F399656

General Info

Members Datasets Scaffolds Average Seq Length
308 201 616 141

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10273683|Ga0114129_102736832
Length 166
Sequence VRSNLPENRNPARGSGYDDSIMPTMLENARRVIAGDAPPPPFAALVGMKLTAIEPGRARMEIATDARHANPMGTLHGGVPCALADSAMGLAYASTLGEGESFTTLELKINFLRPVWTTTLVAEGRVVHRGRTVGLTECDVTDDQGRLIARASSTCMTLREEQAAGR

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
132 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
134 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
135 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
136 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
137 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
138 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
145 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
146 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
149 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
150 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
151 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
152 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
153 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
154 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
155 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
156 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
157 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
158 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
159 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
160 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
161 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
162 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
163 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
164 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
176 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
177 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
178 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
179 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
180 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
181 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
182 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
183 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
184 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
185 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
186 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
187 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
188 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
191 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
192 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
193 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
194 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
195 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
196 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
197 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
198 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
199 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
200 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
201 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.68
Metatranscriptomes 0.32
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.65
Nodule 0
Rhizoplane 1.3
Rhizosphere 97.73
Stem 0
Stem Tuber 0
Unclassified 25.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10273683 3300009147 Bacteria 2258
2 JGI24751J29686_10091223 3300002459 Unclassified 634
3 Ga0065707_10442823 3300005295 Bacteria 808
4 Ga0070676_10140757 3300005328 Bacteria 1535
5 Ga0070670_100122246 3300005331 Bacteria 2245
6 Ga0070677_10015926 3300005333 Bacteria 2670
7 Ga0068869_100017433 3300005334 Bacteria 4866
8 Ga0068869_100416351 3300005334 Bacteria 1108
9 Ga0070666_10476812 3300005335 Unclassified 903
10 Ga0070680_100014483 3300005336 Bacteria 6169
11 Ga0068868_100148556 3300005338 Unclassified 1929
12 Ga0068868_100471412 3300005338 Bacteria 1095
13 Ga0070660_100315270 3300005339 Bacteria 1284
14 Ga0070689_100433482 3300005340 Bacteria 1116
15 Ga0070691_10066538 3300005341 Unclassified 1742
16 Ga0070661_100038870 3300005344 Bacteria 3465
17 Ga0070668_100268843 3300005347 Bacteria 1420
18 Ga0070675_100022929 3300005354 Bacteria 4989
19 Ga0070674_100146730 3300005356 Bacteria 1776
20 Ga0070673_100219773 3300005364 Bacteria 1644
21 Ga0070673_101031195 3300005364 Bacteria 767
22 Ga0070659_100405951 3300005366 Bacteria 1151
23 Ga0070667_100082951 3300005367 Bacteria 2745
24 Ga0070667_100090696 3300005367 Bacteria 2627
25 Ga0070703_10092943 3300005406 Bacteria 1049
26 Ga0070713_102000939 3300005436 Unclassified 562
27 Ga0070701_10203479 3300005438 Unclassified 1171
28 Ga0070705_100006786 3300005440 Bacteria 5631
29 Ga0070700_100641425 3300005441 Bacteria 837
30 Ga0070700_100819641 3300005441 Bacteria 751
31 Ga0070694_100284877 3300005444 Bacteria 1261
32 Ga0070708_100136585 3300005445 Bacteria 2272
33 Ga0070708_100264077 3300005445 Bacteria 1618
34 Ga0070708_100713582 3300005445 Bacteria 943
35 Ga0070678_100007315 3300005456 Bacteria 6541
36 Ga0070678_100008472 3300005456 Bacteria 6158
37 Ga0070662_100291188 3300005457 Bacteria 1324
38 Ga0068867_100013418 3300005459 Bacteria 5805
39 Ga0068867_101989576 3300005459 Unclassified 549
40 Ga0070685_10746643 3300005466 Bacteria 717
41 Ga0070706_100006588 3300005467 Bacteria 10950
42 Ga0070706_100385459 3300005467 Bacteria 1305
43 Ga0070707_100022028 3300005468 Bacteria 6024
44 Ga0070707_100026579 3300005468 Bacteria 5497
45 Ga0070707_100049366 3300005468 Unclassified 4033
46 Ga0070707_100091007 3300005468 Bacteria 2953
47 Ga0070707_100697728 3300005468 Unclassified 978
48 Ga0070698_100030671 3300005471 Bacteria 5574
49 Ga0070698_100058717 3300005471 Bacteria 3889
50 Ga0070698_100117392 3300005471 Bacteria 2623
51 Ga0070699_100098925 3300005518 Bacteria 2556
52 Ga0070699_100220893 3300005518 Bacteria 1688
53 Ga0070699_100465470 3300005518 Bacteria 1147
54 Ga0070699_100469040 3300005518 Bacteria 1142
55 Ga0070699_100940315 3300005518 Bacteria 792
56 Ga0070697_100143086 3300005536 Unclassified 2012
57 Ga0070697_100674795 3300005536 Unclassified 911
58 Ga0070697_101146112 3300005536 Bacteria 692
59 Ga0070672_100011768 3300005543 Bacteria 6113
60 Ga0070695_100020028 3300005545 Bacteria 4080
61 Ga0070696_100076295 3300005546 Unclassified 2366
62 Ga0070696_100321888 3300005546 Unclassified 1190
63 Ga0070693_100304209 3300005547 Bacteria 1076
64 Ga0070665_100080177 3300005548 Unclassified 3270
65 Ga0070665_100128804 3300005548 Bacteria 2533
66 Ga0070664_100016142 3300005564 Bacteria 6120
67 Ga0068857_100942713 3300005577 Bacteria 829
68 Ga0068854_100816517 3300005578 Unclassified 814
69 Ga0068856_101158778 3300005614 Bacteria 790
70 Ga0070702_100225360 3300005615 Bacteria 1256
71 Ga0068859_100150370 3300005617 Bacteria 2404
72 Ga0068861_100247812 3300005719 Bacteria 1518
73 Ga0068861_100482385 3300005719 Bacteria 1117
74 Ga0068870_10013742 3300005840 Bacteria 3811
75 Ga0068870_10349967 3300005840 Unclassified 948
76 Ga0068863_100024409 3300005841 Bacteria 5766
77 Ga0068863_100476197 3300005841 Unclassified 1227
78 Ga0068860_100144238 3300005843 Bacteria 2290
79 Ga0068860_100991442 3300005843 Bacteria 858
80 Ga0068860_101462577 3300005843 Unclassified 705
81 Ga0068862_100617615 3300005844 Bacteria 1042
82 Ga0068862_100631947 3300005844 Bacteria 1031
83 Ga0081455_10019755 3300005937 Bacteria 6364
84 Ga0081538_10052263 3300005981 Bacteria 2443
85 Ga0075432_10023756 3300006058 Bacteria 2100
86 Ga0075428_100262367 3300006844 Bacteria 1860
87 Ga0075428_100638221 3300006844 Unclassified 1136
88 Ga0075430_100229579 3300006846 Bacteria 1539
89 Ga0075431_100000079 3300006847 Bacteria 57271
90 Ga0075431_100251346 3300006847 Bacteria 1796
91 Ga0075433_10025892 3300006852 Bacteria 4961
92 Ga0075433_10036215 3300006852 Bacteria 4249
93 Ga0075434_100010346 3300006871 Bacteria 8743
94 Ga0075434_100318076 3300006871 Bacteria 1577
95 Ga0075434_102133430 3300006871 Unclassified 565
96 Ga0068865_100104950 3300006881 Unclassified 2075
97 Ga0068865_100119339 3300006881 Bacteria 1958
98 Ga0068865_100727984 3300006881 Unclassified 850
99 Ga0068865_101359565 3300006881 Unclassified 633
100 Ga0075436_100590922 3300006914 Bacteria 817
101 Ga0075436_101060643 3300006914 Unclassified 609
102 Ga0097620_100150362 3300006931 Bacteria 2404
103 Ga0075435_100065412 3300007076 Bacteria 2956
104 Ga0075435_100245677 3300007076 Bacteria 1523
105 Ga0075435_100824893 3300007076 Unclassified 808
106 Ga0111539_10074578 3300009094 Bacteria 3997
107 Ga0111539_10075792 3300009094 Bacteria 3962
108 Ga0111539_11193700 3300009094 Bacteria 884
109 Ga0105245_10949938 3300009098 Unclassified 903
110 Ga0105245_13003581 3300009098 Bacteria 523
111 Ga0114129_10084189 3300009147 Bacteria 4416
112 Ga0114129_10913503 3300009147 Bacteria 1111
113 Ga0114129_11446881 3300009147 Bacteria 846
114 Ga0114129_13012911 3300009147 Unclassified 553
115 Ga0105243_10135760 3300009148 Bacteria 2092
116 Ga0105241_10721499 3300009174 Unclassified 912
117 Ga0105242_10027437 3300009176 Bacteria 4521
118 Ga0105242_10456054 3300009176 Unclassified 1206
119 Ga0105242_11692315 3300009176 Unclassified 668
120 Ga0105248_10398294 3300009177 Bacteria 1550
121 Ga0105248_11211730 3300009177 Bacteria 854
122 Ga0105248_12144793 3300009177 Unclassified 636
123 Ga0105249_10823724 3300009553 Unclassified 993
124 Ga0105249_11198049 3300009553 Unclassified 830
125 Ga0105246_10782085 3300011119 Unclassified 845
126 Ga0157378_10302865 3300013297 Bacteria 1547
127 Ga0157378_11508912 3300013297 Bacteria 717
128 Ga0163162_10185963 3300013306 Bacteria 2204
129 Ga0157375_10065862 3300013308 Bacteria 3613
130 Ga0157375_10095335 3300013308 Bacteria 3046
131 Ga0157375_10643944 3300013308 Unclassified 1216
132 Ga0163163_10089035 3300014325 Bacteria 3098
133 Ga0163163_10570545 3300014325 Bacteria 1194
134 Ga0157380_10014906 3300014326 Bacteria 5698
135 Ga0157377_10056445 3300014745 Bacteria 2230
136 Ga0157379_10362946 3300014968 Unclassified 1328
137 Ga0157376_10014061 3300014969 Bacteria 5992
138 Ga0157376_10080637 3300014969 Bacteria 2792
139 Ga0163161_10024149 3300017792 Bacteria 4293
140 Ga0207666_1023111 3300025271 Bacteria 924
141 Ga0207697_10001276 3300025315 Bacteria 13817
142 Ga0207653_10079166 3300025885 Bacteria 1135
143 Ga0207682_10033488 3300025893 Bacteria 2069
144 Ga0207688_10477723 3300025901 Bacteria 779
145 Ga0207680_10231677 3300025903 Archaea 1270
146 Ga0207647_10070734 3300025904 Bacteria 2107
147 Ga0207645_10022005 3300025907 Bacteria 4152
148 Ga0207645_10417066 3300025907 Bacteria 904
149 Ga0207643_10018518 3300025908 Bacteria 3813
150 Ga0207684_10012607 3300025910 Bacteria 7346
151 Ga0207684_10047066 3300025910 Bacteria 3659
152 Ga0207684_10229008 3300025910 Bacteria 1604
153 Ga0207657_10041080 3300025919 Bacteria 4092
154 Ga0207649_10111707 3300025920 Bacteria 1827
155 Ga0207646_10002353 3300025922 Bacteria 22329
156 Ga0207646_10003075 3300025922 Bacteria 19192
157 Ga0207646_10058231 3300025922 Unclassified 3451
158 Ga0207646_10114549 3300025922 Bacteria 2421
159 Ga0207646_11020116 3300025922 Unclassified 731
160 Ga0207681_10726938 3300025923 Bacteria 826
161 Ga0207650_10081159 3300025925 Bacteria 2460
162 Ga0207650_11051129 3300025925 Bacteria 693
163 Ga0207659_10005373 3300025926 Bacteria 7759
164 Ga0207687_10908443 3300025927 Unclassified 754
165 Ga0207644_11118095 3300025931 Bacteria 662
166 Ga0207706_10008407 3300025933 Bacteria 9524
167 Ga0207706_10100191 3300025933 Bacteria 2549
168 Ga0207686_10017657 3300025934 Unclassified 4023
169 Ga0207686_10371474 3300025934 Unclassified 1082
170 Ga0207686_11233357 3300025934 Unclassified 613
171 Ga0207709_10062909 3300025935 Bacteria 2325
172 Ga0207669_10207114 3300025937 Bacteria 1428
173 Ga0207704_10077283 3300025938 Bacteria 2136
174 Ga0207704_11069040 3300025938 Unclassified 685
175 Ga0207691_10003723 3300025940 Bacteria 14796
176 Ga0207691_10035376 3300025940 Bacteria 4637
177 Ga0207711_10392370 3300025941 Bacteria 1289
178 Ga0207689_10101567 3300025942 Bacteria 2362
179 Ga0207661_10890559 3300025944 Bacteria 820
180 Ga0207679_10065128 3300025945 Bacteria 2726
181 Ga0207651_10098885 3300025960 Bacteria 2159
182 Ga0207712_10936939 3300025961 Unclassified 767
183 Ga0207712_11237492 3300025961 Unclassified 666
184 Ga0207668_10392995 3300025972 Bacteria 1170
185 Ga0207668_11650106 3300025972 Unclassified 579
186 Ga0207658_10335967 3300025986 Unclassified 1312
187 Ga0207658_11457086 3300025986 Unclassified 626
188 Ga0207677_10099608 3300026023 Unclassified 2135
189 Ga0207677_11566449 3300026023 Archaea 609
190 Ga0207703_10268047 3300026035 Unclassified 1546
191 Ga0207678_10027441 3300026067 Bacteria 4967
192 Ga0207708_10012466 3300026075 Bacteria 6336
193 Ga0207708_10255609 3300026075 Bacteria 1413
194 Ga0207641_10115222 3300026088 Bacteria 2389
195 Ga0207641_10578063 3300026088 Unclassified 1098
196 Ga0207648_10020331 3300026089 Bacteria 5981
197 Ga0207648_11206182 3300026089 Bacteria 711
198 Ga0207676_10909585 3300026095 Bacteria 863
199 Ga0207674_10034445 3300026116 Bacteria 5293
200 Ga0207675_100020772 3300026118 Bacteria 6122
201 Ga0207675_100463715 3300026118 Unclassified 1257
202 Ga0207683_10008806 3300026121 Bacteria 8613
203 Ga0207683_10395340 3300026121 Bacteria 1271
204 Ga0268266_10089353 3300028379 Bacteria 2697
205 Ga0268266_10154489 3300028379 Unclassified 2071
206 Ga0268265_10215966 3300028380 Bacteria 1675
207 Ga0268265_10318919 3300028380 Bacteria 1406
208 Ga0268264_10028387 3300028381 Bacteria 4577
209 Ga0268264_10955696 3300028381 Bacteria 862
210 Ga0265762_1004270 3300030760 Bacteria 2562
211 Ga0307408_100963425 3300031548 Bacteria 784
212 Ga0307405_11593199 3300031731 Unclassified 576
213 Ga0307410_10011070 3300031852 Bacteria 5143
214 Ga0373940_0021318 3300035088 Bacteria 1655
215 Ga0373923_0605744 3300035111 Unclassified 540
216 Ga0373936_0120152 3300035113 Bacteria 1122
217 Ga0373939_0135594 3300035114 Bacteria 883
218 Ga0373956_0120956 3300035119 Bacteria 1223
219 Ga0373931_0453632 3300035691 Bacteria 820
220 Ga0373933_0456524 3300035724 Bacteria 836
221 Ga0373947_0710249 3300035725 Archaea 686
222 Ga0373937_0034406 3300036401 Bacteria 4609
223 Ga0373925_0340431 3300037068 Bacteria 1217
224 Ga0395900_0255065 3300037418 Unclassified 1754
225 Ga0436364_1420322 3300037853 Bacteria 592
226 Ga0395901_0305199 3300038443 Bacteria 1650
227 Ga0439437_031088 3300042000 Unclassified 671
228 Ga0439441_057118 3300042001 Unclassified 815
229 Ga0466960_0204743 3300044901 Bacteria 1080
230 Ga0451576_0120754 3300045051 Bacteria 2728
231 Ga0451576_0791129 3300045051 Bacteria 996
232 Ga0495592_0245296 3300046454 Unclassified 1187
233 Ga0495603_0085111 3300046455 Unclassified 1851
234 Ga0495629_0159732 3300046459 Unclassified 1566
235 Ga0495629_0819023 3300046459 Unclassified 613
236 Ga0495580_0000002 3300046472 Bacteria 121311
237 Ga0495582_0246137 3300046473 Bacteria 1025
238 Ga0495639_0218732 3300046475 Unclassified 936
239 Ga0495640_0333312 3300046533 Bacteria 938
240 Ga0495586_0174271 3300046535 Bacteria 1216
241 Ga0495645_0010515 3300046543 Bacteria 6490
242 Ga0495667_0036172 3300046559 Bacteria 3297
243 Ga0495599_0184770 3300046678 Bacteria 1284
244 Ga0495647_0018945 3300046681 Bacteria 2457
245 Ga0495658_0381442 3300046683 Unclassified 897
246 Ga0495658_0421802 3300046683 Unclassified 851
247 Ga0495613_0497330 3300046689 Archaea 821
248 Ga0495600_0074551 3300046809 Bacteria 2216
249 Ga0495674_0215546 3300047319 Bacteria 1589
250 Ga0495614_0460093 3300048089 Bacteria 603
251 Ga0496102_0170640 3300048905 Bacteria 2048
252 Ga0496109_1603272 3300048912 Bacteria 585
253 Ga0496114_0127393 3300048917 Unclassified 2196
254 Ga0496115_0044900 3300048918 Unclassified 3526
255 Ga0501033_0098175 3300049570 Bacteria 2139
256 Ga0501038_0347167 3300049574 Bacteria 1156
257 Ga0501039_1020833 3300049575 Bacteria 642
258 Ga0501041_0023083 3300049577 Bacteria 3730
259 Ga0501041_0626363 3300049577 Unclassified 687
260 Ga0501042_0045189 3300049578 Bacteria 3139
261 Ga0501042_0210046 3300049578 Bacteria 1404
262 Ga0501046_0025822 3300049580 Bacteria 4803
263 Ga0501067_0721329 3300049583 Unclassified 561
264 Ga0501068_0387317 3300049584 Bacteria 900
265 Ga0501075_0477885 3300049591 Bacteria 951
266 Ga0501076_0033668 3300049592 Bacteria 4001
267 Ga0501077_0397666 3300049593 Unclassified 881
268 Ga0501079_0278424 3300049741 Bacteria 1308
269 Ga0501079_0889656 3300049741 Unclassified 701
270 Ga0501080_0158362 3300049742 Bacteria 2092
271 Ga0501080_0295844 3300049742 Bacteria 1469
272 Ga0501081_0073494 3300049743 Bacteria 2384
273 Ga0501083_0190984 3300049744 Bacteria 1337
274 Ga0501045_0062879 3300049824 Bacteria 2724
275 nmdc:mga05p37_117147_c1 3300050507 Bacteria 3274
276 nmdc:mga05p37_164581_c1 3300050507 Bacteria 2707
277 nmdc:mga05p37_256189_c1 3300050507 Unclassified 2097
278 nmdc:mga05p37_309563_c1 3300050507 Bacteria 1873
279 nmdc:mga05p37_45353_c1 3300050507 Bacteria 5408
280 nmdc:mga05p37_784563_c1 3300050507 Unclassified 1045
281 nmdc:mga09592_40291_c1 3300050508 Bacteria 3924
282 nmdc:mga0qj67_206138_c1 3300050509 Bacteria 1597
283 nmdc:mga0qj67_22068_c1 3300050509 Bacteria 4887
284 nmdc:mga06r32_1296513_c1 3300050510 Unclassified 672
285 nmdc:mga06r32_1303098_c1 3300050510 Unclassified 670
286 nmdc:mga06r32_27181_c1 3300050510 Bacteria 5342
287 nmdc:mga06r32_527_c1 3300050510 Bacteria 33024
288 nmdc:mga08y16_59683_c1 3300050511 Bacteria 3984
289 nmdc:mga0n895_23674_c1 3300050512 Bacteria 5776
290 nmdc:mga0rr50_118389_c1 3300050513 Bacteria 2104
291 nmdc:mga0rr50_548358_c1 3300050513 Bacteria 984
292 nmdc:mga08x19_259760_c1 3300050514 Bacteria 1200
293 nmdc:mga08x19_840886_c1 3300050514 Unclassified 652
294 nmdc:mga0a205_109774_c1 3300050515 Unclassified 2657
295 nmdc:mga0a205_16639_c2 3300050515 Bacteria 6595
296 nmdc:mga0a205_513145_c1 3300050515 Bacteria 1055
297 nmdc:mga0a205_81132_c1 3300050515 Bacteria 3133
298 Ga0495601_0061028 3300053077 Bacteria 2393
299 Ga0495595_0262384 3300053084 Bacteria 866
300 Ga0495619_0078696 3300053085 Bacteria 2217
301 Ga0500566_0363606 3300053094 Bacteria 659
302 Ga0500658_0159310 3300053134 Unclassified 1021
303 Ga0501084_0067600 3300054114 Bacteria 2991
304 Ga0501084_0279089 3300054114 Bacteria 1411
305 Ga0501082_0029981 3300060353 Bacteria 4687
306 Ga0501082_0492908 3300060353 Bacteria 1071
307 Ga0530510_0007696 3300061734 Bacteria 7502
308 Ga0530510_0197191 3300061734 Bacteria 1495
309 Ga0114129_10273683
310 JGI24751J29686_10091223
311 Ga0065707_10442823
312 Ga0070676_10140757
313 Ga0070670_100122246
314 Ga0070677_10015926
315 Ga0068869_100017433
316 Ga0068869_100416351
317 Ga0070666_10476812
318 Ga0070680_100014483
319 Ga0068868_100148556
320 Ga0068868_100471412
321 Ga0070660_100315270
322 Ga0070689_100433482
323 Ga0070691_10066538
324 Ga0070661_100038870
325 Ga0070668_100268843
326 Ga0070675_100022929
327 Ga0070674_100146730
328 Ga0070673_100219773
329 Ga0070673_101031195
330 Ga0070659_100405951
331 Ga0070667_100082951
332 Ga0070667_100090696
333 Ga0070703_10092943
334 Ga0070713_102000939
335 Ga0070701_10203479
336 Ga0070705_100006786
337 Ga0070700_100641425
338 Ga0070700_100819641
339 Ga0070694_100284877
340 Ga0070708_100136585
341 Ga0070708_100264077
342 Ga0070708_100713582
343 Ga0070678_100007315
344 Ga0070678_100008472
345 Ga0070662_100291188
346 Ga0068867_100013418
347 Ga0068867_101989576
348 Ga0070685_10746643
349 Ga0070706_100006588
350 Ga0070706_100385459
351 Ga0070707_100022028
352 Ga0070707_100026579
353 Ga0070707_100049366
354 Ga0070707_100091007
355 Ga0070707_100697728
356 Ga0070698_100030671
357 Ga0070698_100058717
358 Ga0070698_100117392
359 Ga0070699_100098925
360 Ga0070699_100220893
361 Ga0070699_100465470
362 Ga0070699_100469040
363 Ga0070699_100940315
364 Ga0070697_100143086
365 Ga0070697_100674795
366 Ga0070697_101146112
367 Ga0070672_100011768
368 Ga0070695_100020028
369 Ga0070696_100076295
370 Ga0070696_100321888
371 Ga0070693_100304209
372 Ga0070665_100080177
373 Ga0070665_100128804
374 Ga0070664_100016142
375 Ga0068857_100942713
376 Ga0068854_100816517
377 Ga0068856_101158778
378 Ga0070702_100225360
379 Ga0068859_100150370
380 Ga0068861_100247812
381 Ga0068861_100482385
382 Ga0068870_10013742
383 Ga0068870_10349967
384 Ga0068863_100024409
385 Ga0068863_100476197
386 Ga0068860_100144238
387 Ga0068860_100991442
388 Ga0068860_101462577
389 Ga0068862_100617615
390 Ga0068862_100631947
391 Ga0081455_10019755
392 Ga0081538_10052263
393 Ga0075432_10023756
394 Ga0075428_100262367
395 Ga0075428_100638221
396 Ga0075430_100229579
397 Ga0075431_100000079
398 Ga0075431_100251346
399 Ga0075433_10025892
400 Ga0075433_10036215
401 Ga0075434_100010346
402 Ga0075434_100318076
403 Ga0075434_102133430
404 Ga0068865_100104950
405 Ga0068865_100119339
406 Ga0068865_100727984
407 Ga0068865_101359565
408 Ga0075436_100590922
409 Ga0075436_101060643
410 Ga0097620_100150362
411 Ga0075435_100065412
412 Ga0075435_100245677
413 Ga0075435_100824893
414 Ga0111539_10074578
415 Ga0111539_10075792
416 Ga0111539_11193700
417 Ga0105245_10949938
418 Ga0105245_13003581
419 Ga0114129_10084189
420 Ga0114129_10913503
421 Ga0114129_11446881
422 Ga0114129_13012911
423 Ga0105243_10135760
424 Ga0105241_10721499
425 Ga0105242_10027437
426 Ga0105242_10456054
427 Ga0105242_11692315
428 Ga0105248_10398294
429 Ga0105248_11211730
430 Ga0105248_12144793
431 Ga0105249_10823724
432 Ga0105249_11198049
433 Ga0105246_10782085
434 Ga0157378_10302865
435 Ga0157378_11508912
436 Ga0163162_10185963
437 Ga0157375_10065862
438 Ga0157375_10095335
439 Ga0157375_10643944
440 Ga0163163_10089035
441 Ga0163163_10570545
442 Ga0157380_10014906
443 Ga0157377_10056445
444 Ga0157379_10362946
445 Ga0157376_10014061
446 Ga0157376_10080637
447 Ga0163161_10024149
448 Ga0207666_1023111
449 Ga0207697_10001276
450 Ga0207653_10079166
451 Ga0207682_10033488
452 Ga0207688_10477723
453 Ga0207680_10231677
454 Ga0207647_10070734
455 Ga0207645_10022005
456 Ga0207645_10417066
457 Ga0207643_10018518
458 Ga0207684_10012607
459 Ga0207684_10047066
460 Ga0207684_10229008
461 Ga0207657_10041080
462 Ga0207649_10111707
463 Ga0207646_10002353
464 Ga0207646_10003075
465 Ga0207646_10058231
466 Ga0207646_10114549
467 Ga0207646_11020116
468 Ga0207681_10726938
469 Ga0207650_10081159
470 Ga0207650_11051129
471 Ga0207659_10005373
472 Ga0207687_10908443
473 Ga0207644_11118095
474 Ga0207706_10008407
475 Ga0207706_10100191
476 Ga0207686_10017657
477 Ga0207686_10371474
478 Ga0207686_11233357
479 Ga0207709_10062909
480 Ga0207669_10207114
481 Ga0207704_10077283
482 Ga0207704_11069040
483 Ga0207691_10003723
484 Ga0207691_10035376
485 Ga0207711_10392370
486 Ga0207689_10101567
487 Ga0207661_10890559
488 Ga0207679_10065128
489 Ga0207651_10098885
490 Ga0207712_10936939
491 Ga0207712_11237492
492 Ga0207668_10392995
493 Ga0207668_11650106
494 Ga0207658_10335967
495 Ga0207658_11457086
496 Ga0207677_10099608
497 Ga0207677_11566449
498 Ga0207703_10268047
499 Ga0207678_10027441
500 Ga0207708_10012466
501 Ga0207708_10255609
502 Ga0207641_10115222
503 Ga0207641_10578063
504 Ga0207648_10020331
505 Ga0207648_11206182
506 Ga0207676_10909585
507 Ga0207674_10034445
508 Ga0207675_100020772
509 Ga0207675_100463715
510 Ga0207683_10008806
511 Ga0207683_10395340
512 Ga0268266_10089353
513 Ga0268266_10154489
514 Ga0268265_10215966
515 Ga0268265_10318919
516 Ga0268264_10028387
517 Ga0268264_10955696
518 Ga0265762_1004270
519 Ga0307408_100963425
520 Ga0307405_11593199
521 Ga0307410_10011070
522 Ga0373940_0021318
523 Ga0373923_0605744
524 Ga0373936_0120152
525 Ga0373939_0135594
526 Ga0373956_0120956
527 Ga0373931_0453632
528 Ga0373933_0456524
529 Ga0373947_0710249
530 Ga0373937_0034406
531 Ga0373925_0340431
532 Ga0395900_0255065
533 Ga0436364_1420322
534 Ga0395901_0305199
535 Ga0439437_031088
536 Ga0439441_057118
537 Ga0466960_0204743
538 Ga0451576_0120754
539 Ga0451576_0791129
540 Ga0495592_0245296
541 Ga0495603_0085111
542 Ga0495629_0159732
543 Ga0495629_0819023
544 Ga0495580_0000002
545 Ga0495582_0246137
546 Ga0495639_0218732
547 Ga0495640_0333312
548 Ga0495586_0174271
549 Ga0495645_0010515
550 Ga0495667_0036172
551 Ga0495599_0184770
552 Ga0495647_0018945
553 Ga0495658_0381442
554 Ga0495658_0421802
555 Ga0495613_0497330
556 Ga0495600_0074551
557 Ga0495674_0215546
558 Ga0495614_0460093
559 Ga0496102_0170640
560 Ga0496109_1603272
561 Ga0496114_0127393
562 Ga0496115_0044900
563 Ga0501033_0098175
564 Ga0501038_0347167
565 Ga0501039_1020833
566 Ga0501041_0023083
567 Ga0501041_0626363
568 Ga0501042_0045189
569 Ga0501042_0210046
570 Ga0501046_0025822
571 Ga0501067_0721329
572 Ga0501068_0387317
573 Ga0501075_0477885
574 Ga0501076_0033668
575 Ga0501077_0397666
576 Ga0501079_0278424
577 Ga0501079_0889656
578 Ga0501080_0158362
579 Ga0501080_0295844
580 Ga0501081_0073494
581 Ga0501083_0190984
582 Ga0501045_0062879
583 nmdc:mga05p37_117147_c1
584 nmdc:mga05p37_164581_c1
585 nmdc:mga05p37_256189_c1
586 nmdc:mga05p37_309563_c1
587 nmdc:mga05p37_45353_c1
588 nmdc:mga05p37_784563_c1
589 nmdc:mga09592_40291_c1
590 nmdc:mga0qj67_206138_c1
591 nmdc:mga0qj67_22068_c1
592 nmdc:mga06r32_1296513_c1
593 nmdc:mga06r32_1303098_c1
594 nmdc:mga06r32_27181_c1
595 nmdc:mga06r32_527_c1
596 nmdc:mga08y16_59683_c1
597 nmdc:mga0n895_23674_c1
598 nmdc:mga0rr50_118389_c1
599 nmdc:mga0rr50_548358_c1
600 nmdc:mga08x19_259760_c1
601 nmdc:mga08x19_840886_c1
602 nmdc:mga0a205_109774_c1
603 nmdc:mga0a205_16639_c2
604 nmdc:mga0a205_513145_c1
605 nmdc:mga0a205_81132_c1
606 Ga0495601_0061028
607 Ga0495595_0262384
608 Ga0495619_0078696
609 Ga0500566_0363606
610 Ga0500658_0159310
611 Ga0501084_0067600
612 Ga0501084_0279089
613 Ga0501082_0029981
614 Ga0501082_0492908
615 Ga0530510_0007696
616 Ga0530510_0197191

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

72

149

0.97

PF13622

4HBT_3

Acyl-CoA thioesterase N-terminal domain

65

156

0.9

PF14539

DUF4442

Domain of unknown function (DUF4442)

33

157

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dsl-assembly1.cif.gz_A mutant n33d structure of phenylacetic acid degradation protein paai from thermus thermophilus hb8 0.9676 18 134
1wlu-assembly1.cif.gz_A crystal structure of tt0310 protein from thermus thermophilus hb8 0.9624 17 134
5hmb-assembly1.cif.gz_A crystal structure of s. sahachiroi azig 0.9515 18 138
3s4k-assembly1.cif.gz_A structure of a putative esterase rv1847/mt1895 from mycobacterium tuberculosis 0.9511 18 139
5ep5-assembly1.cif.gz_B the crystal structure of the hypothetical protein sav0944 mutant (glu47ala) from staphylococcus aureus. 0.9438 20 136
ID Description Score Start End Superfamily
1wluA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9624 17 134 3.10.129.10
4m20A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9534 18 135 3.10.129.10
3s4kB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9502 18 139 3.10.129.10
1wluA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9305 17 134 3.10.129.10
4xy5A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9285 26 138 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A359C662-F1-model_v4 PaaI family thioesterase 0.9908 28 144 GO:0016289
AF-A0A536LWM7-F1-model_v4 PaaI family thioesterase 0.9895 3 138 GO:0047617
AF-A0A2V8WJJ9-F1-model_v4 PaaI family thioesterase 0.988 19 144 GO:0005829
GO:0061522
AF-A0A1F7P700-F1-model_v4 Thioesterase domain-containing protein 0.9876 21 144 GO:0005829
GO:0061522
AF-A0A1G4T536-F1-model_v4 Uncharacterized domain 1-containing protein 0.987 1 144 GO:0016289

Map