F399402

General Info

Members Datasets Scaffolds Average Seq Length
307 108 612 622

Family's Representative Sequence

Representative Sequence 3300049593|Ga0501077_0002683|Ga0501077_0002683_4539_6566
Length 675
Sequence MEFVTALISGLIQCFNYSTFSLMIVGIAIGFIVGILPGLGGPTAMALMLPFIFKMNAVEAFAFLLGMTAVTATTGDITSVLFGVPGEPTTASTIVDGHAMARNGEAGRALGAVLMSSLVGAVFAGXXXXAAVPIIRPLVLSFGSPEFFMLSLLGITFVAALSGEDALKGIVAGGIGLMLATIGLDPISGIQRYTFGQLFLWDGIGLVPITIGFYAIPETIELAVLGTSIAKQEVGQLGGVMEGVKDTFRHWSLVIRCSALGTFTAIIPGMGAATTQWLAYAHAVQSSPNKERFGKGAVEGVLGPGAANNSTLGGSLITTIAFGVPASVVMAILLGAFIIQGIVPGPDMLLPPPKGKLDLTFSFVWVIIISNFITVAICFLFLKPLAKVTQVRGGIIIPIILVLIYLGAFAEKNAFEDMLVVLFFGALGWVMEKLQWPRPPVLLGLVLGPLAENRLFLSSDNYGLGWTTRPGVLLIFALTLLGIFYPIFKKRKEEKEKASSQIETGATMTKEAQPSGARFSAAALFALVVAILLALALWQSRNFGFRAGLFPWVIGIPTLILALVQLSKDLFGKKKKPAEAVGESAEVEVPPEVAKQRTINILLWTLFFFIAIWFLGFSYAVPIVMLLYLKLAGKEKWPMTLAVTFFTWLFFYVLFERALSVPFPDGLMFTLFKGQ

Samples

Sample ID Description Type Environment
1 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
21 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
29 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
34 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
35 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
44 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
45 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
47 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
48 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
49 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
50 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
51 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
52 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
53 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
54 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
55 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
56 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
57 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
58 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
59 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
60 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
61 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
62 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
63 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
64 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
65 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
66 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
67 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
68 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
69 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
70 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
71 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
72 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
74 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
75 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
82 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
83 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
84 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
85 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
86 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
87 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
88 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
89 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
90 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
91 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
92 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
95 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
96 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
97 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
98 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
99 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
100 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
101 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
102 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
103 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
104 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
105 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
106 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
107 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
108 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.33
Rhizosphere 99.67
Stem 0
Stem Tuber 0
Unclassified 14.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501077_0002683 3300049593 Bacteria 10669
2 JGI25405J52794_10002018 3300003911 Unclassified 3440
3 Ga0065712_10067804 3300005290 Bacteria 31846
4 Ga0065715_10001730 3300005293 Bacteria 6377
5 Ga0065707_10001180 3300005295 Bacteria 17230
6 Ga0070670_100021195 3300005331 Bacteria 5591
7 Ga0070680_100050774 3300005336 Bacteria 3383
8 Ga0070659_100020215 3300005366 Bacteria 5055
9 Ga0070708_100090443 3300005445 Bacteria 2786
10 Ga0070681_10028400 3300005458 Bacteria 5623
11 Ga0070706_100009188 3300005467 Bacteria 9204
12 Ga0070707_100013472 3300005468 Bacteria 7649
13 Ga0070698_100072922 3300005471 Bacteria 3440
14 Ga0070679_100023756 3300005530 Bacteria 6006
15 Ga0070697_100034211 3300005536 Unclassified 4096
16 Ga0070686_100004549 3300005544 Bacteria 7651
17 Ga0070695_100031225 3300005545 Bacteria 3321
18 Ga0070664_100067498 3300005564 Bacteria 3057
19 Ga0081455_10000094 3300005937 Bacteria 96637
20 Ga0081455_10000567 3300005937 Bacteria 48149
21 Ga0081455_10002777 3300005937 Bacteria 20626
22 Ga0081455_10003770 3300005937 Bacteria 17302
23 Ga0081455_10046469 3300005937 Bacteria 3766
24 Ga0081455_10072672 3300005937 Unclassified 2847
25 Ga0081538_10007076 3300005981 Bacteria 9749
26 Ga0081538_10027654 3300005981 Unclassified 3925
27 Ga0075432_10010653 3300006058 Unclassified 3124
28 Ga0075428_100052444 3300006844 Bacteria 4471
29 Ga0075428_100054053 3300006844 Bacteria 4400
30 Ga0075428_100143693 3300006844 Unclassified 2594
31 Ga0075430_100020513 3300006846 Bacteria 5621
32 Ga0075430_100040108 3300006846 Unclassified 3964
33 Ga0075430_100054682 3300006846 Bacteria 3358
34 Ga0075431_100003093 3300006847 Bacteria 16114
35 Ga0075431_100020616 3300006847 Bacteria 6736
36 Ga0075431_100040536 3300006847 Bacteria 4800
37 Ga0075431_100082094 3300006847 Bacteria 3328
38 Ga0075431_100105719 3300006847 Bacteria 2904
39 Ga0075433_10002079 3300006852 Bacteria 15143
40 Ga0075433_10002221 3300006852 Bacteria 14729
41 Ga0075433_10027093 3300006852 Bacteria 4858
42 Ga0075433_10042412 3300006852 Bacteria 3947
43 Ga0075433_10066978 3300006852 Bacteria 3151
44 Ga0075433_10111655 3300006852 Unclassified 2425
45 Ga0075434_100000223 3300006871 Bacteria 38868
46 Ga0075434_100003073 3300006871 Bacteria 14857
47 Ga0075434_100003499 3300006871 Bacteria 14041
48 Ga0075434_100005741 3300006871 Bacteria 11331
49 Ga0075434_100006291 3300006871 Bacteria 10880
50 Ga0075434_100133781 3300006871 Bacteria 2499
51 Ga0075434_100143351 3300006871 Unclassified 2409
52 Ga0075434_100144705 3300006871 Bacteria 2397
53 Ga0075429_100009732 3300006880 Bacteria 8329
54 Ga0075429_100018192 3300006880 Bacteria 6081
55 Ga0075429_100056954 3300006880 Bacteria 3402
56 Ga0075436_100002928 3300006914 Bacteria 11706
57 Ga0075436_100037777 3300006914 Unclassified 3334
58 Ga0075435_100008471 3300007076 Bacteria 7379
59 Ga0075435_100015112 3300007076 Bacteria 5795
60 Ga0075435_100030511 3300007076 Bacteria 4240
61 Ga0075435_100053695 3300007076 Bacteria 3250
62 Ga0111539_10003789 3300009094 Bacteria 19896
63 Ga0111539_10004224 3300009094 Bacteria 18825
64 Ga0111539_10006869 3300009094 Bacteria 14620
65 Ga0111539_10099192 3300009094 Bacteria 3421
66 Ga0114129_10007481 3300009147 Bacteria 15555
67 Ga0114129_10020677 3300009147 Bacteria 9356
68 Ga0114129_10023716 3300009147 Bacteria 8698
69 Ga0114129_10036060 3300009147 Bacteria 6985
70 Ga0114129_10061030 3300009147 Bacteria 5270
71 Ga0114129_10061179 3300009147 Bacteria 5262
72 Ga0114129_10069094 3300009147 Bacteria 4924
73 Ga0114129_10090226 3300009147 Bacteria 4248
74 Ga0114129_10241540 3300009147 Unclassified 2428
75 Ga0105249_10023804 3300009553 Bacteria 5501
76 Ga0157378_10004400 3300013297 Bacteria 12402
77 Ga0157378_10021789 3300013297 Bacteria 5634
78 Ga0163162_10068697 3300013306 Unclassified 3595
79 Ga0207707_10028656 3300025912 Bacteria 4867
80 Ga0207660_10042681 3300025917 Bacteria 3184
81 Ga0207652_10028134 3300025921 Bacteria 4688
82 Ga0207646_10014337 3300025922 Bacteria 7532
83 Ga0207650_10009476 3300025925 Bacteria 6653
84 Ga0207706_10011241 3300025933 Bacteria 8164
85 Ga0207678_10002836 3300026067 Bacteria 15712
86 Ga0207675_100068414 3300026118 Bacteria 3318
87 Ga0209982_1003688 3300027552 Bacteria 2183
88 Ga0209971_1001536 3300027682 Bacteria 5715
89 Ga0209974_10000514 3300027876 Bacteria 12921
90 Ga0209974_10001048 3300027876 Bacteria 9796
91 Ga0209974_10005333 3300027876 Bacteria 4535
92 Ga0207428_10000029 3300027907 Bacteria 241338
93 Ga0207428_10013208 3300027907 Bacteria 7228
94 Ga0307408_100059232 3300031548 Unclassified 2787
95 Ga0307405_10031982 3300031731 Unclassified 3104
96 Ga0307413_10002534 3300031824 Bacteria 7457
97 Ga0307406_10020564 3300031901 Bacteria 3890
98 Ga0307409_100013152 3300031995 Bacteria 5311
99 Ga0307416_100001412 3300032002 Bacteria 13020
100 Ga0307416_100006289 3300032002 Bacteria 7419
101 Ga0307414_10000849 3300032004 Bacteria 15608
102 Ga0307411_10003941 3300032005 Bacteria 7007
103 Ga0307415_100002456 3300032126 Bacteria 9248
104 Ga0373926_0006219 3300035083 Bacteria 3961
105 Ga0373943_0021297 3300035170 Bacteria 2993
106 Ga0373931_0024239 3300035691 Unclassified 3071
107 Ga0373935_0006404 3300035692 Bacteria 7023
108 Ga0373947_0017925 3300035725 Bacteria 4075
109 Ga0373937_0121702 3300036401 Bacteria 2432
110 Ga0373925_0011825 3300037068 Bacteria 6316
111 Ga0451577_0016357 3300042876 Bacteria 6872
112 Ga0453683_0000741 3300044673 Bacteria 33173
113 Ga0451576_0218829 3300045051 Bacteria 1988
114 Ga0495580_0055413 3300046472 Bacteria 2794
115 Ga0495586_0053773 3300046535 Bacteria 2181
116 Ga0496112_0029845 3300048915 Bacteria 5275
117 Ga0501031_0038803 3300049568 Unclassified 3108
118 Ga0501031_0060794 3300049568 Bacteria 2462
119 Ga0501033_0010388 3300049570 Bacteria 7142
120 Ga0501033_0021589 3300049570 Unclassified 4858
121 Ga0501033_0047195 3300049570 Unclassified 3202
122 Ga0501036_0007619 3300049572 Bacteria 8836
123 Ga0501036_0012086 3300049572 Bacteria 7156
124 Ga0501036_0034657 3300049572 Unclassified 4270
125 Ga0501036_0083918 3300049572 Bacteria 2693
126 Ga0501036_0090185 3300049572 Unclassified 2590
127 Ga0501036_0101936 3300049572 Bacteria 2428
128 Ga0501037_0012670 3300049573 Bacteria 6213
129 Ga0501037_0053741 3300049573 Bacteria 2946
130 Ga0501037_0056463 3300049573 Bacteria 2867
131 Ga0501037_0064265 3300049573 Unclassified 2675
132 Ga0501038_0007871 3300049574 Bacteria 9823
133 Ga0501038_0009218 3300049574 Bacteria 9053
134 Ga0501038_0012772 3300049574 Bacteria 7672
135 Ga0501038_0031841 3300049574 Unclassified 4658
136 Ga0501038_0067031 3300049574 Bacteria 3055
137 Ga0501038_0106881 3300049574 Bacteria 2322
138 Ga0501039_0002911 3300049575 Bacteria 12806
139 Ga0501039_0007386 3300049575 Bacteria 8381
140 Ga0501040_0000584 3300049576 Bacteria 22238
141 Ga0501040_0001688 3300049576 Bacteria 14143
142 Ga0501040_0015412 3300049576 Bacteria 5054
143 Ga0501040_0022538 3300049576 Bacteria 4216
144 Ga0501040_0023618 3300049576 Bacteria 4123
145 Ga0501040_0029132 3300049576 Bacteria 3726
146 Ga0501041_0001137 3300049577 Bacteria 14575
147 Ga0501041_0001191 3300049577 Bacteria 14190
148 Ga0501041_0002458 3300049577 Bacteria 10526
149 Ga0501041_0004572 3300049577 Bacteria 8027
150 Ga0501041_0013781 3300049577 Bacteria 4794
151 Ga0501041_0025055 3300049577 Bacteria 3584
152 Ga0501042_0001497 3300049578 Bacteria 13801
153 Ga0501042_0003017 3300049578 Bacteria 10473
154 Ga0501042_0024883 3300049578 Unclassified 4202
155 Ga0501042_0034380 3300049578 Bacteria 3594
156 Ga0501043_0026442 3300049579 Unclassified 4553
157 Ga0501043_0037124 3300049579 Unclassified 3833
158 Ga0501046_0003134 3300049580 Bacteria 15270
159 Ga0501046_0011423 3300049580 Bacteria 7592
160 Ga0501046_0014298 3300049580 Bacteria 6702
161 Ga0501046_0014837 3300049580 Bacteria 6560
162 Ga0501048_0003201 3300049582 Bacteria 12476
163 Ga0501048_0012551 3300049582 Bacteria 6303
164 Ga0501070_0014851 3300049586 Bacteria 6552
165 Ga0501070_0024953 3300049586 Bacteria 5013
166 Ga0501071_0000624 3300049587 Bacteria 18360
167 Ga0501071_0004341 3300049587 Bacteria 8990
168 Ga0501071_0021530 3300049587 Unclassified 4491
169 Ga0501071_0038527 3300049587 Unclassified 3416
170 Ga0501071_0065754 3300049587 Bacteria 2633
171 Ga0501071_0130803 3300049587 Bacteria 1864
172 Ga0501072_0002867 3300049588 Bacteria 12954
173 Ga0501072_0004905 3300049588 Bacteria 10178
174 Ga0501072_0008251 3300049588 Bacteria 7911
175 Ga0501072_0012077 3300049588 Bacteria 6598
176 Ga0501072_0023065 3300049588 Bacteria 4832
177 Ga0501072_0070040 3300049588 Bacteria 2769
178 Ga0501073_0007138 3300049589 Bacteria 8322
179 Ga0501073_0090744 3300049589 Bacteria 2123
180 Ga0501074_0010050 3300049590 Bacteria 6870
181 Ga0501074_0022807 3300049590 Bacteria 4551
182 Ga0501074_0032159 3300049590 Unclassified 3801
183 Ga0501075_0000228 3300049591 Bacteria 30097
184 Ga0501075_0001005 3300049591 Bacteria 18027
185 Ga0501075_0003505 3300049591 Bacteria 10496
186 Ga0501075_0004675 3300049591 Bacteria 9295
187 Ga0501075_0006101 3300049591 Bacteria 8276
188 Ga0501075_0025337 3300049591 Unclassified 4358
189 Ga0501075_0034970 3300049591 Bacteria 3745
190 Ga0501075_0057560 3300049591 Bacteria 2927
191 Ga0501075_0090927 3300049591 Bacteria 2316
192 Ga0501076_0001326 3300049592 Bacteria 16526
193 Ga0501076_0007137 3300049592 Bacteria 8122
194 Ga0501076_0008824 3300049592 Bacteria 7409
195 Ga0501076_0011133 3300049592 Bacteria 6693
196 Ga0501076_0038373 3300049592 Bacteria 3760
197 Ga0501076_0044580 3300049592 Bacteria 3497
198 Ga0501077_0000246 3300049593 Bacteria 32034
199 Ga0501077_0001054 3300049593 Bacteria 16623
200 Ga0501077_0020471 3300049593 Bacteria 4188
201 Ga0501077_0020856 3300049593 Unclassified 4149
202 Ga0501077_0025589 3300049593 Unclassified 3747
203 Ga0501077_0026726 3300049593 Bacteria 3664
204 Ga0501077_0035975 3300049593 Bacteria 3153
205 Ga0501079_0001438 3300049741 Bacteria 16820
206 Ga0501079_0009127 3300049741 Bacteria 7507
207 Ga0501079_0012195 3300049741 Bacteria 6562
208 Ga0501079_0013313 3300049741 Bacteria 6271
209 Ga0501079_0039959 3300049741 Bacteria 3619
210 Ga0501080_0003581 3300049742 Bacteria 13674
211 Ga0501080_0027183 3300049742 Bacteria 5321
212 Ga0501080_0050057 3300049742 Unclassified 3889
213 Ga0501080_0094813 3300049742 Bacteria 2771
214 Ga0501081_0000133 3300049743 Bacteria 33020
215 Ga0501081_0000613 3300049743 Bacteria 20364
216 Ga0501081_0001116 3300049743 Bacteria 16136
217 Ga0501081_0001810 3300049743 Bacteria 13269
218 Ga0501081_0021612 3300049743 Unclassified 4294
219 Ga0501081_0022032 3300049743 Bacteria 4260
220 Ga0501081_0028620 3300049743 Bacteria 3761
221 Ga0501081_0061443 3300049743 Bacteria 2605
222 Ga0501081_0115080 3300049743 Unclassified 1911
223 Ga0501083_0001160 3300049744 Bacteria 17749
224 Ga0501083_0005373 3300049744 Bacteria 9064
225 Ga0501083_0070165 3300049744 Unclassified 2331
226 Ga0501035_0020830 3300049822 Bacteria 6025
227 Ga0501035_0047076 3300049822 Unclassified 3873
228 Ga0501035_0069083 3300049822 Unclassified 3132
229 Ga0501044_0057412 3300049823 Bacteria 3994
230 Ga0501045_0000475 3300049824 Bacteria 24883
231 Ga0501045_0003500 3300049824 Bacteria 10750
232 Ga0501045_0021947 3300049824 Unclassified 4568
233 Ga0501045_0029280 3300049824 Bacteria 3980
234 Ga0501045_0058864 3300049824 Bacteria 2814
235 nmdc:mga05p37_13221_c1 3300050507 Bacteria 9881
236 nmdc:mga05p37_146516_c1 3300050507 Bacteria 2891
237 nmdc:mga05p37_172335_c1 3300050507 Bacteria 2639
238 nmdc:mga05p37_237779_c1 3300050507 Unclassified 2192
239 nmdc:mga05p37_23977_c1 3300050507 Bacteria 7410
240 nmdc:mga05p37_44170_c1 3300050507 Bacteria 5483
241 nmdc:mga05p37_4826_c1 3300050507 Bacteria 15768
242 nmdc:mga05p37_50003_c1 3300050507 Bacteria 5142
243 nmdc:mga05p37_67497_c1 3300050507 Bacteria 4400
244 nmdc:mga05p37_73709_c1 3300050507 Bacteria 4202
245 nmdc:mga09592_1777_c1 3300050508 Bacteria 17321
246 nmdc:mga09592_18901_c1 3300050508 Bacteria 5653
247 nmdc:mga09592_42609_c1 3300050508 Bacteria 3819
248 nmdc:mga09592_62402_c1 3300050508 Bacteria 3153
249 nmdc:mga09592_71431_c1 3300050508 Bacteria 2946
250 nmdc:mga0qj67_155339_c1 3300050509 Unclassified 1857
251 nmdc:mga0qj67_15907_c1 3300050509 Bacteria 5697
252 nmdc:mga0qj67_29857_c1 3300050509 Bacteria 4237
253 nmdc:mga0qj67_4720_c1 3300050509 Bacteria 9899
254 nmdc:mga06r32_15516_c1 3300050510 Bacteria 6919
255 nmdc:mga06r32_26076_c1 3300050510 Bacteria 5446
256 nmdc:mga08y16_176447_c1 3300050511 Bacteria 2219
257 nmdc:mga08y16_5544_c1 3300050511 Bacteria 13216
258 nmdc:mga08y16_5908_c1 3300050511 Bacteria 12831
259 nmdc:mga0n895_103303_c1 3300050512 Bacteria 2861
260 nmdc:mga0n895_127290_c1 3300050512 Bacteria 2571
261 nmdc:mga0n895_132962_c1 3300050512 Bacteria 2514
262 nmdc:mga0n895_2512_c1 3300050512 Bacteria 14358
263 nmdc:mga0n895_34458_c1 3300050512 Bacteria 4874
264 nmdc:mga0n895_37483_c1 3300050512 Bacteria 4691
265 nmdc:mga0n895_4146_c1 3300050512 Bacteria 11825
266 nmdc:mga0n895_5918_c1 3300050512 Bacteria 10282
267 nmdc:mga0rr50_11011_c1 3300050513 Bacteria 5767
268 nmdc:mga0rr50_21012_c1 3300050513 Bacteria 4447
269 nmdc:mga0rr50_2255_c1 3300050513 Bacteria 10825
270 nmdc:mga0rr50_5884_c1 3300050513 Bacteria 7378
271 nmdc:mga0rr50_70979_c1 3300050513 Bacteria 2656
272 nmdc:mga08x19_3372_c1 3300050514 Bacteria 9528
273 nmdc:mga08x19_88516_c1 3300050514 Bacteria 2041
274 nmdc:mga0a205_1226_c1 3300050515 Bacteria 21502
275 nmdc:mga0a205_124756_c1 3300050515 Bacteria 2475
276 nmdc:mga0a205_12494_c1 3300050515 Bacteria 7857
277 nmdc:mga0a205_128351_c1 3300050515 Unclassified 2436
278 nmdc:mga0a205_132024_c1 3300050515 Bacteria 2398
279 nmdc:mga0a205_163486_c1 3300050515 Bacteria 2122
280 nmdc:mga0a205_211924_c1 3300050515 Bacteria 1825
281 nmdc:mga0a205_23082_c1 3300050515 Bacteria 5900
282 nmdc:mga0a205_34154_c1 3300050515 Bacteria 4880
283 nmdc:mga0a205_93627_c1 3300050515 Bacteria 2903
284 Ga0501084_0000869 3300054114 Bacteria 23334
285 Ga0501084_0010714 3300054114 Bacteria 7587
286 Ga0501084_0010814 3300054114 Bacteria 7557
287 Ga0501084_0023172 3300054114 Bacteria 5183
288 Ga0590071_000722 3300059421 Bacteria 9319
289 Ga0590075_004243 3300059424 Bacteria 3391
290 Ga0501082_0002091 3300060353 Bacteria 17584
291 Ga0501082_0002267 3300060353 Bacteria 16849
292 Ga0501082_0016901 3300060353 Bacteria 6282
293 Ga0501082_0020899 3300060353 Bacteria 5646
294 Ga0501082_0049867 3300060353 Unclassified 3610
295 Ga0501082_0072259 3300060353 Bacteria 2971
296 Ga0501082_0086257 3300060353 Unclassified 2708
297 Ga0501082_0087018 3300060353 Unclassified 2695
298 Ga0530510_0000275 3300061734 Bacteria 32534
299 Ga0530510_0006254 3300061734 Bacteria 8282
300 Ga0530510_0013456 3300061734 Bacteria 5751
301 Ga0530510_0016819 3300061734 Bacteria 5180
302 Ga0530510_0019395 3300061734 Bacteria 4827
303 Ga0530510_0022998 3300061734 Unclassified 4441
304 Ga0530510_0032155 3300061734 Bacteria 3773
305 Ga0530510_0083094 3300061734 Bacteria 2332
306 Ga0530510_0094329 3300061734 Bacteria 2186
307 Ga0501077_0002683
308 JGI25405J52794_10002018
309 Ga0065712_10067804
310 Ga0065715_10001730
311 Ga0065707_10001180
312 Ga0070670_100021195
313 Ga0070680_100050774
314 Ga0070659_100020215
315 Ga0070708_100090443
316 Ga0070681_10028400
317 Ga0070706_100009188
318 Ga0070707_100013472
319 Ga0070698_100072922
320 Ga0070679_100023756
321 Ga0070697_100034211
322 Ga0070686_100004549
323 Ga0070695_100031225
324 Ga0070664_100067498
325 Ga0081455_10000094
326 Ga0081455_10000567
327 Ga0081455_10002777
328 Ga0081455_10003770
329 Ga0081455_10046469
330 Ga0081455_10072672
331 Ga0081538_10007076
332 Ga0081538_10027654
333 Ga0075432_10010653
334 Ga0075428_100052444
335 Ga0075428_100054053
336 Ga0075428_100143693
337 Ga0075430_100020513
338 Ga0075430_100040108
339 Ga0075430_100054682
340 Ga0075431_100003093
341 Ga0075431_100020616
342 Ga0075431_100040536
343 Ga0075431_100082094
344 Ga0075431_100105719
345 Ga0075433_10002079
346 Ga0075433_10002221
347 Ga0075433_10027093
348 Ga0075433_10042412
349 Ga0075433_10066978
350 Ga0075433_10111655
351 Ga0075434_100000223
352 Ga0075434_100003073
353 Ga0075434_100003499
354 Ga0075434_100005741
355 Ga0075434_100006291
356 Ga0075434_100133781
357 Ga0075434_100143351
358 Ga0075434_100144705
359 Ga0075429_100009732
360 Ga0075429_100018192
361 Ga0075429_100056954
362 Ga0075436_100002928
363 Ga0075436_100037777
364 Ga0075435_100008471
365 Ga0075435_100015112
366 Ga0075435_100030511
367 Ga0075435_100053695
368 Ga0111539_10003789
369 Ga0111539_10004224
370 Ga0111539_10006869
371 Ga0111539_10099192
372 Ga0114129_10007481
373 Ga0114129_10020677
374 Ga0114129_10023716
375 Ga0114129_10036060
376 Ga0114129_10061030
377 Ga0114129_10061179
378 Ga0114129_10069094
379 Ga0114129_10090226
380 Ga0114129_10241540
381 Ga0105249_10023804
382 Ga0157378_10004400
383 Ga0157378_10021789
384 Ga0163162_10068697
385 Ga0207707_10028656
386 Ga0207660_10042681
387 Ga0207652_10028134
388 Ga0207646_10014337
389 Ga0207650_10009476
390 Ga0207706_10011241
391 Ga0207678_10002836
392 Ga0207675_100068414
393 Ga0209982_1003688
394 Ga0209971_1001536
395 Ga0209974_10000514
396 Ga0209974_10001048
397 Ga0209974_10005333
398 Ga0207428_10000029
399 Ga0207428_10013208
400 Ga0307408_100059232
401 Ga0307405_10031982
402 Ga0307413_10002534
403 Ga0307406_10020564
404 Ga0307409_100013152
405 Ga0307416_100001412
406 Ga0307416_100006289
407 Ga0307414_10000849
408 Ga0307411_10003941
409 Ga0307415_100002456
410 Ga0373926_0006219
411 Ga0373943_0021297
412 Ga0373931_0024239
413 Ga0373935_0006404
414 Ga0373947_0017925
415 Ga0373937_0121702
416 Ga0373925_0011825
417 Ga0451577_0016357
418 Ga0453683_0000741
419 Ga0451576_0218829
420 Ga0495580_0055413
421 Ga0495586_0053773
422 Ga0496112_0029845
423 Ga0501031_0038803
424 Ga0501031_0060794
425 Ga0501033_0010388
426 Ga0501033_0021589
427 Ga0501033_0047195
428 Ga0501036_0007619
429 Ga0501036_0012086
430 Ga0501036_0034657
431 Ga0501036_0083918
432 Ga0501036_0090185
433 Ga0501036_0101936
434 Ga0501037_0012670
435 Ga0501037_0053741
436 Ga0501037_0056463
437 Ga0501037_0064265
438 Ga0501038_0007871
439 Ga0501038_0009218
440 Ga0501038_0012772
441 Ga0501038_0031841
442 Ga0501038_0067031
443 Ga0501038_0106881
444 Ga0501039_0002911
445 Ga0501039_0007386
446 Ga0501040_0000584
447 Ga0501040_0001688
448 Ga0501040_0015412
449 Ga0501040_0022538
450 Ga0501040_0023618
451 Ga0501040_0029132
452 Ga0501041_0001137
453 Ga0501041_0001191
454 Ga0501041_0002458
455 Ga0501041_0004572
456 Ga0501041_0013781
457 Ga0501041_0025055
458 Ga0501042_0001497
459 Ga0501042_0003017
460 Ga0501042_0024883
461 Ga0501042_0034380
462 Ga0501043_0026442
463 Ga0501043_0037124
464 Ga0501046_0003134
465 Ga0501046_0011423
466 Ga0501046_0014298
467 Ga0501046_0014837
468 Ga0501048_0003201
469 Ga0501048_0012551
470 Ga0501070_0014851
471 Ga0501070_0024953
472 Ga0501071_0000624
473 Ga0501071_0004341
474 Ga0501071_0021530
475 Ga0501071_0038527
476 Ga0501071_0065754
477 Ga0501071_0130803
478 Ga0501072_0002867
479 Ga0501072_0004905
480 Ga0501072_0008251
481 Ga0501072_0012077
482 Ga0501072_0023065
483 Ga0501072_0070040
484 Ga0501073_0007138
485 Ga0501073_0090744
486 Ga0501074_0010050
487 Ga0501074_0022807
488 Ga0501074_0032159
489 Ga0501075_0000228
490 Ga0501075_0001005
491 Ga0501075_0003505
492 Ga0501075_0004675
493 Ga0501075_0006101
494 Ga0501075_0025337
495 Ga0501075_0034970
496 Ga0501075_0057560
497 Ga0501075_0090927
498 Ga0501076_0001326
499 Ga0501076_0007137
500 Ga0501076_0008824
501 Ga0501076_0011133
502 Ga0501076_0038373
503 Ga0501076_0044580
504 Ga0501077_0000246
505 Ga0501077_0001054
506 Ga0501077_0020471
507 Ga0501077_0020856
508 Ga0501077_0025589
509 Ga0501077_0026726
510 Ga0501077_0035975
511 Ga0501079_0001438
512 Ga0501079_0009127
513 Ga0501079_0012195
514 Ga0501079_0013313
515 Ga0501079_0039959
516 Ga0501080_0003581
517 Ga0501080_0027183
518 Ga0501080_0050057
519 Ga0501080_0094813
520 Ga0501081_0000133
521 Ga0501081_0000613
522 Ga0501081_0001116
523 Ga0501081_0001810
524 Ga0501081_0021612
525 Ga0501081_0022032
526 Ga0501081_0028620
527 Ga0501081_0061443
528 Ga0501081_0115080
529 Ga0501083_0001160
530 Ga0501083_0005373
531 Ga0501083_0070165
532 Ga0501035_0020830
533 Ga0501035_0047076
534 Ga0501035_0069083
535 Ga0501044_0057412
536 Ga0501045_0000475
537 Ga0501045_0003500
538 Ga0501045_0021947
539 Ga0501045_0029280
540 Ga0501045_0058864
541 nmdc:mga05p37_13221_c1
542 nmdc:mga05p37_146516_c1
543 nmdc:mga05p37_172335_c1
544 nmdc:mga05p37_237779_c1
545 nmdc:mga05p37_23977_c1
546 nmdc:mga05p37_44170_c1
547 nmdc:mga05p37_4826_c1
548 nmdc:mga05p37_50003_c1
549 nmdc:mga05p37_67497_c1
550 nmdc:mga05p37_73709_c1
551 nmdc:mga09592_1777_c1
552 nmdc:mga09592_18901_c1
553 nmdc:mga09592_42609_c1
554 nmdc:mga09592_62402_c1
555 nmdc:mga09592_71431_c1
556 nmdc:mga0qj67_155339_c1
557 nmdc:mga0qj67_15907_c1
558 nmdc:mga0qj67_29857_c1
559 nmdc:mga0qj67_4720_c1
560 nmdc:mga06r32_15516_c1
561 nmdc:mga06r32_26076_c1
562 nmdc:mga08y16_176447_c1
563 nmdc:mga08y16_5544_c1
564 nmdc:mga08y16_5908_c1
565 nmdc:mga0n895_103303_c1
566 nmdc:mga0n895_127290_c1
567 nmdc:mga0n895_132962_c1
568 nmdc:mga0n895_2512_c1
569 nmdc:mga0n895_34458_c1
570 nmdc:mga0n895_37483_c1
571 nmdc:mga0n895_4146_c1
572 nmdc:mga0n895_5918_c1
573 nmdc:mga0rr50_11011_c1
574 nmdc:mga0rr50_21012_c1
575 nmdc:mga0rr50_2255_c1
576 nmdc:mga0rr50_5884_c1
577 nmdc:mga0rr50_70979_c1
578 nmdc:mga08x19_3372_c1
579 nmdc:mga08x19_88516_c1
580 nmdc:mga0a205_1226_c1
581 nmdc:mga0a205_124756_c1
582 nmdc:mga0a205_12494_c1
583 nmdc:mga0a205_128351_c1
584 nmdc:mga0a205_132024_c1
585 nmdc:mga0a205_163486_c1
586 nmdc:mga0a205_211924_c1
587 nmdc:mga0a205_23082_c1
588 nmdc:mga0a205_34154_c1
589 nmdc:mga0a205_93627_c1
590 Ga0501084_0000869
591 Ga0501084_0010714
592 Ga0501084_0010814
593 Ga0501084_0023172
594 Ga0590071_000722
595 Ga0590075_004243
596 Ga0501082_0002091
597 Ga0501082_0002267
598 Ga0501082_0016901
599 Ga0501082_0020899
600 Ga0501082_0049867
601 Ga0501082_0072259
602 Ga0501082_0086257
603 Ga0501082_0087018
604 Ga0530510_0000275
605 Ga0530510_0006254
606 Ga0530510_0013456
607 Ga0530510_0016819
608 Ga0530510_0019395
609 Ga0530510_0022998
610 Ga0530510_0032155
611 Ga0530510_0083094
612 Ga0530510_0094329

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01970

TctA

Tripartite tricarboxylate transporter TctA family

20

443

0.97

PF07331

TctB

Tripartite tricarboxylate transporter TctB family

518

664

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
8jda-assembly1.cif.gz_B cyro-em structure of the na+/h+ antipoter sos1 from arabidopsis thaliana,class2 0.1867 1 467
8jda-assembly1.cif.gz_B cyro-em structure of the na+/h+ antipoter sos1 from arabidopsis thaliana,class2 0.1834 1 467
4zyr-assembly2.cif.gz_B crystal structure of e. coli lactose permease g46w/g262w bound to p-nitrophenyl alpha-d-galactopyranoside (alpha-npg) 0.1768 27 435
4zyr-assembly2.cif.gz_B crystal structure of e. coli lactose permease g46w/g262w bound to p-nitrophenyl alpha-d-galactopyranoside (alpha-npg) 0.172 27 435
6c3i-assembly2.cif.gz_B crystal structure of the deinococcus radiodurans nramp/mnth divalent transition metal transporter g45r mutant in an inward occluded state 0.1716 31 543
ID Description Score Start End Superfamily
af_C6TG14_1_116_1.20.85.10 Mainly Alpha;Up-down Bundle;Photosynthetic Reaction Center, subunit M; domain 1;Photosystem II protein D1-like 0.4088 436 548 1.20.85.10
af_C6TG14_1_116_1.20.85.10 Mainly Alpha;Up-down Bundle;Photosynthetic Reaction Center, subunit M; domain 1;Photosystem II protein D1-like 0.3934 436 548 1.20.85.10
af_O94607_64_272_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2307 141 365 1.20.1250.20
af_O94607_64_272_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2121 141 365 1.20.1250.20
af_A0A0P0XM20_8_411_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2008 2 372 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A7J9XYF3-F1-model_v4 C4-dicarboxylate ABC transporter permease 0.8136 215 377 GO:0016020
AF-A0A257Q664-F1-model_v4 DUF112 domain-containing protein 0.8117 4 468 GO:0016020
AF-A0A7C3NTY2-F1-model_v4 Tricarboxylic transporter 0.8013 4 467 GO:0016020
AF-A0A1F9JZW5-F1-model_v4 DUF112 domain-containing protein 0.7994 4 469 GO:0016020
AF-A0A1S7N1J8-F1-model_v4 deleted 0.7926 228 468

Map