F399340
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 307 | 185 | 307 | 92 |
Family's Representative Sequence
| Representative Sequence | 3300046516|Ga0495628_0271195|Ga0495628_0271195_506_802 |
| Length | 88 |
| Sequence | MCRTSLLVFSAVNAKQLYRMRAPASGREALAYAEPGSVYIDRETDEEMAPVAMVLPLPENLRACSRCDQLIGLDVSDCPYCGLRQTAL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 3 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 4 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 5 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 9 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 13 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 20 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 22 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 24 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 25 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 26 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 27 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 28 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 29 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 30 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 31 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 32 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 33 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 34 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 35 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 38 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 39 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 40 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 41 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 42 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 43 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 44 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 45 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 85 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 88 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 89 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 90 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 91 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 92 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 93 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 94 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 95 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 96 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 97 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 98 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 99 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 100 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 101 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 102 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 103 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 104 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 105 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 106 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 107 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 108 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 109 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 110 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 142 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 143 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 144 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 145 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 146 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 147 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 148 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 149 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 150 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 151 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 152 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 153 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 154 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 155 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 156 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 157 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 158 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 159 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 160 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 161 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 162 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 163 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 165 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 168 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 174 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 175 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 177 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 178 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 179 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 183 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 184 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.58 |
| Nodule | 0 |
| Rhizoplane | 14.66 |
| Rhizosphere | 80.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.98 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1001545 | 3300001977 | Bacteria | 3672 |
| 2 | JGI25407J50210_10015868 | 3300003373 | Unclassified | 1948 |
| 3 | JGI25407J50210_10099062 | 3300003373 | Unclassified | 721 |
| 4 | Ga0068869_100206795 | 3300005334 | Unclassified | 1550 |
| 5 | Ga0068869_100678467 | 3300005334 | Bacteria | 877 |
| 6 | Ga0070691_10044480 | 3300005341 | Unclassified | 2106 |
| 7 | Ga0070668_100248749 | 3300005347 | Bacteria | 1475 |
| 8 | Ga0070668_101325242 | 3300005347 | Bacteria | 655 |
| 9 | Ga0070674_100045796 | 3300005356 | Bacteria | 2989 |
| 10 | Ga0070667_100001110 | 3300005367 | Bacteria | 24556 |
| 11 | Ga0070713_100339333 | 3300005436 | Unclassified | 1392 |
| 12 | Ga0070700_100012035 | 3300005441 | Bacteria | 4809 |
| 13 | Ga0070708_100342878 | 3300005445 | Bacteria | 1408 |
| 14 | Ga0070681_10013258 | 3300005458 | Bacteria | 8190 |
| 15 | Ga0068867_100384927 | 3300005459 | Bacteria | 1179 |
| 16 | Ga0070699_101225315 | 3300005518 | Bacteria | 688 |
| 17 | Ga0070679_100000424 | 3300005530 | Bacteria | 35927 |
| 18 | Ga0070684_100014534 | 3300005535 | Bacteria | 6381 |
| 19 | Ga0070686_100011107 | 3300005544 | Bacteria | 5102 |
| 20 | Ga0070695_101042208 | 3300005545 | Bacteria | 667 |
| 21 | Ga0070704_100014164 | 3300005549 | Bacteria | 4975 |
| 22 | Ga0070704_100258280 | 3300005549 | Bacteria | 1434 |
| 23 | Ga0068855_101714967 | 3300005563 | Unclassified | 640 |
| 24 | Ga0070664_100706760 | 3300005564 | Unclassified | 939 |
| 25 | Ga0068854_100042127 | 3300005578 | Bacteria | 3230 |
| 26 | Ga0068854_101825343 | 3300005578 | Bacteria | 558 |
| 27 | Ga0070702_101344207 | 3300005615 | Bacteria | 582 |
| 28 | Ga0068859_100222554 | 3300005617 | Bacteria | 1975 |
| 29 | Ga0068861_100228683 | 3300005719 | Bacteria | 1576 |
| 30 | Ga0068861_101315651 | 3300005719 | Bacteria | 703 |
| 31 | Ga0068863_100000261 | 3300005841 | Bacteria | 55053 |
| 32 | Ga0068858_100065985 | 3300005842 | Bacteria | 3350 |
| 33 | Ga0068858_100202992 | 3300005842 | Bacteria | 1875 |
| 34 | Ga0068860_100200823 | 3300005843 | Bacteria | 1932 |
| 35 | Ga0068862_100002784 | 3300005844 | Bacteria | 15326 |
| 36 | Ga0081455_10004942 | 3300005937 | Bacteria | 14737 |
| 37 | Ga0081455_10017101 | 3300005937 | Bacteria | 6968 |
| 38 | Ga0081455_10027981 | 3300005937 | Bacteria | 5156 |
| 39 | Ga0081455_10046986 | 3300005937 | Bacteria | 3741 |
| 40 | Ga0081455_10093809 | 3300005937 | Bacteria | 2426 |
| 41 | Ga0081455_10155189 | 3300005937 | Bacteria | 1760 |
| 42 | Ga0081455_10520921 | 3300005937 | Bacteria | 793 |
| 43 | Ga0081455_10747408 | 3300005937 | Bacteria | 618 |
| 44 | Ga0081538_10000609 | 3300005981 | Bacteria | 39610 |
| 45 | Ga0081538_10005104 | 3300005981 | Bacteria | 11923 |
| 46 | Ga0081538_10097518 | 3300005981 | Bacteria | 1493 |
| 47 | Ga0081538_10099915 | 3300005981 | Unclassified | 1465 |
| 48 | Ga0081540_1000868 | 3300005983 | Bacteria | 27372 |
| 49 | Ga0081540_1001098 | 3300005983 | Bacteria | 23963 |
| 50 | Ga0081540_1067368 | 3300005983 | Bacteria | 1673 |
| 51 | Ga0081539_10038119 | 3300005985 | Unclassified | 2852 |
| 52 | Ga0075365_10138220 | 3300006038 | Bacteria | 1690 |
| 53 | Ga0075365_11276139 | 3300006038 | Bacteria | 516 |
| 54 | Ga0075364_10117024 | 3300006051 | Bacteria | 1782 |
| 55 | Ga0075364_10325904 | 3300006051 | Bacteria | 1046 |
| 56 | Ga0070716_100148849 | 3300006173 | Bacteria | 1503 |
| 57 | Ga0070716_101032604 | 3300006173 | Bacteria | 652 |
| 58 | Ga0070712_100004572 | 3300006175 | Bacteria | 8544 |
| 59 | Ga0075367_10207821 | 3300006178 | Unclassified | 1224 |
| 60 | Ga0075428_100059150 | 3300006844 | Bacteria | 4196 |
| 61 | Ga0075430_100006738 | 3300006846 | Bacteria | 9687 |
| 62 | Ga0075430_101201448 | 3300006846 | Bacteria | 624 |
| 63 | Ga0075431_100031941 | 3300006847 | Bacteria | 5424 |
| 64 | Ga0075431_100032007 | 3300006847 | Bacteria | 5420 |
| 65 | Ga0075433_10005003 | 3300006852 | Bacteria | 10383 |
| 66 | Ga0075434_100862125 | 3300006871 | Unclassified | 921 |
| 67 | Ga0075429_100272328 | 3300006880 | Bacteria | 1483 |
| 68 | Ga0068865_100284686 | 3300006881 | Bacteria | 1317 |
| 69 | Ga0068865_101396970 | 3300006881 | Unclassified | 625 |
| 70 | Ga0068865_102114560 | 3300006881 | Bacteria | 512 |
| 71 | Ga0097620_100222546 | 3300006931 | Bacteria | 1975 |
| 72 | Ga0111539_10736271 | 3300009094 | Bacteria | 1148 |
| 73 | Ga0111539_11752893 | 3300009094 | Bacteria | 720 |
| 74 | Ga0111539_12681734 | 3300009094 | Bacteria | 578 |
| 75 | Ga0105245_10003299 | 3300009098 | Bacteria | 14489 |
| 76 | Ga0105245_11916556 | 3300009098 | Bacteria | 646 |
| 77 | Ga0105245_12102627 | 3300009098 | Bacteria | 618 |
| 78 | Ga0105247_10080024 | 3300009101 | Bacteria | 2057 |
| 79 | Ga0105247_10158176 | 3300009101 | Bacteria | 1498 |
| 80 | Ga0114129_10497973 | 3300009147 | Bacteria | 1592 |
| 81 | Ga0114129_10982604 | 3300009147 | Bacteria | 1064 |
| 82 | Ga0114129_12746815 | 3300009147 | Bacteria | 586 |
| 83 | Ga0105243_10741486 | 3300009148 | Bacteria | 962 |
| 84 | Ga0105243_12641548 | 3300009148 | Bacteria | 542 |
| 85 | Ga0105242_10000378 | 3300009176 | Bacteria | 35439 |
| 86 | Ga0105242_10375574 | 3300009176 | Bacteria | 1320 |
| 87 | Ga0105242_12417317 | 3300009176 | Bacteria | 573 |
| 88 | Ga0105248_11041475 | 3300009177 | Bacteria | 924 |
| 89 | Ga0105249_10002088 | 3300009553 | Bacteria | 17318 |
| 90 | Ga0105249_10381425 | 3300009553 | Bacteria | 1436 |
| 91 | Ga0105249_10631398 | 3300009553 | Bacteria | 1128 |
| 92 | Ga0105239_11233925 | 3300010375 | Unclassified | 862 |
| 93 | Ga0105239_11323190 | 3300010375 | Bacteria | 831 |
| 94 | Ga0105239_11458791 | 3300010375 | Bacteria | 790 |
| 95 | Ga0105246_10249181 | 3300011119 | Bacteria | 1409 |
| 96 | Ga0105246_10747627 | 3300011119 | Bacteria | 862 |
| 97 | Ga0157370_11030940 | 3300013104 | Unclassified | 744 |
| 98 | Ga0157374_10001797 | 3300013296 | Bacteria | 18046 |
| 99 | Ga0157374_10058364 | 3300013296 | Bacteria | 3606 |
| 100 | Ga0157374_12518328 | 3300013296 | Bacteria | 542 |
| 101 | Ga0157378_10557571 | 3300013297 | Unclassified | 1152 |
| 102 | Ga0163162_10117522 | 3300013306 | Bacteria | 2761 |
| 103 | Ga0163162_11482622 | 3300013306 | Bacteria | 773 |
| 104 | Ga0157372_11102419 | 3300013307 | Bacteria | 918 |
| 105 | Ga0157375_10149963 | 3300013308 | Bacteria | 2466 |
| 106 | Ga0163163_10677032 | 3300014325 | Bacteria | 1095 |
| 107 | Ga0157380_10001943 | 3300014326 | Bacteria | 13750 |
| 108 | Ga0157377_10234865 | 3300014745 | Bacteria | 1181 |
| 109 | Ga0157377_10284339 | 3300014745 | Bacteria | 1085 |
| 110 | Ga0157379_10015110 | 3300014968 | Bacteria | 6771 |
| 111 | Ga0157379_10018096 | 3300014968 | Bacteria | 6209 |
| 112 | Ga0157379_10082060 | 3300014968 | Bacteria | 2889 |
| 113 | Ga0157376_12873893 | 3300014969 | Unclassified | 521 |
| 114 | Ga0163161_11463001 | 3300017792 | Bacteria | 598 |
| 115 | Ga0207693_10006358 | 3300025915 | Bacteria | 9789 |
| 116 | Ga0207663_10045264 | 3300025916 | Bacteria | 2706 |
| 117 | Ga0207681_10452419 | 3300025923 | Bacteria | 1045 |
| 118 | Ga0207706_10733058 | 3300025933 | Bacteria | 843 |
| 119 | Ga0207686_10017669 | 3300025934 | Bacteria | 4022 |
| 120 | Ga0207704_10128086 | 3300025938 | Bacteria | 1752 |
| 121 | Ga0207704_11224691 | 3300025938 | Unclassified | 640 |
| 122 | Ga0207667_11888079 | 3300025949 | Unclassified | 560 |
| 123 | Ga0207712_10015646 | 3300025961 | Bacteria | 4897 |
| 124 | Ga0207712_10394452 | 3300025961 | Bacteria | 1162 |
| 125 | Ga0207668_10008828 | 3300025972 | Bacteria | 6024 |
| 126 | Ga0207640_10489394 | 3300025981 | Bacteria | 1022 |
| 127 | Ga0207658_10001811 | 3300025986 | Bacteria | 15995 |
| 128 | Ga0207703_10025893 | 3300026035 | Bacteria | 4616 |
| 129 | Ga0207703_10171531 | 3300026035 | Bacteria | 1908 |
| 130 | Ga0207678_10089693 | 3300026067 | Unclassified | 2628 |
| 131 | Ga0207708_11197788 | 3300026075 | Bacteria | 664 |
| 132 | Ga0207675_101162447 | 3300026118 | Bacteria | 792 |
| 133 | Ga0207683_10152605 | 3300026121 | Bacteria | 2085 |
| 134 | Ga0207428_10876234 | 3300027907 | Bacteria | 635 |
| 135 | Ga0268265_10001768 | 3300028380 | Bacteria | 17341 |
| 136 | Ga0268264_10101700 | 3300028381 | Bacteria | 2499 |
| 137 | Ga0265319_1000010 | 3300028563 | Bacteria | 188773 |
| 138 | Ga0265336_10048923 | 3300028666 | Unclassified | 1281 |
| 139 | Ga0265338_10000287 | 3300028800 | Bacteria | 90818 |
| 140 | Ga0265332_10050794 | 3300031238 | Bacteria | 1782 |
| 141 | Ga0265325_10402566 | 3300031241 | Bacteria | 599 |
| 142 | Ga0307410_10071518 | 3300031852 | Bacteria | 2406 |
| 143 | Ga0307406_11516340 | 3300031901 | Bacteria | 590 |
| 144 | Ga0307409_100120574 | 3300031995 | Bacteria | 2220 |
| 145 | Ga0307409_100890315 | 3300031995 | Bacteria | 903 |
| 146 | Ga0307409_101823568 | 3300031995 | Bacteria | 637 |
| 147 | Ga0307416_101084579 | 3300032002 | Bacteria | 905 |
| 148 | Ga0307416_102803438 | 3300032002 | Bacteria | 583 |
| 149 | Ga0307415_100541378 | 3300032126 | Bacteria | 1026 |
| 150 | Ga0373952_0242651 | 3300035092 | Bacteria | 543 |
| 151 | Ga0373961_0129330 | 3300035241 | Bacteria | 844 |
| 152 | Ga0373937_0395072 | 3300036401 | Bacteria | 1312 |
| 153 | Ga0373925_1576080 | 3300037068 | Unclassified | 537 |
| 154 | Ga0395899_0634393 | 3300037312 | Unclassified | 677 |
| 155 | Ga0395899_0908091 | 3300037312 | Unclassified | 537 |
| 156 | Ga0395900_0361067 | 3300037418 | Bacteria | 1424 |
| 157 | Ga0395900_0362758 | 3300037418 | Bacteria | 1420 |
| 158 | Ga0395900_0424601 | 3300037418 | Bacteria | 1290 |
| 159 | Ga0395900_0467156 | 3300037418 | Bacteria | 1216 |
| 160 | Ga0395900_0627745 | 3300037418 | Unclassified | 1013 |
| 161 | Ga0395900_0953454 | 3300037418 | Unclassified | 779 |
| 162 | Ga0395898_0023186 | 3300037466 | Bacteria | 6274 |
| 163 | Ga0395898_0030992 | 3300037466 | Bacteria | 5348 |
| 164 | Ga0395898_0035266 | 3300037466 | Bacteria | 4977 |
| 165 | Ga0395898_0265786 | 3300037466 | Unclassified | 1636 |
| 166 | Ga0395898_1611493 | 3300037466 | Bacteria | 573 |
| 167 | Ga0395898_1955002 | 3300037466 | Unclassified | 506 |
| 168 | Ga0395905_0146108 | 3300037471 | Bacteria | 2225 |
| 169 | Ga0395905_0146499 | 3300037471 | Bacteria | 2222 |
| 170 | Ga0395905_0264930 | 3300037471 | Unclassified | 1604 |
| 171 | Ga0395905_0331337 | 3300037471 | Bacteria | 1413 |
| 172 | Ga0395905_1188084 | 3300037471 | Bacteria | 666 |
| 173 | Ga0395901_0014051 | 3300038443 | Bacteria | 8150 |
| 174 | Ga0395901_0131936 | 3300038443 | Bacteria | 2625 |
| 175 | Ga0395901_0173224 | 3300038443 | Bacteria | 2264 |
| 176 | Ga0395901_1194139 | 3300038443 | Unclassified | 727 |
| 177 | Ga0395901_1250523 | 3300038443 | Bacteria | 706 |
| 178 | Ga0395901_1533777 | 3300038443 | Bacteria | 621 |
| 179 | Ga0436365_0794302 | 3300039437 | Unclassified | 674 |
| 180 | Ga0451804_0210505 | 3300041463 | Unclassified | 614 |
| 181 | Ga0439451_136288 | 3300042009 | Unclassified | 502 |
| 182 | Ga0466967_0690272 | 3300045976 | Bacteria | 1011 |
| 183 | Ga0495592_0141460 | 3300046454 | Bacteria | 1673 |
| 184 | Ga0495641_0017169 | 3300046461 | Bacteria | 3781 |
| 185 | Ga0495641_0272285 | 3300046461 | Bacteria | 762 |
| 186 | Ga0495651_0242006 | 3300046462 | Bacteria | 1237 |
| 187 | Ga0495662_0000069 | 3300046476 | Bacteria | 36219 |
| 188 | Ga0495584_0097406 | 3300046491 | Bacteria | 1486 |
| 189 | Ga0495585_0413110 | 3300046492 | Bacteria | 649 |
| 190 | Ga0495594_0000009 | 3300046499 | Bacteria | 122139 |
| 191 | Ga0495596_0163133 | 3300046500 | Bacteria | 866 |
| 192 | Ga0495616_0274562 | 3300046513 | Unclassified | 718 |
| 193 | Ga0495618_0541920 | 3300046514 | Unclassified | 697 |
| 194 | Ga0495628_0129994 | 3300046516 | Unclassified | 1927 |
| 195 | Ga0495628_0271195 | 3300046516 | Bacteria | 1262 |
| 196 | Ga0495628_0283000 | 3300046516 | Bacteria | 1231 |
| 197 | Ga0495644_0091687 | 3300046523 | Unclassified | 1147 |
| 198 | Ga0495652_0060643 | 3300046529 | Bacteria | 3196 |
| 199 | Ga0495587_0683876 | 3300046536 | Unclassified | 563 |
| 200 | Ga0495609_0444802 | 3300046538 | Unclassified | 515 |
| 201 | Ga0495645_0356298 | 3300046543 | Bacteria | 941 |
| 202 | Ga0495622_0000097 | 3300046557 | Bacteria | 76953 |
| 203 | Ga0495667_0144219 | 3300046559 | Bacteria | 1534 |
| 204 | Ga0495656_0154579 | 3300046615 | Bacteria | 1110 |
| 205 | Ga0495656_0348577 | 3300046615 | Bacteria | 767 |
| 206 | Ga0495668_0224816 | 3300046616 | Bacteria | 1028 |
| 207 | Ga0495634_0006840 | 3300046642 | Bacteria | 8627 |
| 208 | Ga0495634_0043009 | 3300046642 | Bacteria | 3062 |
| 209 | Ga0495625_0231896 | 3300046660 | Unclassified | 1205 |
| 210 | Ga0495599_0393083 | 3300046678 | Bacteria | 826 |
| 211 | Ga0495646_0168154 | 3300046680 | Bacteria | 1210 |
| 212 | Ga0495613_0878570 | 3300046689 | Unclassified | 581 |
| 213 | Ga0495604_0002435 | 3300047317 | Bacteria | 14888 |
| 214 | Ga0495674_0000039 | 3300047319 | Bacteria | 97645 |
| 215 | Ga0495672_0113315 | 3300047320 | Bacteria | 1452 |
| 216 | Ga0495676_0024706 | 3300047321 | Bacteria | 5195 |
| 217 | Ga0495676_0321576 | 3300047321 | Bacteria | 1039 |
| 218 | Ga0495676_0482597 | 3300047321 | Unclassified | 815 |
| 219 | Ga0495679_195023 | 3300047446 | Bacteria | 534 |
| 220 | Ga0495684_0774835 | 3300047471 | Unclassified | 629 |
| 221 | Ga0496100_0005897 | 3300048903 | Bacteria | 6637 |
| 222 | Ga0496100_0653284 | 3300048903 | Unclassified | 819 |
| 223 | Ga0496101_0031031 | 3300048904 | Bacteria | 3753 |
| 224 | Ga0496101_1034935 | 3300048904 | Unclassified | 645 |
| 225 | Ga0496101_1585718 | 3300048904 | Bacteria | 509 |
| 226 | Ga0496102_0006408 | 3300048905 | Bacteria | 10034 |
| 227 | Ga0496102_0345906 | 3300048905 | Bacteria | 1400 |
| 228 | Ga0496102_0386579 | 3300048905 | Bacteria | 1317 |
| 229 | Ga0496103_0002557 | 3300048906 | Bacteria | 11401 |
| 230 | Ga0496103_0019977 | 3300048906 | Bacteria | 4023 |
| 231 | Ga0496103_0646180 | 3300048906 | Bacteria | 672 |
| 232 | Ga0496104_0000008 | 3300048907 | Bacteria | 516976 |
| 233 | Ga0496104_0000010 | 3300048907 | Bacteria | 475255 |
| 234 | Ga0496104_0030394 | 3300048907 | Bacteria | 5019 |
| 235 | Ga0496105_0000003 | 3300048908 | Bacteria | 713251 |
| 236 | Ga0496105_0000005 | 3300048908 | Bacteria | 475797 |
| 237 | Ga0496105_0000051 | 3300048908 | Bacteria | 90365 |
| 238 | Ga0496105_0014615 | 3300048908 | Bacteria | 6251 |
| 239 | Ga0496106_0006957 | 3300048909 | Bacteria | 8363 |
| 240 | Ga0496106_0250048 | 3300048909 | Unclassified | 1417 |
| 241 | Ga0496107_0035366 | 3300048910 | Bacteria | 3581 |
| 242 | Ga0496107_0304548 | 3300048910 | Bacteria | 1186 |
| 243 | Ga0496107_0484861 | 3300048910 | Unclassified | 917 |
| 244 | Ga0496108_0001876 | 3300048911 | Bacteria | 16829 |
| 245 | Ga0496108_0475090 | 3300048911 | Bacteria | 1092 |
| 246 | Ga0496109_0004919 | 3300048912 | Bacteria | 11154 |
| 247 | Ga0496109_0276777 | 3300048912 | Bacteria | 1581 |
| 248 | Ga0496109_0429519 | 3300048912 | Bacteria | 1248 |
| 249 | Ga0496109_0792942 | 3300048912 | Bacteria | 885 |
| 250 | Ga0496110_0041398 | 3300048913 | Bacteria | 4019 |
| 251 | Ga0496110_0067877 | 3300048913 | Unclassified | 3156 |
| 252 | Ga0496110_0793382 | 3300048913 | Bacteria | 851 |
| 253 | Ga0496111_0034373 | 3300048914 | Bacteria | 3619 |
| 254 | Ga0496111_0041144 | 3300048914 | Bacteria | 3316 |
| 255 | Ga0496112_0033120 | 3300048915 | Bacteria | 5020 |
| 256 | Ga0496112_0621871 | 3300048915 | Bacteria | 1011 |
| 257 | Ga0496113_0020317 | 3300048916 | Bacteria | 4667 |
| 258 | Ga0496113_0066925 | 3300048916 | Bacteria | 2722 |
| 259 | Ga0496113_0611852 | 3300048916 | Unclassified | 872 |
| 260 | Ga0496114_0000003 | 3300048917 | Bacteria | 630981 |
| 261 | Ga0496114_0005733 | 3300048917 | Bacteria | 9747 |
| 262 | Ga0496114_0915616 | 3300048917 | Bacteria | 758 |
| 263 | Ga0496115_0000827 | 3300048918 | Bacteria | 22678 |
| 264 | Ga0496115_0023855 | 3300048918 | Bacteria | 4750 |
| 265 | Ga0496116_0143191 | 3300048919 | Bacteria | 1341 |
| 266 | Ga0496119_0016268 | 3300048922 | Bacteria | 5671 |
| 267 | Ga0501039_0553574 | 3300049575 | Bacteria | 902 |
| 268 | Ga0501040_0189087 | 3300049576 | Bacteria | 1461 |
| 269 | Ga0501040_0245629 | 3300049576 | Bacteria | 1276 |
| 270 | Ga0501042_0520677 | 3300049578 | Unclassified | 864 |
| 271 | Ga0501042_0684060 | 3300049578 | Bacteria | 746 |
| 272 | Ga0501067_0790637 | 3300049583 | Bacteria | 534 |
| 273 | Ga0501070_0591071 | 3300049586 | Bacteria | 885 |
| 274 | Ga0501071_0762503 | 3300049587 | Bacteria | 746 |
| 275 | Ga0501071_1221382 | 3300049587 | Unclassified | 581 |
| 276 | Ga0501071_1476336 | 3300049587 | Bacteria | 525 |
| 277 | Ga0501072_0135569 | 3300049588 | Bacteria | 1963 |
| 278 | Ga0501072_0779652 | 3300049588 | Unclassified | 749 |
| 279 | Ga0501074_1297586 | 3300049590 | Unclassified | 510 |
| 280 | Ga0501075_0669999 | 3300049591 | Unclassified | 791 |
| 281 | Ga0501075_1234404 | 3300049591 | Unclassified | 567 |
| 282 | Ga0501076_1711234 | 3300049592 | Bacteria | 516 |
| 283 | Ga0501079_0831966 | 3300049741 | Bacteria | 727 |
| 284 | Ga0501079_1279743 | 3300049741 | Bacteria | 577 |
| 285 | Ga0501081_0533386 | 3300049743 | Unclassified | 876 |
| 286 | Ga0501083_0213859 | 3300049744 | Bacteria | 1257 |
| 287 | Ga0501045_0184182 | 3300049824 | Bacteria | 1556 |
| 288 | nmdc:mga00v17_142628_c1 | 3300050491 | Bacteria | 1536 |
| 289 | nmdc:mga00v17_179397_c1 | 3300050491 | Bacteria | 1366 |
| 290 | nmdc:mga0yw44_104282_c1 | 3300050492 | Bacteria | 1810 |
| 291 | nmdc:mga0yw44_1187563_c1 | 3300050492 | Bacteria | 515 |
| 292 | nmdc:mga05p37_349409_c1 | 3300050507 | Bacteria | 1741 |
| 293 | nmdc:mga05p37_44576_c1 | 3300050507 | Bacteria | 5456 |
| 294 | nmdc:mga09592_279686_c1 | 3300050508 | Bacteria | 1447 |
| 295 | nmdc:mga0qj67_98783_c1 | 3300050509 | Bacteria | 2352 |
| 296 | nmdc:mga06r32_35823_c1 | 3300050510 | Bacteria | 4683 |
| 297 | nmdc:mga06r32_55724_c1 | 3300050510 | Bacteria | 3793 |
| 298 | nmdc:mga08y16_1508664_c1 | 3300050511 | Bacteria | 632 |
| 299 | nmdc:mga08y16_1762263_c1 | 3300050511 | Bacteria | 573 |
| 300 | nmdc:mga08y16_462111_c1 | 3300050511 | Bacteria | 1293 |
| 301 | nmdc:mga08y16_644304_c1 | 3300050511 | Bacteria | 1064 |
| 302 | Ga0495601_0578731 | 3300053077 | Bacteria | 721 |
| 303 | Ga0495619_0267981 | 3300053085 | Archaea | 1184 |
| 304 | Ga0500641_0001015 | 3300053096 | Bacteria | 9981 |
| 305 | Ga0500554_210911 | 3300053102 | Unclassified | 648 |
| 306 | Ga0501084_0234289 | 3300054114 | Bacteria | 1550 |
| 307 | Ga0501082_0132931 | 3300060353 | Bacteria | 2159 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046516 | Ga0495628_0271195 | Ga0495628_0271195_506_802 | 77 |
| 2 | 3300001977 | JGI24746J21847_1001545 | JGI24746J21847_10015452 | 87 |
| 3 | 3300003373 | JGI25407J50210_10015868 | JGI25407J50210_100158682 | 87 |
| 4 | 3300003373 | JGI25407J50210_10099062 | JGI25407J50210_100990621 | 87 |
| 5 | 3300005334 | Ga0068869_100206795 | Ga0068869_1002067952 | 87 |
| 6 | 3300005334 | Ga0068869_100678467 | Ga0068869_1006784671 | 87 |
| 7 | 3300005341 | Ga0070691_10044480 | Ga0070691_100444802 | 87 |
| 8 | 3300005347 | Ga0070668_100248749 | Ga0070668_1002487491 | 87 |
| 9 | 3300005347 | Ga0070668_101325242 | Ga0070668_1013252421 | 87 |
| 10 | 3300005356 | Ga0070674_100045796 | Ga0070674_1000457962 | 87 |
| 11 | 3300005367 | Ga0070667_100001110 | Ga0070667_10000111011 | 87 |
| 12 | 3300005436 | Ga0070713_100339333 | Ga0070713_1003393331 | 87 |
| 13 | 3300005441 | Ga0070700_100012035 | Ga0070700_1000120354 | 87 |
| 14 | 3300005445 | Ga0070708_100342878 | Ga0070708_1003428781 | 87 |
| 15 | 3300005458 | Ga0070681_10013258 | Ga0070681_100132582 | 87 |
| 16 | 3300005459 | Ga0068867_100384927 | Ga0068867_1003849271 | 87 |
| 17 | 3300005518 | Ga0070699_101225315 | Ga0070699_1012253152 | 87 |
| 18 | 3300005530 | Ga0070679_100000424 | Ga0070679_1000004244 | 87 |
| 19 | 3300005535 | Ga0070684_100014534 | Ga0070684_1000145349 | 87 |
| 20 | 3300005544 | Ga0070686_100011107 | Ga0070686_1000111074 | 87 |
| 21 | 3300005545 | Ga0070695_101042208 | Ga0070695_1010422082 | 87 |
| 22 | 3300005549 | Ga0070704_100014164 | Ga0070704_1000141644 | 87 |
| 23 | 3300005549 | Ga0070704_100258280 | Ga0070704_1002582802 | 87 |
| 24 | 3300005563 | Ga0068855_101714967 | Ga0068855_1017149672 | 87 |
| 25 | 3300005564 | Ga0070664_100706760 | Ga0070664_1007067602 | 87 |
| 26 | 3300005578 | Ga0068854_100042127 | Ga0068854_1000421272 | 87 |
| 27 | 3300005578 | Ga0068854_101825343 | Ga0068854_1018253431 | 87 |
| 28 | 3300005615 | Ga0070702_101344207 | Ga0070702_1013442071 | 87 |
| 29 | 3300005617 | Ga0068859_100222554 | Ga0068859_1002225543 | 87 |
| 30 | 3300005719 | Ga0068861_100228683 | Ga0068861_1002286831 | 87 |
| 31 | 3300005719 | Ga0068861_101315651 | Ga0068861_1013156512 | 87 |
| 32 | 3300005841 | Ga0068863_100000261 | Ga0068863_10000026127 | 87 |
| 33 | 3300005842 | Ga0068858_100065985 | Ga0068858_1000659855 | 87 |
| 34 | 3300005842 | Ga0068858_100202992 | Ga0068858_1002029922 | 87 |
| 35 | 3300005843 | Ga0068860_100200823 | Ga0068860_1002008232 | 87 |
| 36 | 3300005844 | Ga0068862_100002784 | Ga0068862_10000278411 | 87 |
| 37 | 3300005937 | Ga0081455_10004942 | Ga0081455_1000494215 | 87 |
| 38 | 3300005937 | Ga0081455_10017101 | Ga0081455_100171019 | 87 |
| 39 | 3300005937 | Ga0081455_10027981 | Ga0081455_100279812 | 87 |
| 40 | 3300005937 | Ga0081455_10046986 | Ga0081455_100469864 | 87 |
| 41 | 3300005937 | Ga0081455_10093809 | Ga0081455_100938095 | 87 |
| 42 | 3300005937 | Ga0081455_10155189 | Ga0081455_101551892 | 87 |
| 43 | 3300005937 | Ga0081455_10520921 | Ga0081455_105209212 | 87 |
| 44 | 3300005937 | Ga0081455_10747408 | Ga0081455_107474082 | 87 |
| 45 | 3300005981 | Ga0081538_10000609 | Ga0081538_100006098 | 87 |
| 46 | 3300005981 | Ga0081538_10005104 | Ga0081538_100051046 | 87 |
| 47 | 3300005981 | Ga0081538_10097518 | Ga0081538_100975182 | 87 |
| 48 | 3300005981 | Ga0081538_10099915 | Ga0081538_100999152 | 87 |
| 49 | 3300005983 | Ga0081540_1000868 | Ga0081540_10008682 | 87 |
| 50 | 3300005983 | Ga0081540_1001098 | Ga0081540_100109817 | 87 |
| 51 | 3300005983 | Ga0081540_1067368 | Ga0081540_10673682 | 87 |
| 52 | 3300005985 | Ga0081539_10038119 | Ga0081539_100381192 | 87 |
| 53 | 3300006038 | Ga0075365_10138220 | Ga0075365_101382202 | 87 |
| 54 | 3300006038 | Ga0075365_11276139 | Ga0075365_112761392 | 87 |
| 55 | 3300006051 | Ga0075364_10117024 | Ga0075364_101170244 | 87 |
| 56 | 3300006051 | Ga0075364_10325904 | Ga0075364_103259042 | 87 |
| 57 | 3300006173 | Ga0070716_100148849 | Ga0070716_1001488492 | 87 |
| 58 | 3300006173 | Ga0070716_101032604 | Ga0070716_1010326042 | 87 |
| 59 | 3300006175 | Ga0070712_100004572 | Ga0070712_1000045724 | 87 |
| 60 | 3300006178 | Ga0075367_10207821 | Ga0075367_102078212 | 87 |
| 61 | 3300006844 | Ga0075428_100059150 | Ga0075428_1000591502 | 87 |
| 62 | 3300006846 | Ga0075430_100006738 | Ga0075430_10000673811 | 87 |
| 63 | 3300006846 | Ga0075430_101201448 | Ga0075430_1012014482 | 87 |
| 64 | 3300006847 | Ga0075431_100031941 | Ga0075431_1000319416 | 87 |
| 65 | 3300006847 | Ga0075431_100032007 | Ga0075431_1000320076 | 87 |
| 66 | 3300006852 | Ga0075433_10005003 | Ga0075433_100050038 | 87 |
| 67 | 3300006871 | Ga0075434_100862125 | Ga0075434_1008621252 | 87 |
| 68 | 3300006880 | Ga0075429_100272328 | Ga0075429_1002723282 | 87 |
| 69 | 3300006881 | Ga0068865_100284686 | Ga0068865_1002846862 | 87 |
| 70 | 3300006881 | Ga0068865_101396970 | Ga0068865_1013969702 | 87 |
| 71 | 3300006881 | Ga0068865_102114560 | Ga0068865_1021145602 | 87 |
| 72 | 3300006931 | Ga0097620_100222546 | Ga0097620_1002225463 | 87 |
| 73 | 3300009094 | Ga0111539_10736271 | Ga0111539_107362712 | 87 |
| 74 | 3300009094 | Ga0111539_11752893 | Ga0111539_117528932 | 87 |
| 75 | 3300009094 | Ga0111539_12681734 | Ga0111539_126817341 | 87 |
| 76 | 3300009098 | Ga0105245_10003299 | Ga0105245_100032997 | 87 |
| 77 | 3300009098 | Ga0105245_11916556 | Ga0105245_119165562 | 87 |
| 78 | 3300009098 | Ga0105245_12102627 | Ga0105245_121026272 | 87 |
| 79 | 3300009101 | Ga0105247_10080024 | Ga0105247_100800242 | 87 |
| 80 | 3300009101 | Ga0105247_10158176 | Ga0105247_101581762 | 87 |
| 81 | 3300009147 | Ga0114129_10497973 | Ga0114129_104979733 | 87 |
| 82 | 3300009147 | Ga0114129_10982604 | Ga0114129_109826042 | 87 |
| 83 | 3300009147 | Ga0114129_12746815 | Ga0114129_127468152 | 87 |
| 84 | 3300009148 | Ga0105243_10741486 | Ga0105243_107414862 | 87 |
| 85 | 3300009148 | Ga0105243_12641548 | Ga0105243_126415481 | 87 |
| 86 | 3300009176 | Ga0105242_10000378 | Ga0105242_1000037839 | 87 |
| 87 | 3300009176 | Ga0105242_10375574 | Ga0105242_103755743 | 87 |
| 88 | 3300009176 | Ga0105242_12417317 | Ga0105242_124173172 | 87 |
| 89 | 3300009177 | Ga0105248_11041475 | Ga0105248_110414752 | 87 |
| 90 | 3300009553 | Ga0105249_10002088 | Ga0105249_100020882 | 87 |
| 91 | 3300009553 | Ga0105249_10381425 | Ga0105249_103814251 | 87 |
| 92 | 3300009553 | Ga0105249_10631398 | Ga0105249_106313981 | 87 |
| 93 | 3300010375 | Ga0105239_11233925 | Ga0105239_112339251 | 87 |
| 94 | 3300010375 | Ga0105239_11323190 | Ga0105239_113231902 | 87 |
| 95 | 3300010375 | Ga0105239_11458791 | Ga0105239_114587912 | 87 |
| 96 | 3300011119 | Ga0105246_10249181 | Ga0105246_102491812 | 87 |
| 97 | 3300011119 | Ga0105246_10747627 | Ga0105246_107476272 | 87 |
| 98 | 3300013104 | Ga0157370_11030940 | Ga0157370_110309402 | 87 |
| 99 | 3300013296 | Ga0157374_10001797 | Ga0157374_100017974 | 87 |
| 100 | 3300013296 | Ga0157374_10058364 | Ga0157374_100583642 | 87 |
| 101 | 3300013296 | Ga0157374_12518328 | Ga0157374_125183282 | 87 |
| 102 | 3300013297 | Ga0157378_10557571 | Ga0157378_105575712 | 87 |
| 103 | 3300013306 | Ga0163162_10117522 | Ga0163162_101175223 | 87 |
| 104 | 3300013306 | Ga0163162_11482622 | Ga0163162_114826222 | 87 |
| 105 | 3300013307 | Ga0157372_11102419 | Ga0157372_111024192 | 87 |
| 106 | 3300013308 | Ga0157375_10149963 | Ga0157375_101499633 | 87 |
| 107 | 3300014325 | Ga0163163_10677032 | Ga0163163_106770322 | 87 |
| 108 | 3300014326 | Ga0157380_10001943 | Ga0157380_100019434 | 87 |
| 109 | 3300014745 | Ga0157377_10234865 | Ga0157377_102348652 | 87 |
| 110 | 3300014745 | Ga0157377_10284339 | Ga0157377_102843391 | 87 |
| 111 | 3300014968 | Ga0157379_10015110 | Ga0157379_100151104 | 87 |
| 112 | 3300014968 | Ga0157379_10018096 | Ga0157379_100180964 | 87 |
| 113 | 3300014968 | Ga0157379_10082060 | Ga0157379_100820601 | 87 |
| 114 | 3300014969 | Ga0157376_12873893 | Ga0157376_128738931 | 87 |
| 115 | 3300017792 | Ga0163161_11463001 | Ga0163161_114630012 | 87 |
| 116 | 3300025915 | Ga0207693_10006358 | Ga0207693_100063588 | 87 |
| 117 | 3300025916 | Ga0207663_10045264 | Ga0207663_100452642 | 87 |
| 118 | 3300025923 | Ga0207681_10452419 | Ga0207681_104524191 | 87 |
| 119 | 3300025933 | Ga0207706_10733058 | Ga0207706_107330582 | 87 |
| 120 | 3300025934 | Ga0207686_10017669 | Ga0207686_100176692 | 87 |
| 121 | 3300025938 | Ga0207704_10128086 | Ga0207704_101280862 | 87 |
| 122 | 3300025938 | Ga0207704_11224691 | Ga0207704_112246911 | 87 |
| 123 | 3300025949 | Ga0207667_11888079 | Ga0207667_118880792 | 87 |
| 124 | 3300025961 | Ga0207712_10015646 | Ga0207712_100156465 | 87 |
| 125 | 3300025961 | Ga0207712_10394452 | Ga0207712_103944522 | 87 |
| 126 | 3300025972 | Ga0207668_10008828 | Ga0207668_100088285 | 87 |
| 127 | 3300025981 | Ga0207640_10489394 | Ga0207640_104893942 | 87 |
| 128 | 3300025986 | Ga0207658_10001811 | Ga0207658_1000181117 | 87 |
| 129 | 3300026035 | Ga0207703_10025893 | Ga0207703_100258932 | 87 |
| 130 | 3300026035 | Ga0207703_10171531 | Ga0207703_101715312 | 87 |
| 131 | 3300026067 | Ga0207678_10089693 | Ga0207678_100896932 | 87 |
| 132 | 3300026075 | Ga0207708_11197788 | Ga0207708_111977882 | 87 |
| 133 | 3300026118 | Ga0207675_101162447 | Ga0207675_1011624471 | 87 |
| 134 | 3300026121 | Ga0207683_10152605 | Ga0207683_101526052 | 87 |
| 135 | 3300027907 | Ga0207428_10876234 | Ga0207428_108762342 | 87 |
| 136 | 3300028380 | Ga0268265_10001768 | Ga0268265_1000176814 | 87 |
| 137 | 3300028381 | Ga0268264_10101700 | Ga0268264_101017002 | 87 |
| 138 | 3300028563 | Ga0265319_1000010 | Ga0265319_100001056 | 87 |
| 139 | 3300028666 | Ga0265336_10048923 | Ga0265336_100489232 | 87 |
| 140 | 3300028800 | Ga0265338_10000287 | Ga0265338_1000028753 | 87 |
| 141 | 3300031238 | Ga0265332_10050794 | Ga0265332_100507942 | 87 |
| 142 | 3300031241 | Ga0265325_10402566 | Ga0265325_104025662 | 87 |
| 143 | 3300031852 | Ga0307410_10071518 | Ga0307410_100715182 | 87 |
| 144 | 3300031901 | Ga0307406_11516340 | Ga0307406_115163402 | 87 |
| 145 | 3300031995 | Ga0307409_100120574 | Ga0307409_1001205742 | 87 |
| 146 | 3300031995 | Ga0307409_100890315 | Ga0307409_1008903152 | 87 |
| 147 | 3300031995 | Ga0307409_101823568 | Ga0307409_1018235682 | 87 |
| 148 | 3300032002 | Ga0307416_101084579 | Ga0307416_1010845792 | 87 |
| 149 | 3300032002 | Ga0307416_102803438 | Ga0307416_1028034382 | 87 |
| 150 | 3300032126 | Ga0307415_100541378 | Ga0307415_1005413782 | 87 |
| 151 | 3300035092 | Ga0373952_0242651 | Ga0373952_0242651_90_419 | 87 |
| 152 | 3300035241 | Ga0373961_0129330 | Ga0373961_0129330_449_733 | 87 |
| 153 | 3300036401 | Ga0373937_0395072 | Ga0373937_0395072_171_434 | 87 |
| 154 | 3300037068 | Ga0373925_1576080 | Ga0373925_1576080_156_440 | 87 |
| 155 | 3300037312 | Ga0395899_0634393 | Ga0395899_0634393_310_609 | 87 |
| 156 | 3300037312 | Ga0395899_0908091 | Ga0395899_0908091_37_324 | 87 |
| 157 | 3300037418 | Ga0395900_0361067 | Ga0395900_0361067_42_320 | 87 |
| 158 | 3300037418 | Ga0395900_0362758 | Ga0395900_0362758_653_931 | 87 |
| 159 | 3300037418 | Ga0395900_0424601 | Ga0395900_0424601_575_850 | 87 |
| 160 | 3300037418 | Ga0395900_0467156 | Ga0395900_0467156_349_639 | 87 |
| 161 | 3300037418 | Ga0395900_0627745 | Ga0395900_0627745_216_494 | 87 |
| 162 | 3300037418 | Ga0395900_0953454 | Ga0395900_0953454_121_399 | 87 |
| 163 | 3300037466 | Ga0395898_0023186 | Ga0395898_0023186_2918_3196 | 87 |
| 164 | 3300037466 | Ga0395898_0030992 | Ga0395898_0030992_295_573 | 87 |
| 165 | 3300037466 | Ga0395898_0035266 | Ga0395898_0035266_4303_4590 | 87 |
| 166 | 3300037466 | Ga0395898_0265786 | Ga0395898_0265786_229_507 | 87 |
| 167 | 3300037466 | Ga0395898_1611493 | Ga0395898_1611493_198_461 | 87 |
| 168 | 3300037466 | Ga0395898_1955002 | Ga0395898_1955002_86_373 | 87 |
| 169 | 3300037471 | Ga0395905_0146108 | Ga0395905_0146108_826_1104 | 87 |
| 170 | 3300037471 | Ga0395905_0146499 | Ga0395905_0146499_708_1010 | 87 |
| 171 | 3300037471 | Ga0395905_0264930 | Ga0395905_0264930_277_555 | 87 |
| 172 | 3300037471 | Ga0395905_0331337 | Ga0395905_0331337_320_598 | 87 |
| 173 | 3300037471 | Ga0395905_1188084 | Ga0395905_1188084_206_493 | 87 |
| 174 | 3300038443 | Ga0395901_0014051 | Ga0395901_0014051_6913_7191 | 87 |
| 175 | 3300038443 | Ga0395901_0131936 | Ga0395901_0131936_585_872 | 87 |
| 176 | 3300038443 | Ga0395901_0173224 | Ga0395901_0173224_645_923 | 87 |
| 177 | 3300038443 | Ga0395901_1194139 | Ga0395901_1194139_270_548 | 87 |
| 178 | 3300038443 | Ga0395901_1250523 | Ga0395901_1250523_129_407 | 87 |
| 179 | 3300038443 | Ga0395901_1533777 | Ga0395901_1533777_66_344 | 87 |
| 180 | 3300039437 | Ga0436365_0794302 | Ga0436365_0794302_83_352 | 87 |
| 181 | 3300041463 | Ga0451804_0210505 | Ga0451804_0210505_162_425 | 87 |
| 182 | 3300042009 | Ga0439451_136288 | Ga0439451_136288_209_484 | 87 |
| 183 | 3300045976 | Ga0466967_0690272 | Ga0466967_0690272_339_605 | 87 |
| 184 | 3300046454 | Ga0495592_0141460 | Ga0495592_0141460_235_498 | 87 |
| 185 | 3300046461 | Ga0495641_0017169 | Ga0495641_0017169_2690_2953 | 87 |
| 186 | 3300046461 | Ga0495641_0272285 | Ga0495641_0272285_455_736 | 87 |
| 187 | 3300046462 | Ga0495651_0242006 | Ga0495651_0242006_382_645 | 87 |
| 188 | 3300046476 | Ga0495662_0000069 | Ga0495662_0000069_26595_26858 | 87 |
| 189 | 3300046491 | Ga0495584_0097406 | Ga0495584_0097406_1001_1276 | 87 |
| 190 | 3300046492 | Ga0495585_0413110 | Ga0495585_0413110_331_606 | 87 |
| 191 | 3300046499 | Ga0495594_0000009 | Ga0495594_0000009_25689_26003 | 87 |
| 192 | 3300046500 | Ga0495596_0163133 | Ga0495596_0163133_106_435 | 87 |
| 193 | 3300046513 | Ga0495616_0274562 | Ga0495616_0274562_386_676 | 87 |
| 194 | 3300046514 | Ga0495618_0541920 | Ga0495618_0541920_220_513 | 87 |
| 195 | 3300046516 | Ga0495628_0129994 | Ga0495628_0129994_1185_1460 | 87 |
| 196 | 3300046516 | Ga0495628_0283000 | Ga0495628_0283000_884_1147 | 87 |
| 197 | 3300046523 | Ga0495644_0091687 | Ga0495644_0091687_182_472 | 87 |
| 198 | 3300046529 | Ga0495652_0060643 | Ga0495652_0060643_2856_3119 | 87 |
| 199 | 3300046536 | Ga0495587_0683876 | Ga0495587_0683876_102_365 | 87 |
| 200 | 3300046538 | Ga0495609_0444802 | Ga0495609_0444802_122_451 | 87 |
| 201 | 3300046543 | Ga0495645_0356298 | Ga0495645_0356298_69_332 | 87 |
| 202 | 3300046557 | Ga0495622_0000097 | Ga0495622_0000097_74916_75230 | 87 |
| 203 | 3300046559 | Ga0495667_0144219 | Ga0495667_0144219_185_448 | 87 |
| 204 | 3300046615 | Ga0495656_0154579 | Ga0495656_0154579_22_315 | 87 |
| 205 | 3300046615 | Ga0495656_0348577 | Ga0495656_0348577_300_575 | 87 |
| 206 | 3300046616 | Ga0495668_0224816 | Ga0495668_0224816_586_915 | 87 |
| 207 | 3300046642 | Ga0495634_0006840 | Ga0495634_0006840_1104_1367 | 87 |
| 208 | 3300046642 | Ga0495634_0043009 | Ga0495634_0043009_1412_1687 | 87 |
| 209 | 3300046660 | Ga0495625_0231896 | Ga0495625_0231896_806_1069 | 87 |
| 210 | 3300046678 | Ga0495599_0393083 | Ga0495599_0393083_271_534 | 87 |
| 211 | 3300046680 | Ga0495646_0168154 | Ga0495646_0168154_386_649 | 87 |
| 212 | 3300046689 | Ga0495613_0878570 | Ga0495613_0878570_231_515 | 87 |
| 213 | 3300047317 | Ga0495604_0002435 | Ga0495604_0002435_10875_11171 | 87 |
| 214 | 3300047319 | Ga0495674_0000039 | Ga0495674_0000039_76323_76586 | 87 |
| 215 | 3300047320 | Ga0495672_0113315 | Ga0495672_0113315_149_412 | 87 |
| 216 | 3300047321 | Ga0495676_0024706 | Ga0495676_0024706_277_540 | 87 |
| 217 | 3300047321 | Ga0495676_0321576 | Ga0495676_0321576_713_997 | 87 |
| 218 | 3300047321 | Ga0495676_0482597 | Ga0495676_0482597_471_746 | 87 |
| 219 | 3300047446 | Ga0495679_195023 | Ga0495679_195023_28_315 | 87 |
| 220 | 3300047471 | Ga0495684_0774835 | Ga0495684_0774835_42_305 | 87 |
| 221 | 3300048903 | Ga0496100_0005897 | Ga0496100_0005897_4847_5131 | 87 |
| 222 | 3300048903 | Ga0496100_0653284 | Ga0496100_0653284_249_539 | 87 |
| 223 | 3300048904 | Ga0496101_0031031 | Ga0496101_0031031_2878_3162 | 87 |
| 224 | 3300048904 | Ga0496101_1034935 | Ga0496101_1034935_215_505 | 87 |
| 225 | 3300048904 | Ga0496101_1585718 | Ga0496101_1585718_24_299 | 87 |
| 226 | 3300048905 | Ga0496102_0006408 | Ga0496102_0006408_3125_3409 | 87 |
| 227 | 3300048905 | Ga0496102_0345906 | Ga0496102_0345906_409_738 | 87 |
| 228 | 3300048905 | Ga0496102_0386579 | Ga0496102_0386579_103_375 | 87 |
| 229 | 3300048906 | Ga0496103_0002557 | Ga0496103_0002557_7095_7379 | 87 |
| 230 | 3300048906 | Ga0496103_0019977 | Ga0496103_0019977_911_1183 | 87 |
| 231 | 3300048906 | Ga0496103_0646180 | Ga0496103_0646180_268_531 | 87 |
| 232 | 3300048907 | Ga0496104_0000008 | Ga0496104_0000008_135364_135660 | 87 |
| 233 | 3300048907 | Ga0496104_0000010 | Ga0496104_0000010_229166_229429 | 87 |
| 234 | 3300048907 | Ga0496104_0030394 | Ga0496104_0030394_4266_4550 | 87 |
| 235 | 3300048908 | Ga0496105_0000003 | Ga0496105_0000003_135364_135660 | 87 |
| 236 | 3300048908 | Ga0496105_0000005 | Ga0496105_0000005_229166_229429 | 87 |
| 237 | 3300048908 | Ga0496105_0000051 | Ga0496105_0000051_53083_53400 | 87 |
| 238 | 3300048908 | Ga0496105_0014615 | Ga0496105_0014615_2279_2563 | 87 |
| 239 | 3300048909 | Ga0496106_0006957 | Ga0496106_0006957_1747_2031 | 87 |
| 240 | 3300048909 | Ga0496106_0250048 | Ga0496106_0250048_20_310 | 87 |
| 241 | 3300048910 | Ga0496107_0035366 | Ga0496107_0035366_689_973 | 87 |
| 242 | 3300048910 | Ga0496107_0304548 | Ga0496107_0304548_614_943 | 87 |
| 243 | 3300048910 | Ga0496107_0484861 | Ga0496107_0484861_328_618 | 87 |
| 244 | 3300048911 | Ga0496108_0001876 | Ga0496108_0001876_3875_4159 | 87 |
| 245 | 3300048911 | Ga0496108_0475090 | Ga0496108_0475090_140_415 | 87 |
| 246 | 3300048912 | Ga0496109_0004919 | Ga0496109_0004919_7482_7766 | 87 |
| 247 | 3300048912 | Ga0496109_0276777 | Ga0496109_0276777_729_1013 | 87 |
| 248 | 3300048912 | Ga0496109_0429519 | Ga0496109_0429519_851_1126 | 87 |
| 249 | 3300048912 | Ga0496109_0792942 | Ga0496109_0792942_445_708 | 87 |
| 250 | 3300048913 | Ga0496110_0041398 | Ga0496110_0041398_2915_3199 | 87 |
| 251 | 3300048913 | Ga0496110_0067877 | Ga0496110_0067877_697_987 | 87 |
| 252 | 3300048913 | Ga0496110_0793382 | Ga0496110_0793382_167_430 | 87 |
| 253 | 3300048914 | Ga0496111_0034373 | Ga0496111_0034373_1416_1700 | 87 |
| 254 | 3300048914 | Ga0496111_0041144 | Ga0496111_0041144_1968_2297 | 87 |
| 255 | 3300048915 | Ga0496112_0033120 | Ga0496112_0033120_2137_2421 | 87 |
| 256 | 3300048915 | Ga0496112_0621871 | Ga0496112_0621871_666_941 | 87 |
| 257 | 3300048916 | Ga0496113_0020317 | Ga0496113_0020317_2216_2491 | 87 |
| 258 | 3300048916 | Ga0496113_0066925 | Ga0496113_0066925_266_550 | 87 |
| 259 | 3300048916 | Ga0496113_0611852 | Ga0496113_0611852_134_424 | 87 |
| 260 | 3300048917 | Ga0496114_0000003 | Ga0496114_0000003_480514_480777 | 87 |
| 261 | 3300048917 | Ga0496114_0005733 | Ga0496114_0005733_6478_6762 | 87 |
| 262 | 3300048917 | Ga0496114_0915616 | Ga0496114_0915616_101_397 | 87 |
| 263 | 3300048918 | Ga0496115_0000827 | Ga0496115_0000827_15793_16056 | 87 |
| 264 | 3300048918 | Ga0496115_0023855 | Ga0496115_0023855_1866_2150 | 87 |
| 265 | 3300048919 | Ga0496116_0143191 | Ga0496116_0143191_719_991 | 87 |
| 266 | 3300048922 | Ga0496119_0016268 | Ga0496119_0016268_476_739 | 87 |
| 267 | 3300049575 | Ga0501039_0553574 | Ga0501039_0553574_540_803 | 87 |
| 268 | 3300049576 | Ga0501040_0189087 | Ga0501040_0189087_490_765 | 87 |
| 269 | 3300049576 | Ga0501040_0245629 | Ga0501040_0245629_705_968 | 87 |
| 270 | 3300049578 | Ga0501042_0520677 | Ga0501042_0520677_156_419 | 87 |
| 271 | 3300049578 | Ga0501042_0684060 | Ga0501042_0684060_175_450 | 87 |
| 272 | 3300049583 | Ga0501067_0790637 | Ga0501067_0790637_164_439 | 87 |
| 273 | 3300049586 | Ga0501070_0591071 | Ga0501070_0591071_585_848 | 87 |
| 274 | 3300049587 | Ga0501071_0762503 | Ga0501071_0762503_31_297 | 87 |
| 275 | 3300049587 | Ga0501071_1221382 | Ga0501071_1221382_156_419 | 87 |
| 276 | 3300049587 | Ga0501071_1476336 | Ga0501071_1476336_12_323 | 87 |
| 277 | 3300049588 | Ga0501072_0135569 | Ga0501072_0135569_952_1215 | 87 |
| 278 | 3300049588 | Ga0501072_0779652 | Ga0501072_0779652_212_478 | 87 |
| 279 | 3300049590 | Ga0501074_1297586 | Ga0501074_1297586_140_415 | 87 |
| 280 | 3300049591 | Ga0501075_0669999 | Ga0501075_0669999_102_365 | 87 |
| 281 | 3300049591 | Ga0501075_1234404 | Ga0501075_1234404_280_555 | 87 |
| 282 | 3300049592 | Ga0501076_1711234 | Ga0501076_1711234_207_482 | 87 |
| 283 | 3300049741 | Ga0501079_0831966 | Ga0501079_0831966_93_368 | 87 |
| 284 | 3300049741 | Ga0501079_1279743 | Ga0501079_1279743_111_374 | 87 |
| 285 | 3300049743 | Ga0501081_0533386 | Ga0501081_0533386_306_581 | 87 |
| 286 | 3300049744 | Ga0501083_0213859 | Ga0501083_0213859_509_772 | 87 |
| 287 | 3300049824 | Ga0501045_0184182 | Ga0501045_0184182_682_945 | 87 |
| 288 | 3300050491 | nmdc:mga00v17_142628_c1 | nmdc:mga00v17_142628_c1_515_793 | 87 |
| 289 | 3300050491 | nmdc:mga00v17_179397_c1 | nmdc:mga00v17_179397_c1_750_1028 | 87 |
| 290 | 3300050492 | nmdc:mga0yw44_104282_c1 | nmdc:mga0yw44_104282_c1_398_676 | 87 |
| 291 | 3300050492 | nmdc:mga0yw44_1187563_c1 | nmdc:mga0yw44_1187563_c1_78_377 | 87 |
| 292 | 3300050507 | nmdc:mga05p37_349409_c1 | nmdc:mga05p37_349409_c1_1061_1384 | 87 |
| 293 | 3300050507 | nmdc:mga05p37_44576_c1 | nmdc:mga05p37_44576_c1_1185_1460 | 87 |
| 294 | 3300050508 | nmdc:mga09592_279686_c1 | nmdc:mga09592_279686_c1_213_506 | 87 |
| 295 | 3300050509 | nmdc:mga0qj67_98783_c1 | nmdc:mga0qj67_98783_c1_1988_2281 | 87 |
| 296 | 3300050510 | nmdc:mga06r32_35823_c1 | nmdc:mga06r32_35823_c1_3389_3682 | 87 |
| 297 | 3300050510 | nmdc:mga06r32_55724_c1 | nmdc:mga06r32_55724_c1_2813_3142 | 87 |
| 298 | 3300050511 | nmdc:mga08y16_1508664_c1 | nmdc:mga08y16_1508664_c1_220_489 | 87 |
| 299 | 3300050511 | nmdc:mga08y16_1762263_c1 | nmdc:mga08y16_1762263_c1_45_374 | 87 |
| 300 | 3300050511 | nmdc:mga08y16_462111_c1 | nmdc:mga08y16_462111_c1_962_1246 | 87 |
| 301 | 3300050511 | nmdc:mga08y16_644304_c1 | nmdc:mga08y16_644304_c1_471_746 | 87 |
| 302 | 3300053077 | Ga0495601_0578731 | Ga0495601_0578731_202_465 | 87 |
| 303 | 3300053085 | Ga0495619_0267981 | Ga0495619_0267981_686_949 | 87 |
| 304 | 3300053096 | Ga0500641_0001015 | Ga0500641_0001015_9364_9627 | 87 |
| 305 | 3300053102 | Ga0500554_210911 | Ga0500554_210911_208_492 | 87 |
| 306 | 3300054114 | Ga0501084_0234289 | Ga0501084_0234289_459_722 | 87 |
| 307 | 3300060353 | Ga0501082_0132931 | Ga0501082_0132931_275_550 | 87 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar