F399775
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 308 | 213 | 283 | 170 |
Family's Representative Sequence
| Representative Sequence | 3300037312|Ga0395899_0004290|Ga0395899_0004290_6600_7130 |
| Length | 170 |
| Sequence | MTRYVAFLRAVNVGGTGKLPMAELRAMCERIGFSSVRTYIASGNVVFDSPHDAATVKRSLYAGKPVGVLIRTGPELAAVLAGNPFKTAAPNRTVAIFLDAPPPADALAKASGRQDEEMALGKREIYVHYGSGMARSKLKIPAAIAGTARNMNTVATLVEWTAVRSDATNG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 2 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 3 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 4 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 5 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 6 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 7 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 8 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 9 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 10 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 11 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 12 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 13 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 14 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 15 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 16 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 17 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 18 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 19 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 20 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 21 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 22 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 23 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 24 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 25 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 26 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 27 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 28 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 29 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 30 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 31 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 32 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 33 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 34 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 35 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 36 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 37 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 38 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 39 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 40 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 41 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 42 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 43 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 44 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 45 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 46 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 68 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 71 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 84 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 86 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 88 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 89 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 98 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 99 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 102 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 131 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 132 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 133 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 134 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 135 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 136 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 137 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 138 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 139 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 140 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 141 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 142 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 143 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 144 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 145 | 3300044650 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E | Metagenome | Unclassified |
| 146 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 147 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 148 | 3300044671 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E | Metagenome | Unclassified |
| 149 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 150 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 151 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 152 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 153 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 154 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 155 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 156 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 157 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 158 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 159 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 160 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 161 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 177 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 178 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 179 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 180 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 181 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 192 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 195 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 196 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 204 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 207 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 208 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 211 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 212 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.91 |
