 Ga0501069_0079509 Ga0501069_0079509_434_946 169
285 3300049586 Ga0501070_0006507 Ga0501070_0006507_4586_5128 169
286 3300049586 Ga0501070_0139671 Ga0501070_0139671_194_706 169
287 3300049588 Ga0501072_0143500 Ga0501072_0143500_547_1059 169
288 3300049589 Ga0501073_0001159 Ga0501073_0001159_12357_12899 169
289 3300049589 Ga0501073_0164307 Ga0501073_0164307_951_1463 169
290 3300049592 Ga0501076_0166330 Ga0501076_0166330_509_1021 169
291 3300049741 Ga0501079_0003971 Ga0501079_0003971_9692_10204 169
292 3300049741 Ga0501079_0025664 Ga0501079_0025664_2832_3344 169
293 3300049742 Ga0501080_0019335 Ga0501080_0019335_2933_3445 169
294 3300049742 Ga0501080_0045902 Ga0501080_0045902_2884_3426 169
295 3300049743 Ga0501081_0400712 Ga0501081_0400712_238_750 169
296 3300049744 Ga0501083_0009479 Ga0501083_0009479_4760_5302 169
297 3300049822 Ga0501035_0003827 Ga0501035_0003827_10966_11478 169
298 3300049822 Ga0501035_0084861 Ga0501035_0084861_1977_2519 169
299 3300049823 Ga0501044_0468310 Ga0501044_0468310_211_753 169
300 3300049824 Ga0501045_0010661 Ga0501045_0010661_28_570 169
301 3300050496 nmdc:mga07m45_576380_c1 nmdc:mga07m45_576380_c1_51_560 169
302 3300050514 nmdc:mga08x19_181371_c1 nmdc:mga08x19_181371_c1_282_821 169
303 3300053085 Ga0495619_0014212 Ga0495619_0014212_1423_2070 169
304 3300053086 Ga0500578_0137927 Ga0500578_0137927_846_1358 169
305 3300054114 Ga0501084_0007425 Ga0501084_0007425_4401_4913 169
306 3300054114 Ga0501084_0265327 Ga0501084_0265327_795_1337 169
307 3300060353 Ga0501082_0008588 Ga0501082_0008588_4175_4687 169
308 3300061719 Ga0466962_0089848 Ga0466962_0089848_664_1173 169

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08002

DUF1697

Protein of unknown function (DUF1697)

1

126

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hiy-assembly1.cif.gz_B the structure of conserved bacterial protein sp0830 from streptococcus pneumoniae. 0.8143 2 167
2hiy-assembly1.cif.gz_A the structure of conserved bacterial protein sp0830 from streptococcus pneumoniae. 0.8122 1 169
2hiy-assembly1.cif.gz_A the structure of conserved bacterial protein sp0830 from streptococcus pneumoniae. 0.808 1 169
2hiy-assembly1.cif.gz_B the structure of conserved bacterial protein sp0830 from streptococcus pneumoniae. 0.797 2 167
2rsq-assembly1.cif.gz_A copper(i) loaded form of the first domain of the human copper chaperone for sod1, ccs 0.7671 2 78
ID Description Score Start End Superfamily
af_O06552_36_123_3.30.70.1280 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;SP0830-like domains 0.9133 2 86 3.30.70.1280
af_Q54C13_1_90_3.30.70.1280 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;SP0830-like domains 0.9117 1 88 3.30.70.1280
af_Q54C13_1_90_3.30.70.1280 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;SP0830-like domains 0.8835 1 88 3.30.70.1280
af_O06552_36_123_3.30.70.1280 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;SP0830-like domains 0.8649 2 86 3.30.70.1280
2hiyB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;SP0830-like domains 0.8466 1 88 3.30.70.1280
ID Description Score Start End GO Terms
AF-A0A8B4S5X0-F1-model_v4 Uncharacterized protein conserved in bacteria 0.9932 21 168
AF-A0A2S5LIS7-F1-model_v4 DUF1697 domain-containing protein 0.9916 21 168
AF-A0A1H5I8W1-F1-model_v4 Uncharacterized conserved protein, DUF1697 family 0.9879 47 168
AF-A0A0E3Z349-F1-model_v4 DUF1697 domain-containing protein 0.9783 1 168
AF-A0A3R9P6K5-F1-model_v4 Uncharacterized protein (DUF1697 family) 0.9775 1 168

Feature Viewer

pLDDT pTM Quality
91.22 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map