| Metatranscriptomes | 0.97 |
| Isolates | 8.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 18.51 |
| Nodule | 1.95 |
| Rhizoplane | 1.62 |
| Rhizosphere | 65.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.01 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1000708 | 3300001915 | Bacteria | 10049 |
| 2 | JGI24740J21852_10000046 | 3300001979 | Bacteria | 40023 |
| 3 | JGI24740J21852_10000958 | 3300001979 | Bacteria | 12848 |
| 4 | JGI25156J39149_1000465 | 3300002705 | Bacteria | 24472 |
| 5 | JGI25156J39149_1005584 | 3300002705 | Bacteria | 3596 |
| 6 | JGI25156J39149_1006419 | 3300002705 | Bacteria | 3214 |
| 7 | JGI25154J39366_1003220 | 3300002738 | Bacteria | 3571 |
| 8 | JGI25164J39214_1007497 | 3300002772 | Bacteria | 1109 |
| 9 | JGI25151J46595_10039026 | 3300003187 | Bacteria | 1759 |
| 10 | JGI25165J46597_1000596 | 3300003214 | Bacteria | 31107 |
| 11 | JGI25165J46597_1006921 | 3300003214 | Bacteria | 1953 |
| 12 | rootH2_10158678 | 3300003320 | Bacteria | 1652 |
| 13 | rootH2_10301640 | 3300003320 | Unclassified | 1733 |
| 14 | Ga0006562J51391_1094088 | 3300003578 | Bacteria | 3480 |
| 15 | JGI25404J52841_10014733 | 3300003659 | Bacteria | 1697 |
| 16 | JGI25404J52841_10024580 | 3300003659 | Bacteria | 1298 |
| 17 | Ga0055538_1003520 | 3300003751 | Bacteria | 1969 |
| 18 | Ga0055539_1000108 | 3300003752 | Bacteria | 91377 |
| 19 | Ga0055533_1001980 | 3300003756 | Bacteria | 5005 |
| 20 | Ga0055532_1000014 | 3300003758 | Bacteria | 344702 |
| 21 | Ga0055532_1000073 | 3300003758 | Bacteria | 131021 |
| 22 | Ga0055525_1000259 | 3300003759 | Bacteria | 50588 |
| 23 | Ga0055527_1000013 | 3300003760 | Bacteria | 347416 |
| 24 | Ga0055527_1000638 | 3300003760 | Bacteria | 10762 |
| 25 | Ga0055527_1005901 | 3300003760 | Bacteria | 1560 |
| 26 | Ga0055535_1000011 | 3300003761 | Bacteria | 347416 |
| 27 | Ga0055535_1000055 | 3300003761 | Bacteria | 131021 |
| 28 | Ga0055542_1000018 | 3300003762 | Bacteria | 347416 |
| 29 | Ga0055542_1000876 | 3300003762 | Bacteria | 20941 |
| 30 | Ga0055529_1000017 | 3300003763 | Bacteria | 347416 |
| 31 | Ga0055529_1000149 | 3300003763 | Bacteria | 100620 |
| 32 | Ga0055541_1000244 | 3300003841 | Bacteria | 20295 |
| 33 | Ga0065165_1000667 | 3300005262 | Bacteria | 49547 |
| 34 | Ga0070658_10046331 | 3300005327 | Bacteria | 3519 |
| 35 | Ga0070680_100167294 | 3300005336 | Bacteria | 1849 |
| 36 | Ga0070680_100461581 | 3300005336 | Bacteria | 1085 |
| 37 | Ga0070660_100196444 | 3300005339 | Bacteria | 1635 |
| 38 | Ga0070660_100645921 | 3300005339 | Bacteria | 886 |
| 39 | Ga0070661_100001467 | 3300005344 | Bacteria | 16384 |
| 40 | Ga0070661_100033008 | 3300005344 | Bacteria | 3749 |
| 41 | Ga0070661_100080494 | 3300005344 | Bacteria | 2404 |
| 42 | Ga0070668_100155326 | 3300005347 | Bacteria | 1853 |
| 43 | Ga0070674_100471280 | 3300005356 | Unclassified | 1040 |
| 44 | Ga0070674_101272379 | 3300005356 | Bacteria | 655 |
| 45 | Ga0070659_100026949 | 3300005366 | Bacteria | 4424 |
| 46 | Ga0070659_100088343 | 3300005366 | Bacteria | 2482 |
| 47 | Ga0070659_100544581 | 3300005366 | Bacteria | 993 |
| 48 | Ga0070663_100000061 | 3300005455 | Bacteria | 46745 |
| 49 | Ga0070681_10020849 | 3300005458 | Bacteria | 6563 |
| 50 | Ga0070707_100045842 | 3300005468 | Bacteria | 4184 |
| 51 | Ga0070679_100187952 | 3300005530 | Bacteria | 2035 |
| 52 | Ga0070679_100289411 | 3300005530 | Bacteria | 1590 |
| 53 | Ga0070679_100726868 | 3300005530 | Bacteria | 936 |
| 54 | Ga0070665_100000187 | 3300005548 | Bacteria | 110095 |
| 55 | Ga0068855_100003028 | 3300005563 | Bacteria | 20568 |
| 56 | Ga0068855_101000609 | 3300005563 | Bacteria | 878 |
| 57 | Ga0070664_100000010 | 3300005564 | Bacteria | 165664 |
| 58 | Ga0068857_100003693 | 3300005577 | Bacteria | 12838 |
| 59 | Ga0068854_100003098 | 3300005578 | Bacteria | 10352 |
| 60 | Ga0068856_100000045 | 3300005614 | Bacteria | 110625 |
| 61 | Ga0068856_100000451 | 3300005614 | Bacteria | 45442 |
| 62 | Ga0070702_100033839 | 3300005615 | Bacteria | 2813 |
| 63 | Ga0068866_10033504 | 3300005718 | Bacteria | 2493 |
| 64 | Ga0068866_10219181 | 3300005718 | Unclassified | 1147 |
| 65 | Ga0068860_100487456 | 3300005843 | Unclassified | 1229 |
| 66 | Ga0068862_100344482 | 3300005844 | Bacteria | 1381 |
| 67 | Ga0081540_1001267 | 3300005983 | Bacteria | 22006 |
| 68 | Ga0081540_1013239 | 3300005983 | Bacteria | 5375 |
| 69 | Ga0070716_101349550 | 3300006173 | Bacteria | 578 |
| 70 | Ga0068871_100302535 | 3300006358 | Bacteria | 1404 |
| 71 | Ga0075434_101098554 | 3300006871 | Bacteria | 809 |
| 72 | Ga0105240_10054596 | 3300009093 | Bacteria | 5006 |
| 73 | Ga0105240_10322763 | 3300009093 | Bacteria | 1759 |
| 74 | Ga0105240_10557676 | 3300009093 | Bacteria | 1267 |
| 75 | Ga0105245_10146580 | 3300009098 | Bacteria | 2227 |
| 76 | Ga0105247_10308869 | 3300009101 | Bacteria | 1099 |
| 77 | Ga0105241_10501651 | 3300009174 | Bacteria | 1082 |
| 78 | Ga0105237_10010103 | 3300009545 | Bacteria | 10065 |
| 79 | Ga0105237_10022910 | 3300009545 | Bacteria | 6405 |
| 80 | Ga0105237_10549827 | 3300009545 | Bacteria | 1161 |
| 81 | Ga0105237_11811420 | 3300009545 | Unclassified | 618 |
| 82 | Ga0105238_10088081 | 3300009551 | Bacteria | 3091 |
| 83 | Ga0157373_10001786 | 3300013100 | Bacteria | 16343 |
| 84 | Ga0157371_10000088 | 3300013102 | Bacteria | 145526 |
| 85 | Ga0157370_10000041 | 3300013104 | Bacteria | 133912 |
| 86 | Ga0157370_10004703 | 3300013104 | Bacteria | 15562 |
| 87 | Ga0157370_10051834 | 3300013104 | Bacteria | 3919 |
| 88 | Ga0157369_10000472 | 3300013105 | Bacteria | 53307 |
| 89 | Ga0157369_10002013 | 3300013105 | Bacteria | 24489 |
| 90 | Ga0157369_10057480 | 3300013105 | Bacteria | 4197 |
| 91 | Ga0157378_10011676 | 3300013297 | Bacteria | 7688 |
| 92 | Ga0157378_10144407 | 3300013297 | Bacteria | 2212 |
| 93 | Ga0157372_10000097 | 3300013307 | Bacteria | 90742 |
| 94 | Ga0157372_10056854 | 3300013307 | Bacteria | 4372 |
| 95 | Ga0182008_10023627 | 3300014497 | Bacteria | 3136 |
| 96 | Ga0157379_10402440 | 3300014968 | Unclassified | 1258 |
| 97 | Ga0182006_1000898 | 3300015261 | Bacteria | 19947 |
| 98 | Ga0182006_1001299 | 3300015261 | Bacteria | 15405 |
| 99 | Ga0163161_10583115 | 3300017792 | Bacteria | 920 |
| 100 | Ga0154015_1486453 | 3300020610 | Bacteria | 5208 |
| 101 | Ga0224712_10004095 | 3300022467 | Bacteria | 3892 |
| 102 | Ga0209784_100008 | 3300025224 | Bacteria | 740293 |
| 103 | Ga0209784_100180 | 3300025224 | Bacteria | 52470 |
| 104 | Ga0209784_101653 | 3300025224 | Bacteria | 2728 |
| 105 | Ga0209784_101822 | 3300025224 | Bacteria | 2486 |
| 106 | Ga0209566_100006 | 3300025225 | Bacteria | 789272 |
| 107 | Ga0209566_100502 | 3300025225 | Bacteria | 27146 |
| 108 | Ga0209566_102032 | 3300025225 | Bacteria | 4255 |
| 109 | Ga0209674_100045 | 3300025226 | Bacteria | 362387 |
| 110 | Ga0209674_100049 | 3300025226 | Bacteria | 346969 |
| 111 | Ga0209674_100116 | 3300025226 | Bacteria | 135937 |
| 112 | Ga0209674_104971 | 3300025226 | Bacteria | 2054 |
| 113 | Ga0209672_100027 | 3300025228 | Bacteria | 344500 |
| 114 | Ga0209672_100128 | 3300025228 | Bacteria | 77946 |
| 115 | Ga0209672_100575 | 3300025228 | Bacteria | 19521 |
| 116 | Ga0209147_100005 | 3300025229 | Bacteria | 1036530 |
| 117 | Ga0209147_100035 | 3300025229 | Bacteria | 344500 |
| 118 | Ga0209563_100016 | 3300025230 | Bacteria | 802091 |
| 119 | Ga0209563_101711 | 3300025230 | Bacteria | 5550 |
| 120 | Ga0209563_108568 | 3300025230 | Bacteria | 1604 |
| 121 | Ga0207427_101079 | 3300025231 | Bacteria | 11187 |
| 122 | Ga0209258_100007 | 3300025242 | Bacteria | 1036530 |
| 123 | Ga0209258_100052 | 3300025242 | Bacteria | 344500 |
| 124 | Ga0209646_1000027 | 3300025246 | Bacteria | 395141 |
| 125 | Ga0209646_1013692 | 3300025246 | Bacteria | 1228 |
| 126 | Ga0209026_1007608 | 3300025250 | Bacteria | 2400 |
| 127 | Ga0209026_1031644 | 3300025250 | Bacteria | 783 |
| 128 | Ga0209677_100008 | 3300025253 | Bacteria | 802091 |
| 129 | Ga0209677_100693 | 3300025253 | Bacteria | 17214 |
| 130 | Ga0209148_1000019 | 3300025254 | Bacteria | 748518 |
| 131 | Ga0209148_1000064 | 3300025254 | Bacteria | 344500 |
| 132 | Ga0209148_1006253 | 3300025254 | Bacteria | 2602 |
| 133 | Ga0209759_1000041 | 3300025256 | Bacteria | 252893 |
| 134 | Ga0209759_1003171 | 3300025256 | Bacteria | 6705 |
| 135 | Ga0209759_1008256 | 3300025256 | Bacteria | 3260 |
| 136 | Ga0209233_1000073 | 3300025261 | Bacteria | 362383 |
| 137 | Ga0209233_1010764 | 3300025261 | Bacteria | 2722 |
| 138 | Ga0209455_1000011 | 3300025272 | Bacteria | 947242 |
| 139 | Ga0209455_1000057 | 3300025272 | Bacteria | 344500 |
| 140 | Ga0209130_1000106 | 3300025284 | Bacteria | 134559 |
| 141 | Ga0209025_1005644 | 3300025294 | Bacteria | 10089 |
| 142 | Ga0207426_1027387 | 3300025302 | Bacteria | 1899 |
| 143 | Ga0207688_10245523 | 3300025901 | Bacteria | 1083 |
| 144 | Ga0207705_10018891 | 3300025909 | Bacteria | 4928 |
| 145 | Ga0207707_10013883 | 3300025912 | Bacteria | 7023 |
| 146 | Ga0207695_10001416 | 3300025913 | Bacteria | 40402 |
| 147 | Ga0207695_10273308 | 3300025913 | Bacteria | 1585 |
| 148 | Ga0207660_10032734 | 3300025917 | Bacteria | 3590 |
| 149 | Ga0207660_10437378 | 3300025917 | Bacteria | 1056 |
| 150 | Ga0207657_10024118 | 3300025919 | Bacteria | 5647 |
| 151 | Ga0207657_10208828 | 3300025919 | Bacteria | 1568 |
| 152 | Ga0207649_10000170 | 3300025920 | Bacteria | 53356 |
| 153 | Ga0207649_10061998 | 3300025920 | Bacteria | 2356 |
| 154 | Ga0207652_10023367 | 3300025921 | Bacteria | 5121 |
| 155 | Ga0207652_10088449 | 3300025921 | Bacteria | 2718 |
| 156 | Ga0207652_10710567 | 3300025921 | Bacteria | 896 |
| 157 | Ga0207646_10203151 | 3300025922 | Bacteria | 1790 |
| 158 | Ga0207664_10514011 | 3300025929 | Bacteria | 1073 |
| 159 | Ga0207690_10175184 | 3300025932 | Bacteria | 1610 |
| 160 | Ga0207690_10490139 | 3300025932 | Bacteria | 993 |
| 161 | Ga0207669_10199160 | 3300025937 | Bacteria | 1452 |
| 162 | Ga0207691_10926821 | 3300025940 | Bacteria | 729 |
| 163 | Ga0207679_10000024 | 3300025945 | Bacteria | 204787 |
| 164 | Ga0207667_10026365 | 3300025949 | Bacteria | 6352 |
| 165 | Ga0207640_10002272 | 3300025981 | Bacteria | 10352 |
| 166 | Ga0207678_10000018 | 3300026067 | Bacteria | 135549 |
| 167 | Ga0207678_10055548 | 3300026067 | Bacteria | 3411 |
| 168 | Ga0207702_10000053 | 3300026078 | Bacteria | 137538 |
| 169 | Ga0207674_10001884 | 3300026116 | Bacteria | 26717 |
| 170 | Ga0207698_10129879 | 3300026142 | Bacteria | 2151 |
| 171 | Ga0268266_10000003 | 3300028379 | Bacteria | 1701703 |
| 172 | Ga0268266_10008069 | 3300028379 | Bacteria | 9405 |
| 173 | Ga0268265_10474144 | 3300028380 | Bacteria | 1174 |
| 174 | Ga0268265_10939252 | 3300028380 | Bacteria | 851 |
| 175 | Ga0268264_11325253 | 3300028381 | Unclassified | 730 |
| 176 | Ga0265338_10434429 | 3300028800 | Bacteria | 931 |
| 177 | Ga0316183_1007381 | 3300030742 | Bacteria | 940 |
| 178 | Ga0265340_10057162 | 3300031247 | Bacteria | 1875 |
| 179 | Ga0307513_10005321 | 3300031456 | Bacteria | 17020 |
| 180 | Ga0373945_0052554 | 3300035116 | Bacteria | 1501 |
| 181 | Ga0373946_0004814 | 3300035171 | Bacteria | 4858 |
| 182 | Ga0373927_0635580 | 3300035695 | Bacteria | 705 |
| 183 | Ga0373925_0701324 | 3300037068 | Bacteria | 834 |
| 184 | Ga0395899_0004290 | 3300037312 | Bacteria | 11140 |
| 185 | Ga0395900_0030046 | 3300037418 | Bacteria | 5577 |
| 186 | Ga0395898_0109194 | 3300037466 | Bacteria | 2652 |
| 187 | Ga0395905_0678358 | 3300037471 | Bacteria | 933 |
| 188 | Ga0395901_0000529 | 3300038443 | Bacteria | 43995 |
| 189 | Ga0451793_0747671 | 3300041452 | Bacteria | 903 |
| 190 | Ga0451797_1455590 | 3300041453 | Bacteria | 989 |
| 191 | Ga0466986_0089581 | 3300044650 | Bacteria | 2127 |
| 192 | Ga0466986_0235485 | 3300044650 | Bacteria | 1179 |
| 193 | Ga0466969_0010359 | 3300044656 | Bacteria | 4942 |
| 194 | Ga0466969_0084318 | 3300044656 | Bacteria | 1512 |
| 195 | Ga0466972_0000317 | 3300044658 | Bacteria | 27751 |
| 196 | Ga0466978_0204757 | 3300044671 | Bacteria | 1173 |
| 197 | Ga0466982_0000600 | 3300044672 | Bacteria | 10989 |
| 198 | Ga0466966_0054356 | 3300044684 | Bacteria | 2538 |
| 199 | Ga0466961_0000030 | 3300044693 | Bacteria | 86108 |
| 200 | Ga0466961_0223708 | 3300044693 | Bacteria | 1159 |
| 201 | Ga0466963_0005020 | 3300044694 | Bacteria | 7729 |
| 202 | Ga0466964_0003078 | 3300044706 | Bacteria | 6062 |
| 203 | Ga0466971_0010025 | 3300044719 | Bacteria | 4138 |
| 204 | Ga0466971_0088608 | 3300044719 | Bacteria | 1416 |
| 205 | Ga0466970_0001069 | 3300044765 | Bacteria | 13267 |
| 206 | Ga0466957_0120260 | 3300044842 | Bacteria | 1673 |
| 207 | Ga0466960_0009797 | 3300044901 | Bacteria | 3961 |
| 208 | Ga0466959_0000550 | 3300045049 | Bacteria | 21804 |
| 209 | Ga0466958_0063252 | 3300045836 | Bacteria | 2256 |
| 210 | Ga0466967_0006318 | 3300045976 | Bacteria | 8366 |
| 211 | Ga0466967_1720302 | 3300045976 | Bacteria | 624 |
| 212 | Ga0495629_0359780 | 3300046459 | Bacteria | 992 |
| 213 | Ga0495641_0037677 | 3300046461 | Bacteria | 2264 |
| 214 | Ga0495580_0249928 | 3300046472 | Bacteria | 1214 |
| 215 | Ga0495582_0068138 | 3300046473 | Bacteria | 1967 |
| 216 | Ga0495662_0030065 | 3300046476 | Bacteria | 2622 |
| 217 | Ga0495628_0035147 | 3300046516 | Bacteria | 4028 |
| 218 | Ga0495648_0161273 | 3300046524 | Bacteria | 1159 |
| 219 | Ga0495666_0052200 | 3300046526 | Bacteria | 1963 |
| 220 | Ga0495647_0004178 | 3300046681 | Bacteria | 4677 |
| 221 | Ga0495613_0671434 | 3300046689 | Bacteria | 684 |
| 222 | Ga0495624_0027364 | 3300046690 | Bacteria | 3733 |
| 223 | Ga0495671_0120038 | 3300046692 | Bacteria | 1283 |
| 224 | Ga0495649_0019824 | 3300046694 | Bacteria | 3777 |
| 225 | Ga0495676_0156992 | 3300047321 | Bacteria | 1613 |
| 226 | Ga0495675_0105380 | 3300047444 | Bacteria | 1762 |
| 227 | Ga0496112_1861965 | 3300048915 | Unclassified | 513 |
| 228 | Ga0496115_0240383 | 3300048918 | Bacteria | 1492 |
| 229 | Ga0496117_0040645 | 3300048920 | Bacteria | 3417 |
| 230 | Ga0496118_0156413 | 3300048921 | Bacteria | 1417 |
| 231 | Ga0496125_0002069 | 3300048928 | Bacteria | 27080 |
| 232 | Ga0496125_0547260 | 3300048928 | Unclassified | 642 |
| 233 | Ga0501031_0154900 | 3300049568 | Bacteria | 1497 |
| 234 | Ga0501032_0037856 | 3300049569 | Bacteria | 3287 |
| 235 | Ga0501032_0082530 | 3300049569 | Bacteria | 2138 |
| 236 | Ga0501032_0225522 | 3300049569 | Bacteria | 1219 |
| 237 | Ga0501033_0002863 | 3300049570 | Bacteria | 14457 |
| 238 | Ga0501033_0004994 | 3300049570 | Bacteria | 10553 |
| 239 | Ga0501033_0322344 | 3300049570 | Bacteria | 1085 |
| 240 | Ga0501034_0010507 | 3300049571 | Bacteria | 9641 |
| 241 | Ga0501034_0523568 | 3300049571 | Bacteria | 1097 |
| 242 | Ga0501036_0016279 | 3300049572 | Bacteria | 6211 |
| 243 | Ga0501036_0760484 | 3300049572 | Unclassified | 799 |
| 244 | Ga0501038_0002164 | 3300049574 | Bacteria | 18263 |
| 245 | Ga0501039_0517144 | 3300049575 | Bacteria | 937 |
| 246 | Ga0501039_0885666 | 3300049575 | Bacteria | 695 |
| 247 | Ga0501042_0200810 | 3300049578 | Bacteria | 1438 |
| 248 | Ga0501046_0005671 | 3300049580 | Bacteria | 11142 |
| 249 | Ga0501046_0178068 | 3300049580 | Bacteria | 1591 |
| 250 | Ga0501047_0144912 | 3300049581 | Bacteria | 2252 |
| 251 | Ga0501047_0148179 | 3300049581 | Bacteria | 2223 |
| 252 | Ga0501048_0013094 | 3300049582 | Bacteria | 6157 |
| 253 | Ga0501048_0077225 | 3300049582 | Bacteria | 2350 |
| 254 | Ga0501067_0017402 | 3300049583 | Bacteria | 3973 |
| 255 | Ga0501067_0044817 | 3300049583 | Bacteria | 2457 |
| 256 | Ga0501068_0020170 | 3300049584 | Bacteria | 3880 |
| 257 | Ga0501069_0079509 | 3300049585 | Bacteria | 1845 |
| 258 | Ga0501070_0006507 | 3300049586 | Bacteria | 9932 |
| 259 | Ga0501070_0139671 | 3300049586 | Bacteria | 2000 |
| 260 | Ga0501072_0143500 | 3300049588 | Bacteria | 1904 |
| 261 | Ga0501073_0001159 | 3300049589 | Bacteria | 19209 |
| 262 | Ga0501073_0164307 | 3300049589 | Bacteria | 1537 |
| 263 | Ga0501076_0166330 | 3300049592 | Bacteria | 1797 |
| 264 | Ga0501079_0003971 | 3300049741 | Bacteria | 10930 |
| 265 | Ga0501079_0025664 | 3300049741 | Bacteria | 4517 |
| 266 | Ga0501079_1488259 | 3300049741 | Bacteria | 533 |
| 267 | Ga0501080_0019335 | 3300049742 | Bacteria | 6310 |
| 268 | Ga0501080_0045902 | 3300049742 | Bacteria | 4068 |
| 269 | Ga0501081_0400712 | 3300049743 | Unclassified | 1016 |
| 270 | Ga0501083_0009479 | 3300049744 | Bacteria | 6876 |
| 271 | Ga0501035_0003827 | 3300049822 | Bacteria | 14343 |
| 272 | Ga0501035_0084861 | 3300049822 | Bacteria | 2792 |
| 273 | Ga0501044_0468310 | 3300049823 | Bacteria | 1164 |
| 274 | Ga0501045_0010661 | 3300049824 | Bacteria | 6442 |
| 275 | nmdc:mga07m45_576380_c1 | 3300050496 | Bacteria | 650 |
| 276 | nmdc:mga08x19_181371_c1 | 3300050514 | Bacteria | 1437 |
| 277 | Ga0495601_0438877 | 3300053077 | Bacteria | 845 |
| 278 | Ga0495619_0014212 | 3300053085 | Bacteria | 5028 |
| 279 | Ga0500578_0137927 | 3300053086 | Bacteria | 1526 |
| 280 | Ga0501084_0007425 | 3300054114 | Bacteria | 9035 |
| 281 | Ga0501084_0265327 | 3300054114 | Bacteria | 1450 |
| 282 | Ga0501082_0008588 | 3300060353 | Bacteria | 8811 |
| 283 | Ga0466962_0089848 | 3300061719 | Bacteria | 1471 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005530 | Ga0070679_100289411 | Ga0070679_1002894112 | 143 |
| 2 | 3300048915 | Ga0496112_1861965 | Ga0496112_1861965_32_496 | 143 |
| 3 | 3300005344 | Ga0070661_100080494 | Ga0070661_1000804942 | 149 |
| 4 | 3300009101 | Ga0105247_10308869 | Ga0105247_103088691 | 149 |
| 5 | 3300009545 | Ga0105237_11811420 | Ga0105237_118114201 | 149 |
| 6 | 3300009551 | Ga0105238_10088081 | Ga0105238_100880814 | 149 |
| 7 | 3300013104 | Ga0157370_10051834 | Ga0157370_100518343 | 149 |
| 8 | 3300013105 | Ga0157369_10000472 | Ga0157369_100004722 | 149 |
| 9 | 3300014968 | Ga0157379_10402440 | Ga0157379_104024402 | 149 |
| 10 | 3300022467 | Ga0224712_10004095 | Ga0224712_100040951 | 149 |
| 11 | 3300046692 | Ga0495671_0120038 | Ga0495671_0120038_522_971 | 149 |
| 12 | 3300048928 | Ga0496125_0547260 | Ga0496125_0547260_118_600 | 149 |
| 13 | 3300049741 | Ga0501079_1488259 | Ga0501079_1488259_10_462 | 149 |
| 14 | 3300053077 | Ga0495601_0438877 | Ga0495601_0438877_14_466 | 149 |
| 15 | 3300005468 | Ga0070707_100045842 | Ga0070707_1000458424 | 159 |
| 16 | 3300025922 | Ga0207646_10203151 | Ga0207646_102031512 | 159 |
| 17 | 3300047444 | Ga0495675_0105380 | Ga0495675_0105380_308_787 | 159 |
| 18 | 3300037312 | Ga0395899_0004290 | Ga0395899_0004290_6600_7130 | 163 |
| 19 | 3300037466 | Ga0395898_0109194 | Ga0395898_0109194_71_601 | 163 |
| 20 | 3300038443 | Ga0395901_0000529 | Ga0395901_0000529_18478_19008 | 163 |
| 21 | iso_pu_bacteria | 2501025502 | 2501083048 | 165 |
| 22 | iso_pu_bacteria | 2508501125 | 2509126732 | 165 |
| 23 | iso_pu_bacteria | 2510917013 | 2511090976 | 165 |
| 24 | iso_pu_bacteria | 2515154189 | 2516020951 | 165 |
| 25 | iso_pu_bacteria | 2526164713 | 2527078167 | 165 |
| 26 | iso_pu_bacteria | 2596583598 | 2597032489 | 165 |
| 27 | iso_pu_bacteria | 2599185178 | 2599447736 | 165 |
| 28 | iso_pu_bacteria | 2738541296 | 2738819561 | 165 |
| 29 | iso_pu_bacteria | 2738541298 | 2738832040 | 165 |
| 30 | iso_pu_bacteria | 2738541306 | 2738873568 | 165 |
| 31 | iso_pu_bacteria | 2738543002 | 2739185198 | 165 |
| 32 | iso_pu_bacteria | 2738543008 | 2739220167 | 165 |
| 33 | iso_pu_bacteria | 2791355197 | 2793067411 | 165 |
| 34 | iso_pu_bacteria | 2821443989 | 2821445893 | 165 |
| 35 | iso_pu_bacteria | 2844533157 | 2844535001 | 165 |
| 36 | iso_pu_bacteria | 2885266251 | 2885266556 | 165 |
| 37 | iso_pu_bacteria | 2900577576 | 2900578842 | 165 |
| 38 | iso_pu_bacteria | 2900577576 | 2900580323 | 165 |
| 39 | iso_pu_bacteria | 2903727486 | 2903729083 | 165 |
| 40 | iso_pu_bacteria | 2904483920 | 2904489439 | 165 |
| 41 | iso_pu_bacteria | 2908739725 | 2908747125 | 165 |
| 42 | iso_pu_bacteria | 2919527303 | 2919531808 | 165 |
| 43 | iso_pu_bacteria | 2928058823 | 2928059597 | 165 |
| 44 | iso_pu_bacteria | 3005718088 | 3005722224 | 165 |
| 45 | iso_pu_bacteria | 2600255067 | 2600811806 | 166 |
| 46 | 3300005843 | Ga0068860_100487456 | Ga0068860_1004874561 | 168 |
| 47 | 3300001915 | JGI24741J21665_1000708 | JGI24741J21665_10007088 | 169 |
| 48 | 3300001979 | JGI24740J21852_10000046 | JGI24740J21852_1000004627 | 169 |
| 49 | 3300001979 | JGI24740J21852_10000958 | JGI24740J21852_100009587 | 169 |
| 50 | 3300002705 | JGI25156J39149_1000465 | JGI25156J39149_10004653 | 169 |
| 51 | 3300002705 | JGI25156J39149_1005584 | JGI25156J39149_10055842 | 169 |
| 52 | 3300002705 | JGI25156J39149_1006419 | JGI25156J39149_10064192 | 169 |
| 53 | 3300002738 | JGI25154J39366_1003220 | JGI25154J39366_10032203 | 169 |
| 54 | 3300002772 | JGI25164J39214_1007497 | JGI25164J39214_10074972 | 169 |
| 55 | 3300003187 | JGI25151J46595_10039026 | JGI25151J46595_100390263 | 169 |
| 56 | 3300003214 | JGI25165J46597_1000596 | JGI25165J46597_100059627 | 169 |
| 57 | 3300003214 | JGI25165J46597_1006921 | JGI25165J46597_10069213 | 169 |
| 58 | 3300003320 | rootH2_10158678 | rootH2_101586782 | 169 |
| 59 | 3300003320 | rootH2_10301640 | rootH2_103016401 | 169 |
| 60 | 3300003578 | Ga0006562J51391_1094088 | Ga0006562J51391_10940882 | 169 |
| 61 | 3300003659 | JGI25404J52841_10014733 | JGI25404J52841_100147332 | 169 |
| 62 | 3300003659 | JGI25404J52841_10024580 | JGI25404J52841_100245802 | 169 |
| 63 | 3300003751 | Ga0055538_1003520 | Ga0055538_10035203 | 169 |
| 64 | 3300003752 | Ga0055539_1000108 | Ga0055539_100010846 | 169 |
| 65 | 3300003756 | Ga0055533_1001980 | Ga0055533_10019804 | 169 |
| 66 | 3300003758 | Ga0055532_1000014 | Ga0055532_1000014168 | 169 |
| 67 | 3300003758 | Ga0055532_1000073 | Ga0055532_100007374 | 169 |
| 68 | 3300003759 | Ga0055525_1000259 | Ga0055525_100025946 | 169 |
| 69 | 3300003760 | Ga0055527_1000013 | Ga0055527_1000013172 | 169 |
| 70 | 3300003760 | Ga0055527_1000638 | Ga0055527_10006389 | 169 |
| 71 | 3300003760 | Ga0055527_1005901 | Ga0055527_10059013 | 169 |
| 72 | 3300003761 | Ga0055535_1000011 | Ga0055535_1000011170 | 169 |
| 73 | 3300003761 | Ga0055535_1000055 | Ga0055535_100005574 | 169 |
| 74 | 3300003762 | Ga0055542_1000018 | Ga0055542_1000018172 | 169 |
| 75 | 3300003762 | Ga0055542_1000876 | Ga0055542_100087613 | 169 |
| 76 | 3300003763 | Ga0055529_1000017 | Ga0055529_1000017170 | 169 |
| 77 | 3300003763 | Ga0055529_1000149 | Ga0055529_100014947 | 169 |
| 78 | 3300003841 | Ga0055541_1000244 | Ga0055541_10002449 | 169 |
| 79 | 3300005262 | Ga0065165_1000667 | Ga0065165_100066746 | 169 |
| 80 | 3300005327 | Ga0070658_10046331 | Ga0070658_100463311 | 169 |
| 81 | 3300005336 | Ga0070680_100167294 | Ga0070680_1001672942 | 169 |
| 82 | 3300005336 | Ga0070680_100461581 | Ga0070680_1004615812 | 169 |
| 83 | 3300005339 | Ga0070660_100196444 | Ga0070660_1001964442 | 169 |
| 84 | 3300005339 | Ga0070660_100645921 | Ga0070660_1006459211 | 169 |
| 85 | 3300005344 | Ga0070661_100001467 | Ga0070661_1000014674 | 169 |
| 86 | 3300005344 | Ga0070661_100033008 | Ga0070661_1000330082 | 169 |
| 87 | 3300005347 | Ga0070668_100155326 | Ga0070668_1001553262 | 169 |
| 88 | 3300005356 | Ga0070674_100471280 | Ga0070674_1004712801 | 169 |
| 89 | 3300005356 | Ga0070674_101272379 | Ga0070674_1012723791 | 169 |
| 90 | 3300005366 | Ga0070659_100026949 | Ga0070659_1000269493 | 169 |
| 91 | 3300005366 | Ga0070659_100088343 | Ga0070659_1000883432 | 169 |
| 92 | 3300005366 | Ga0070659_100544581 | Ga0070659_1005445811 | 169 |
| 93 | 3300005455 | Ga0070663_100000061 | Ga0070663_1000000612 | 169 |
| 94 | 3300005458 | Ga0070681_10020849 | Ga0070681_100208494 | 169 |
| 95 | 3300005530 | Ga0070679_100187952 | Ga0070679_1001879522 | 169 |
| 96 | 3300005530 | Ga0070679_100726868 | Ga0070679_1007268682 | 169 |
| 97 | 3300005548 | Ga0070665_100000187 | Ga0070665_10000018736 | 169 |
| 98 | 3300005563 | Ga0068855_100003028 | Ga0068855_10000302820 | 169 |
| 99 | 3300005563 | Ga0068855_101000609 | Ga0068855_1010006091 | 169 |
| 100 | 3300005564 | Ga0070664_100000010 | Ga0070664_10000001098 | 169 |
| 101 | 3300005577 | Ga0068857_100003693 | Ga0068857_1000036936 | 169 |
| 102 | 3300005578 | Ga0068854_100003098 | Ga0068854_1000030987 | 169 |
| 103 | 3300005614 | Ga0068856_100000045 | Ga0068856_10000004554 | 169 |
| 104 | 3300005614 | Ga0068856_100000451 | Ga0068856_1000004511 | 169 |
| 105 | 3300005615 | Ga0070702_100033839 | Ga0070702_1000338392 | 169 |
| 106 | 3300005718 | Ga0068866_10033504 | Ga0068866_100335042 | 169 |
| 107 | 3300005718 | Ga0068866_10219181 | Ga0068866_102191812 | 169 |
| 108 | 3300005844 | Ga0068862_100344482 | Ga0068862_1003444823 | 169 |
| 109 | 3300005983 | Ga0081540_1001267 | Ga0081540_10012678 | 169 |
| 110 | 3300005983 | Ga0081540_1013239 | Ga0081540_10132392 | 169 |
| 111 | 3300006173 | Ga0070716_101349550 | Ga0070716_1013495501 | 169 |
| 112 | 3300006358 | Ga0068871_100302535 | Ga0068871_1003025353 | 169 |
| 113 | 3300006871 | Ga0075434_101098554 | Ga0075434_1010985542 | 169 |
| 114 | 3300009093 | Ga0105240_10054596 | Ga0105240_100545965 | 169 |
| 115 | 3300009093 | Ga0105240_10322763 | Ga0105240_103227632 | 169 |
| 116 | 3300009093 | Ga0105240_10557676 | Ga0105240_105576761 | 169 |
| 117 | 3300009098 | Ga0105245_10146580 | Ga0105245_101465802 | 169 |
| 118 | 3300009174 | Ga0105241_10501651 | Ga0105241_105016511 | 169 |
| 119 | 3300009545 | Ga0105237_10010103 | Ga0105237_100101032 | 169 |
| 120 | 3300009545 | Ga0105237_10022910 | Ga0105237_100229104 | 169 |
| 121 | 3300009545 | Ga0105237_10549827 | Ga0105237_105498271 | 169 |
| 122 | 3300013100 | Ga0157373_10001786 | Ga0157373_100017864 | 169 |
| 123 | 3300013102 | Ga0157371_10000088 | Ga0157371_1000008849 | 169 |
| 124 | 3300013104 | Ga0157370_10000041 | Ga0157370_1000004146 | 169 |
| 125 | 3300013104 | Ga0157370_10004703 | Ga0157370_1000470315 | 169 |
| 126 | 3300013105 | Ga0157369_10002013 | Ga0157369_100020133 | 169 |
| 127 | 3300013105 | Ga0157369_10057480 | Ga0157369_100574803 | 169 |
| 128 | 3300013297 | Ga0157378_10011676 | Ga0157378_100116764 | 169 |
| 129 | 3300013297 | Ga0157378_10144407 | Ga0157378_101444072 | 169 |
| 130 | 3300013307 | Ga0157372_10000097 | Ga0157372_1000009775 | 169 |
| 131 | 3300013307 | Ga0157372_10056854 | Ga0157372_100568543 | 169 |
| 132 | 3300014497 | Ga0182008_10023627 | Ga0182008_100236272 | 169 |
| 133 | 3300015261 | Ga0182006_1000898 | Ga0182006_100089817 | 169 |
| 134 | 3300015261 | Ga0182006_1001299 | Ga0182006_100129917 | 169 |
| 135 | 3300017792 | Ga0163161_10583115 | Ga0163161_105831152 | 169 |
| 136 | 3300020610 | Ga0154015_1486453 | Ga0154015_14864532 | 169 |
| 137 | 3300025224 | Ga0209784_100008 | Ga0209784_100008147 | 169 |
| 138 | 3300025224 | Ga0209784_100180 | Ga0209784_10018020 | 169 |
| 139 | 3300025224 | Ga0209784_101653 | Ga0209784_1016533 | 169 |
| 140 | 3300025224 | Ga0209784_101822 | Ga0209784_1018223 | 169 |
| 141 | 3300025225 | Ga0209566_100006 | Ga0209566_100006147 | 169 |
| 142 | 3300025225 | Ga0209566_100502 | Ga0209566_10050223 | 169 |
| 143 | 3300025225 | Ga0209566_102032 | Ga0209566_1020323 | 169 |
| 144 | 3300025226 | Ga0209674_100045 | Ga0209674_100045164 | 169 |
| 145 | 3300025226 | Ga0209674_100049 | Ga0209674_100049113 | 169 |
| 146 | 3300025226 | Ga0209674_100116 | Ga0209674_10011648 | 169 |
| 147 | 3300025226 | Ga0209674_104971 | Ga0209674_1049712 | 169 |
| 148 | 3300025228 | Ga0209672_100027 | Ga0209672_100027163 | 169 |
| 149 | 3300025228 | Ga0209672_100128 | Ga0209672_10012846 | 169 |
| 150 | 3300025228 | Ga0209672_100575 | Ga0209672_10057522 | 169 |
| 151 | 3300025229 | Ga0209147_100005 | Ga0209147_100005144 | 169 |
| 152 | 3300025229 | Ga0209147_100035 | Ga0209147_100035163 | 169 |
| 153 | 3300025230 | Ga0209563_100016 | Ga0209563_100016147 | 169 |
| 154 | 3300025230 | Ga0209563_101711 | Ga0209563_1017115 | 169 |
| 155 | 3300025230 | Ga0209563_108568 | Ga0209563_1085682 | 169 |
| 156 | 3300025231 | Ga0207427_101079 | Ga0207427_1010792 | 169 |
| 157 | 3300025242 | Ga0209258_100007 | Ga0209258_100007144 | 169 |
| 158 | 3300025242 | Ga0209258_100052 | Ga0209258_100052156 | 169 |
| 159 | 3300025246 | Ga0209646_1000027 | Ga0209646_1000027120 | 169 |
| 160 | 3300025246 | Ga0209646_1013692 | Ga0209646_10136921 | 169 |
| 161 | 3300025250 | Ga0209026_1007608 | Ga0209026_10076083 | 169 |
| 162 | 3300025250 | Ga0209026_1031644 | Ga0209026_10316441 | 169 |
| 163 | 3300025253 | Ga0209677_100008 | Ga0209677_100008545 | 169 |
| 164 | 3300025253 | Ga0209677_100693 | Ga0209677_10069314 | 169 |
| 165 | 3300025254 | Ga0209148_1000019 | Ga0209148_1000019214 | 169 |
| 166 | 3300025254 | Ga0209148_1000064 | Ga0209148_1000064156 | 169 |
| 167 | 3300025254 | Ga0209148_1006253 | Ga0209148_10062533 | 169 |
| 168 | 3300025256 | Ga0209759_1000041 | Ga0209759_1000041119 | 169 |
| 169 | 3300025256 | Ga0209759_1003171 | Ga0209759_10031719 | 169 |
| 170 | 3300025256 | Ga0209759_1008256 | Ga0209759_10082562 | 169 |
| 171 | 3300025261 | Ga0209233_1000073 | Ga0209233_1000073174 | 169 |
| 172 | 3300025261 | Ga0209233_1010764 | Ga0209233_10107644 | 169 |
| 173 | 3300025272 | Ga0209455_1000011 | Ga0209455_100001169 | 169 |
| 174 | 3300025272 | Ga0209455_1000057 | Ga0209455_1000057156 | 169 |
| 175 | 3300025284 | Ga0209130_1000106 | Ga0209130_1000106114 | 169 |
| 176 | 3300025294 | Ga0209025_1005644 | Ga0209025_10056448 | 169 |
| 177 | 3300025302 | Ga0207426_1027387 | Ga0207426_10273871 | 169 |
| 178 | 3300025901 | Ga0207688_10245523 | Ga0207688_102455232 | 169 |
| 179 | 3300025909 | Ga0207705_10018891 | Ga0207705_100188916 | 169 |
| 180 | 3300025912 | Ga0207707_10013883 | Ga0207707_100138839 | 169 |
| 181 | 3300025913 | Ga0207695_10001416 | Ga0207695_1000141627 | 169 |
| 182 | 3300025913 | Ga0207695_10273308 | Ga0207695_102733082 | 169 |
| 183 | 3300025917 | Ga0207660_10032734 | Ga0207660_100327343 | 169 |
| 184 | 3300025917 | Ga0207660_10437378 | Ga0207660_104373782 | 169 |
| 185 | 3300025919 | Ga0207657_10024118 | Ga0207657_100241182 | 169 |
| 186 | 3300025919 | Ga0207657_10208828 | Ga0207657_102088282 | 169 |
| 187 | 3300025920 | Ga0207649_10000170 | Ga0207649_1000017016 | 169 |
| 188 | 3300025920 | Ga0207649_10061998 | Ga0207649_100619982 | 169 |
| 189 | 3300025921 | Ga0207652_10023367 | Ga0207652_100233674 | 169 |
| 190 | 3300025921 | Ga0207652_10088449 | Ga0207652_100884492 | 169 |
| 191 | 3300025921 | Ga0207652_10710567 | Ga0207652_107105671 | 169 |
| 192 | 3300025929 | Ga0207664_10514011 | Ga0207664_105140112 | 169 |
| 193 | 3300025932 | Ga0207690_10175184 | Ga0207690_101751842 | 169 |
| 194 | 3300025932 | Ga0207690_10490139 | Ga0207690_104901391 | 169 |
| 195 | 3300025937 | Ga0207669_10199160 | Ga0207669_101991602 | 169 |
| 196 | 3300025940 | Ga0207691_10926821 | Ga0207691_109268211 | 169 |
| 197 | 3300025945 | Ga0207679_10000024 | Ga0207679_10000024151 | 169 |
| 198 | 3300025949 | Ga0207667_10026365 | Ga0207667_100263654 | 169 |
| 199 | 3300025981 | Ga0207640_10002272 | Ga0207640_100022727 | 169 |
| 200 | 3300026067 | Ga0207678_10000018 | Ga0207678_1000001846 | 169 |
| 201 | 3300026067 | Ga0207678_10055548 | Ga0207678_100555482 | 169 |
| 202 | 3300026078 | Ga0207702_10000053 | Ga0207702_10000053112 | 169 |
| 203 | 3300026116 | Ga0207674_10001884 | Ga0207674_100018845 | 169 |
| 204 | 3300026142 | Ga0207698_10129879 | Ga0207698_101298792 | 169 |
| 205 | 3300028379 | Ga0268266_10000003 | Ga0268266_100000031275 | 169 |
| 206 | 3300028379 | Ga0268266_10008069 | Ga0268266_1000806910 | 169 |
| 207 | 3300028380 | Ga0268265_10474144 | Ga0268265_104741442 | 169 |
| 208 | 3300028380 | Ga0268265_10939252 | Ga0268265_109392521 | 169 |
| 209 | 3300028381 | Ga0268264_11325253 | Ga0268264_113252532 | 169 |
| 210 | 3300028800 | Ga0265338_10434429 | Ga0265338_104344292 | 169 |
| 211 | 3300030742 | Ga0316183_1007381 | Ga0316183_10073811 | 169 |
| 212 | 3300031247 | Ga0265340_10057162 | Ga0265340_100571622 | 169 |
| 213 | 3300031456 | Ga0307513_10005321 | Ga0307513_1000532112 | 169 |
| 214 | 3300035116 | Ga0373945_0052554 | Ga0373945_0052554_112_624 | 169 |
| 215 | 3300035171 | Ga0373946_0004814 | Ga0373946_0004814_1046_1558 | 169 |
| 216 | 3300035695 | Ga0373927_0635580 | Ga0373927_0635580_136_648 | 169 |
| 217 | 3300037068 | Ga0373925_0701324 | Ga0373925_0701324_142_654 | 169 |
| 218 | 3300037418 | Ga0395900_0030046 | Ga0395900_0030046_3228_3737 | 169 |
| 219 | 3300037471 | Ga0395905_0678358 | Ga0395905_0678358_364_873 | 169 |
| 220 | 3300041452 | Ga0451793_0747671 | Ga0451793_0747671_100_717 | 169 |
| 221 | 3300041453 | Ga0451797_1455590 | Ga0451797_1455590_189_806 | 169 |
| 222 | 3300044650 | Ga0466986_0089581 | Ga0466986_0089581_1442_1951 | 169 |
| 223 | 3300044650 | Ga0466986_0235485 | Ga0466986_0235485_654_1163 | 169 |
| 224 | 3300044656 | Ga0466969_0010359 | Ga0466969_0010359_4328_4837 | 169 |
| 225 | 3300044656 | Ga0466969_0084318 | Ga0466969_0084318_843_1352 | 169 |
| 226 | 3300044658 | Ga0466972_0000317 | Ga0466972_0000317_11651_12160 | 169 |
| 227 | 3300044671 | Ga0466978_0204757 | Ga0466978_0204757_449_958 | 169 |
| 228 | 3300044672 | Ga0466982_0000600 | Ga0466982_0000600_6266_6775 | 169 |
| 229 | 3300044684 | Ga0466966_0054356 | Ga0466966_0054356_1803_2312 | 169 |
| 230 | 3300044693 | Ga0466961_0000030 | Ga0466961_0000030_68972_69481 | 169 |
| 231 | 3300044693 | Ga0466961_0223708 | Ga0466961_0223708_624_1133 | 169 |
| 232 | 3300044694 | Ga0466963_0005020 | Ga0466963_0005020_1909_2418 | 169 |
| 233 | 3300044706 | Ga0466964_0003078 | Ga0466964_0003078_1261_1770 | 169 |
| 234 | 3300044719 | Ga0466971_0010025 | Ga0466971_0010025_135_644 | 169 |
| 235 | 3300044719 | Ga0466971_0088608 | Ga0466971_0088608_889_1404 | 169 |
| 236 | 3300044765 | Ga0466970_0001069 | Ga0466970_0001069_2836_3345 | 169 |
| 237 | 3300044842 | Ga0466957_0120260 | Ga0466957_0120260_217_726 | 169 |
| 238 | 3300044901 | Ga0466960_0009797 | Ga0466960_0009797_1337_1846 | 169 |
| 239 | 3300045049 | Ga0466959_0000550 | Ga0466959_0000550_16443_16952 | 169 |
| 240 | 3300045836 | Ga0466958_0063252 | Ga0466958_0063252_15_524 | 169 |
| 241 | 3300045976 | Ga0466967_0006318 | Ga0466967_0006318_754_1263 | 169 |
| 242 | 3300045976 | Ga0466967_1720302 | Ga0466967_1720302_50_559 | 169 |
| 243 | 3300046459 | Ga0495629_0359780 | Ga0495629_0359780_367_879 | 169 |
| 244 | 3300046461 | Ga0495641_0037677 | Ga0495641_0037677_1638_2150 | 169 |
| 245 | 3300046472 | Ga0495580_0249928 | Ga0495580_0249928_515_1027 | 169 |
| 246 | 3300046473 | Ga0495582_0068138 | Ga0495582_0068138_158_670 | 169 |
| 247 | 3300046476 | Ga0495662_0030065 | Ga0495662_0030065_1545_2057 | 169 |
| 248 | 3300046516 | Ga0495628_0035147 | Ga0495628_0035147_2772_3281 | 169 |
| 249 | 3300046524 | Ga0495648_0161273 | Ga0495648_0161273_48_560 | 169 |
| 250 | 3300046526 | Ga0495666_0052200 | Ga0495666_0052200_1316_1828 | 169 |
| 251 | 3300046681 | Ga0495647_0004178 | Ga0495647_0004178_922_1434 | 169 |
| 252 | 3300046689 | Ga0495613_0671434 | Ga0495613_0671434_113_625 | 169 |
| 253 | 3300046690 | Ga0495624_0027364 | Ga0495624_0027364_160_672 | 169 |
| 254 | 3300046694 | Ga0495649_0019824 | Ga0495649_0019824_204_713 | 169 |
| 255 | 3300047321 | Ga0495676_0156992 | Ga0495676_0156992_1017_1529 | 169 |
| 256 | 3300048918 | Ga0496115_0240383 | Ga0496115_0240383_330_842 | 169 |
| 257 | 3300048920 | Ga0496117_0040645 | Ga0496117_0040645_2197_2706 | 169 |
| 258 | 3300048921 | Ga0496118_0156413 | Ga0496118_0156413_184_693 | 169 |
| 259 | 3300048928 | Ga0496125_0002069 | Ga0496125_0002069_7897_8406 | 169 |
| 260 | 3300049568 | Ga0501031_0154900 | Ga0501031_0154900_563_1084 | 169 |
| 261 | 3300049569 | Ga0501032_0037856 | Ga0501032_0037856_1138_1680 | 169 |
| 262 | 3300049569 | Ga0501032_0082530 | Ga0501032_0082530_1238_1750 | 169 |
| 263 | 3300049569 | Ga0501032_0225522 | Ga0501032_0225522_469_981 | 169 |
| 264 | 3300049570 | Ga0501033_0002863 | Ga0501033_0002863_12504_13046 | 169 |
| 265 | 3300049570 | Ga0501033_0004994 | Ga0501033_0004994_6895_7407 | 169 |
| 266 | 3300049570 | Ga0501033_0322344 | Ga0501033_0322344_337_858 | 169 |
| 267 | 3300049571 | Ga0501034_0010507 | Ga0501034_0010507_5508_6050 | 169 |
| 268 | 3300049571 | Ga0501034_0523568 | Ga0501034_0523568_453_974 | 169 |
| 269 | 3300049572 | Ga0501036_0016279 | Ga0501036_0016279_4761_5303 | 169 |
| 270 | 3300049572 | Ga0501036_0760484 | Ga0501036_0760484_36_557 | 169 |
| 271 | 3300049574 | Ga0501038_0002164 | Ga0501038_0002164_1605_2147 | 169 |
| 272 | 3300049575 | Ga0501039_0517144 | Ga0501039_0517144_312_854 | 169 |
| 273 | 3300049575 | Ga0501039_0885666 | Ga0501039_0885666_42_554 | 169 |
| 274 | 3300049578 | Ga0501042_0200810 | Ga0501042_0200810_161_673 | 169 |
| 275 | 3300049580 | Ga0501046_0005671 | Ga0501046_0005671_8387_8929 | 169 |
| 276 | 3300049580 | Ga0501046_0178068 | Ga0501046_0178068_52_564 | 169 |
| 277 | 3300049581 | Ga0501047_0144912 | Ga0501047_0144912_1153_1695 | 169 |
| 278 | 3300049581 | Ga0501047_0148179 | Ga0501047_0148179_1339_1851 | 169 |
| 279 | 3300049582 | Ga0501048_0013094 | Ga0501048_0013094_2069_2581 | 169 |
| 280 | 3300049582 | Ga0501048_0077225 | Ga0501048_0077225_660_1202 | 169 |
| 281 | 3300049583 | Ga0501067_0017402 | Ga0501067_0017402_3365_3907 | 169 |
| 282 | 3300049583 | Ga0501067_0044817 | Ga0501067_0044817_596_1108 | 169 |
| 283 | 3300049584 | Ga0501068_0020170 | Ga0501068_0020170_2196_2708 | 169 |
| 284 | 3300049585 | Ga0501069_0079509 | Ga0501069_0079509_434_946 | 169 |
| 285 | 3300049586 | Ga0501070_0006507 | Ga0501070_0006507_4586_5128 | 169 |
| 286 | 3300049586 | Ga0501070_0139671 | Ga0501070_0139671_194_706 | 169 |
| 287 | 3300049588 | Ga0501072_0143500 | Ga0501072_0143500_547_1059 | 169 |
| 288 | 3300049589 | Ga0501073_0001159 | Ga0501073_0001159_12357_12899 | 169 |
| 289 | 3300049589 | Ga0501073_0164307 | Ga0501073_0164307_951_1463 | 169 |
| 290 | 3300049592 | Ga0501076_0166330 | Ga0501076_0166330_509_1021 | 169 |
| 291 | 3300049741 | Ga0501079_0003971 | Ga0501079_0003971_9692_10204 | 169 |
| 292 | 3300049741 | Ga0501079_0025664 | Ga0501079_0025664_2832_3344 | 169 |
| 293 | 3300049742 | Ga0501080_0019335 | Ga0501080_0019335_2933_3445 | 169 |
| 294 | 3300049742 | Ga0501080_0045902 | Ga0501080_0045902_2884_3426 | 169 |
| 295 | 3300049743 | Ga0501081_0400712 | Ga0501081_0400712_238_750 | 169 |
| 296 | 3300049744 | Ga0501083_0009479 | Ga0501083_0009479_4760_5302 | 169 |
| 297 | 3300049822 | Ga0501035_0003827 | Ga0501035_0003827_10966_11478 | 169 |
| 298 | 3300049822 | Ga0501035_0084861 | Ga0501035_0084861_1977_2519 | 169 |
| 299 | 3300049823 | Ga0501044_0468310 | Ga0501044_0468310_211_753 | 169 |
| 300 | 3300049824 | Ga0501045_0010661 | Ga0501045_0010661_28_570 | 169 |
| 301 | 3300050496 | nmdc:mga07m45_576380_c1 | nmdc:mga07m45_576380_c1_51_560 | 169 |
| 302 | 3300050514 | nmdc:mga08x19_181371_c1 | nmdc:mga08x19_181371_c1_282_821 | 169 |
| 303 | 3300053085 | Ga0495619_0014212 | Ga0495619_0014212_1423_2070 | 169 |
| 304 | 3300053086 | Ga0500578_0137927 | Ga0500578_0137927_846_1358 | 169 |
| 305 | 3300054114 | Ga0501084_0007425 | Ga0501084_0007425_4401_4913 | 169 |
| 306 | 3300054114 | Ga0501084_0265327 | Ga0501084_0265327_795_1337 | 169 |
| 307 | 3300060353 | Ga0501082_0008588 | Ga0501082_0008588_4175_4687 | 169 |
| 308 | 3300061719 | Ga0466962_0089848 | Ga0466962_0089848_664_1173 | 169 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2hiy-assembly1.cif.gz_B | the structure of conserved bacterial protein sp0830 from streptococcus pneumoniae. | 0.8143 | 2 | 167 |
| 2hiy-assembly1.cif.gz_A | the structure of conserved bacterial protein sp0830 from streptococcus pneumoniae. | 0.8122 | 1 | 169 |
| 2hiy-assembly1.cif.gz_A | the structure of conserved bacterial protein sp0830 from streptococcus pneumoniae. | 0.808 | 1 | 169 |
| 2hiy-assembly1.cif.gz_B | the structure of conserved bacterial protein sp0830 from streptococcus pneumoniae. | 0.797 | 2 | 167 |
| 2rsq-assembly1.cif.gz_A | copper(i) loaded form of the first domain of the human copper chaperone for sod1, ccs | 0.7671 | 2 | 78 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O06552_36_123_3.30.70.1280 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;SP0830-like domains | 0.9133 | 2 | 86 | 3.30.70.1280 |
| af_Q54C13_1_90_3.30.70.1280 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;SP0830-like domains | 0.9117 | 1 | 88 | 3.30.70.1280 |
| af_Q54C13_1_90_3.30.70.1280 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;SP0830-like domains | 0.8835 | 1 | 88 | 3.30.70.1280 |
| af_O06552_36_123_3.30.70.1280 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;SP0830-like domains | 0.8649 | 2 | 86 | 3.30.70.1280 |
| 2hiyB01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;SP0830-like domains | 0.8466 | 1 | 88 | 3.30.70.1280 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A8B4S5X0-F1-model_v4 | Uncharacterized protein conserved in bacteria | 0.9932 | 21 | 168 |
|
| AF-A0A2S5LIS7-F1-model_v4 | DUF1697 domain-containing protein | 0.9916 | 21 | 168 |
|
| AF-A0A1H5I8W1-F1-model_v4 | Uncharacterized conserved protein, DUF1697 family | 0.9879 | 47 | 168 |
|
| AF-A0A0E3Z349-F1-model_v4 | DUF1697 domain-containing protein | 0.9783 | 1 | 168 |
|
| AF-A0A3R9P6K5-F1-model_v4 | Uncharacterized protein (DUF1697 family) | 0.9775 | 1 | 168 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar