F399340

General Info

Members Datasets Scaffolds Average Seq Length
307 185 307 92

Family's Representative Sequence

Representative Sequence 3300046516|Ga0495628_0271195|Ga0495628_0271195_506_802
Length 88
Sequence MCRTSLLVFSAVNAKQLYRMRAPASGREALAYAEPGSVYIDRETDEEMAPVAMVLPLPENLRACSRCDQLIGLDVSDCPYCGLRQTAL

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
85 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
88 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
89 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
90 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
91 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
92 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
93 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
94 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
95 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
96 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
97 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
98 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
99 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
105 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
106 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
107 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
108 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
109 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
110 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
111 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
112 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
113 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
114 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
115 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
116 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
117 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
118 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
119 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
120 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
121 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
122 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
123 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
124 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
125 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
126 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
127 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
128 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
129 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
130 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
131 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
132 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
133 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
134 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
135 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
136 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
137 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
138 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
139 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
140 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
141 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
142 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
147 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
148 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
158 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
159 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
163 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
164 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
165 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
166 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
167 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
168 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
169 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
170 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
171 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
172 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
173 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
174 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
175 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
176 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
177 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
178 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
179 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
180 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
181 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
182 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
183 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
184 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
185 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.58
Nodule 0
Rhizoplane 14.66
Rhizosphere 80.78
Stem 0
Stem Tuber 0
Unclassified 0.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1001545 3300001977 Bacteria 3672
2 JGI25407J50210_10015868 3300003373 Unclassified 1948
3 JGI25407J50210_10099062 3300003373 Unclassified 721
4 Ga0068869_100206795 3300005334 Unclassified 1550
5 Ga0068869_100678467 3300005334 Bacteria 877
6 Ga0070691_10044480 3300005341 Unclassified 2106
7 Ga0070668_100248749 3300005347 Bacteria 1475
8 Ga0070668_101325242 3300005347 Bacteria 655
9 Ga0070674_100045796 3300005356 Bacteria 2989
10 Ga0070667_100001110 3300005367 Bacteria 24556
11 Ga0070713_100339333 3300005436 Unclassified 1392
12 Ga0070700_100012035 3300005441 Bacteria 4809
13 Ga0070708_100342878 3300005445 Bacteria 1408
14 Ga0070681_10013258 3300005458 Bacteria 8190
15 Ga0068867_100384927 3300005459 Bacteria 1179
16 Ga0070699_101225315 3300005518 Bacteria 688
17 Ga0070679_100000424 3300005530 Bacteria 35927
18 Ga0070684_100014534 3300005535 Bacteria 6381
19 Ga0070686_100011107 3300005544 Bacteria 5102
20 Ga0070695_101042208 3300005545 Bacteria 667
21 Ga0070704_100014164 3300005549 Bacteria 4975
22 Ga0070704_100258280 3300005549 Bacteria 1434
23 Ga0068855_101714967 3300005563 Unclassified 640
24 Ga0070664_100706760 3300005564 Unclassified 939
25 Ga0068854_100042127 3300005578 Bacteria 3230
26 Ga0068854_101825343 3300005578 Bacteria 558
27 Ga0070702_101344207 3300005615 Bacteria 582
28 Ga0068859_100222554 3300005617 Bacteria 1975
29 Ga0068861_100228683 3300005719 Bacteria 1576
30 Ga0068861_101315651 3300005719 Bacteria 703
31 Ga0068863_100000261 3300005841 Bacteria 55053
32 Ga0068858_100065985 3300005842 Bacteria 3350
33 Ga0068858_100202992 3300005842 Bacteria 1875
34 Ga0068860_100200823 3300005843 Bacteria 1932
35 Ga0068862_100002784 3300005844 Bacteria 15326
36 Ga0081455_10004942 3300005937 Bacteria 14737
37 Ga0081455_10017101 3300005937 Bacteria 6968
38 Ga0081455_10027981 3300005937 Bacteria 5156
39 Ga0081455_10046986 3300005937 Bacteria 3741
40 Ga0081455_10093809 3300005937 Bacteria 2426
41 Ga0081455_10155189 3300005937 Bacteria 1760
42 Ga0081455_10520921 3300005937 Bacteria 793
43 Ga0081455_10747408 3300005937 Bacteria 618
44 Ga0081538_10000609 3300005981 Bacteria 39610
45 Ga0081538_10005104 3300005981 Bacteria 11923
46 Ga0081538_10097518 3300005981 Bacteria 1493
47 Ga0081538_10099915 3300005981 Unclassified 1465
48 Ga0081540_1000868 3300005983 Bacteria 27372
49 Ga0081540_1001098 3300005983 Bacteria 23963
50 Ga0081540_1067368 3300005983 Bacteria 1673
51 Ga0081539_10038119 3300005985 Unclassified 2852
52 Ga0075365_10138220 3300006038 Bacteria 1690
53 Ga0075365_11276139 3300006038 Bacteria 516
54 Ga0075364_10117024 3300006051 Bacteria 1782
55 Ga0075364_10325904 3300006051 Bacteria 1046
56 Ga0070716_100148849 3300006173 Bacteria 1503
57 Ga0070716_101032604 3300006173 Bacteria 652
58 Ga0070712_100004572 3300006175 Bacteria 8544
59 Ga0075367_10207821 3300006178 Unclassified 1224
60 Ga0075428_100059150 3300006844 Bacteria 4196
61 Ga0075430_100006738 3300006846 Bacteria 9687
62 Ga0075430_101201448 3300006846 Bacteria 624
63 Ga0075431_100031941 3300006847 Bacteria 5424
64 Ga0075431_100032007 3300006847 Bacteria 5420
65 Ga0075433_10005003 3300006852 Bacteria 10383
66 Ga0075434_100862125 3300006871 Unclassified 921
67 Ga0075429_100272328 3300006880 Bacteria 1483
68 Ga0068865_100284686 3300006881 Bacteria 1317
69 Ga0068865_101396970 3300006881 Unclassified 625
70 Ga0068865_102114560 3300006881 Bacteria 512
71 Ga0097620_100222546 3300006931 Bacteria 1975
72 Ga0111539_10736271 3300009094 Bacteria 1148
73 Ga0111539_11752893 3300009094 Bacteria 720
74 Ga0111539_12681734 3300009094 Bacteria 578
75 Ga0105245_10003299 3300009098 Bacteria 14489
76 Ga0105245_11916556 3300009098 Bacteria 646
77 Ga0105245_12102627 3300009098 Bacteria 618
78 Ga0105247_10080024 3300009101 Bacteria 2057
79 Ga0105247_10158176 3300009101 Bacteria 1498
80 Ga0114129_10497973 3300009147 Bacteria 1592
81 Ga0114129_10982604 3300009147 Bacteria 1064
82 Ga0114129_12746815 3300009147 Bacteria 586
83 Ga0105243_10741486 3300009148 Bacteria 962
84 Ga0105243_12641548 3300009148 Bacteria 542
85 Ga0105242_10000378 3300009176 Bacteria 35439
86 Ga0105242_10375574 3300009176 Bacteria 1320
87 Ga0105242_12417317 3300009176 Bacteria 573
88 Ga0105248_11041475 3300009177 Bacteria 924
89 Ga0105249_10002088 3300009553 Bacteria 17318
90 Ga0105249_10381425 3300009553 Bacteria 1436
91 Ga0105249_10631398 3300009553 Bacteria 1128
92 Ga0105239_11233925 3300010375 Unclassified 862
93 Ga0105239_11323190 3300010375 Bacteria 831
94 Ga0105239_11458791 3300010375 Bacteria 790
95 Ga0105246_10249181 3300011119 Bacteria 1409
96 Ga0105246_10747627 3300011119 Bacteria 862
97 Ga0157370_11030940 3300013104 Unclassified 744
98 Ga0157374_10001797 3300013296 Bacteria 18046
99 Ga0157374_10058364 3300013296 Bacteria 3606
100 Ga0157374_12518328 3300013296 Bacteria 542
101 Ga0157378_10557571 3300013297 Unclassified 1152
102 Ga0163162_10117522 3300013306 Bacteria 2761
103 Ga0163162_11482622 3300013306 Bacteria 773
104 Ga0157372_11102419 3300013307 Bacteria 918
105 Ga0157375_10149963 3300013308 Bacteria 2466
106 Ga0163163_10677032 3300014325 Bacteria 1095
107 Ga0157380_10001943 3300014326 Bacteria 13750
108 Ga0157377_10234865 3300014745 Bacteria 1181
109 Ga0157377_10284339 3300014745 Bacteria 1085
110 Ga0157379_10015110 3300014968 Bacteria 6771
111 Ga0157379_10018096 3300014968 Bacteria 6209
112 Ga0157379_10082060 3300014968 Bacteria 2889
113 Ga0157376_12873893 3300014969 Unclassified 521
114 Ga0163161_11463001 3300017792 Bacteria 598
115 Ga0207693_10006358 3300025915 Bacteria 9789
116 Ga0207663_10045264 3300025916 Bacteria 2706
117 Ga0207681_10452419 3300025923 Bacteria 1045
118 Ga0207706_10733058 3300025933 Bacteria 843
119 Ga0207686_10017669 3300025934 Bacteria 4022
120 Ga0207704_10128086 3300025938 Bacteria 1752
121 Ga0207704_11224691 3300025938 Unclassified 640
122 Ga0207667_11888079 3300025949 Unclassified 560
123 Ga0207712_10015646 3300025961 Bacteria 4897
124 Ga0207712_10394452 3300025961 Bacteria 1162
125 Ga0207668_10008828 3300025972 Bacteria 6024
126 Ga0207640_10489394 3300025981 Bacteria 1022
127 Ga0207658_10001811 3300025986 Bacteria 15995
128 Ga0207703_10025893 3300026035 Bacteria 4616
129 Ga0207703_10171531 3300026035 Bacteria 1908
130 Ga0207678_10089693 3300026067 Unclassified 2628
131 Ga0207708_11197788 3300026075 Bacteria 664
132 Ga0207675_101162447 3300026118 Bacteria 792
133 Ga0207683_10152605 3300026121 Bacteria 2085
134 Ga0207428_10876234 3300027907 Bacteria 635
135 Ga0268265_10001768 3300028380 Bacteria 17341
136 Ga0268264_10101700 3300028381 Bacteria 2499
137 Ga0265319_1000010 3300028563 Bacteria 188773
138 Ga0265336_10048923 3300028666 Unclassified 1281
139 Ga0265338_10000287 3300028800 Bacteria 90818
140 Ga0265332_10050794 3300031238 Bacteria 1782
141 Ga0265325_10402566 3300031241 Bacteria 599
142 Ga0307410_10071518 3300031852 Bacteria 2406
143 Ga0307406_11516340 3300031901 Bacteria 590
144 Ga0307409_100120574 3300031995 Bacteria 2220
145 Ga0307409_100890315 3300031995 Bacteria 903
146 Ga0307409_101823568 3300031995 Bacteria 637
147 Ga0307416_101084579 3300032002 Bacteria 905
148 Ga0307416_102803438 3300032002 Bacteria 583
149 Ga0307415_100541378 3300032126 Bacteria 1026
150 Ga0373952_0242651 3300035092 Bacteria 543
151 Ga0373961_0129330 3300035241 Bacteria 844
152 Ga0373937_0395072 3300036401 Bacteria 1312
153 Ga0373925_1576080 3300037068 Unclassified 537
154 Ga0395899_0634393 3300037312 Unclassified 677
155 Ga0395899_0908091 3300037312 Unclassified 537
156 Ga0395900_0361067 3300037418 Bacteria 1424
157 Ga0395900_0362758 3300037418 Bacteria 1420
158 Ga0395900_0424601 3300037418 Bacteria 1290
159 Ga0395900_0467156 3300037418 Bacteria 1216
160 Ga0395900_0627745 3300037418 Unclassified 1013
161 Ga0395900_0953454 3300037418 Unclassified 779
162 Ga0395898_0023186 3300037466 Bacteria 6274
163 Ga0395898_0030992 3300037466 Bacteria 5348
164 Ga0395898_0035266 3300037466 Bacteria 4977
165 Ga0395898_0265786 3300037466 Unclassified 1636
166 Ga0395898_1611493 3300037466 Bacteria 573
167 Ga0395898_1955002 3300037466 Unclassified 506
168 Ga0395905_0146108 3300037471 Bacteria 2225
169 Ga0395905_0146499 3300037471 Bacteria 2222
170 Ga0395905_0264930 3300037471 Unclassified 1604
171 Ga0395905_0331337 3300037471 Bacteria 1413
172 Ga0395905_1188084 3300037471 Bacteria 666
173 Ga0395901_0014051 3300038443 Bacteria 8150
174 Ga0395901_0131936 3300038443 Bacteria 2625
175 Ga0395901_0173224 3300038443 Bacteria 2264
176 Ga0395901_1194139 3300038443 Unclassified 727
177 Ga0395901_1250523 3300038443 Bacteria 706
178 Ga0395901_1533777 3300038443 Bacteria 621
179 Ga0436365_0794302 3300039437 Unclassified 674
180 Ga0451804_0210505 3300041463 Unclassified 614
181 Ga0439451_136288 3300042009 Unclassified 502
182 Ga0466967_0690272 3300045976 Bacteria 1011
183 Ga0495592_0141460 3300046454 Bacteria 1673
184 Ga0495641_0017169 3300046461 Bacteria 3781
185 Ga0495641_0272285 3300046461 Bacteria 762
186 Ga0495651_0242006 3300046462 Bacteria 1237
187 Ga0495662_0000069 3300046476 Bacteria 36219
188 Ga0495584_0097406 3300046491 Bacteria 1486
189 Ga0495585_0413110 3300046492 Bacteria 649
190 Ga0495594_0000009 3300046499 Bacteria 122139
191 Ga0495596_0163133 3300046500 Bacteria 866
192 Ga0495616_0274562 3300046513 Unclassified 718
193 Ga0495618_0541920 3300046514 Unclassified 697
194 Ga0495628_0129994 3300046516 Unclassified 1927
195 Ga0495628_0271195 3300046516 Bacteria 1262
196 Ga0495628_0283000 3300046516 Bacteria 1231
197 Ga0495644_0091687 3300046523 Unclassified 1147
198 Ga0495652_0060643 3300046529 Bacteria 3196
199 Ga0495587_0683876 3300046536 Unclassified 563
200 Ga0495609_0444802 3300046538 Unclassified 515
201 Ga0495645_0356298 3300046543 Bacteria 941
202 Ga0495622_0000097 3300046557 Bacteria 76953
203 Ga0495667_0144219 3300046559 Bacteria 1534
204 Ga0495656_0154579 3300046615 Bacteria 1110
205 Ga0495656_0348577 3300046615 Bacteria 767
206 Ga0495668_0224816 3300046616 Bacteria 1028
207 Ga0495634_0006840 3300046642 Bacteria 8627
208 Ga0495634_0043009 3300046642 Bacteria 3062
209 Ga0495625_0231896 3300046660 Unclassified 1205
210 Ga0495599_0393083 3300046678 Bacteria 826
211 Ga0495646_0168154 3300046680 Bacteria 1210
212 Ga0495613_0878570 3300046689 Unclassified 581
213 Ga0495604_0002435 3300047317 Bacteria 14888
214 Ga0495674_0000039 3300047319 Bacteria 97645
215 Ga0495672_0113315 3300047320 Bacteria 1452
216 Ga0495676_0024706 3300047321 Bacteria 5195
217 Ga0495676_0321576 3300047321 Bacteria 1039
218 Ga0495676_0482597 3300047321 Unclassified 815
219 Ga0495679_195023 3300047446 Bacteria 534
220 Ga0495684_0774835 3300047471 Unclassified 629
221 Ga0496100_0005897 3300048903 Bacteria 6637
222 Ga0496100_0653284 3300048903 Unclassified 819
223 Ga0496101_0031031 3300048904 Bacteria 3753
224 Ga0496101_1034935 3300048904 Unclassified 645
225 Ga0496101_1585718 3300048904 Bacteria 509
226 Ga0496102_0006408 3300048905 Bacteria 10034
227 Ga0496102_0345906 3300048905 Bacteria 1400
228 Ga0496102_0386579 3300048905 Bacteria 1317
229 Ga0496103_0002557 3300048906 Bacteria 11401
230 Ga0496103_0019977 3300048906 Bacteria 4023
231 Ga0496103_0646180 3300048906 Bacteria 672
232 Ga0496104_0000008 3300048907 Bacteria 516976
233 Ga0496104_0000010 3300048907 Bacteria 475255
234 Ga0496104_0030394 3300048907 Bacteria 5019
235 Ga0496105_0000003 3300048908 Bacteria 713251
236 Ga0496105_0000005 3300048908 Bacteria 475797
237 Ga0496105_0000051 3300048908 Bacteria 90365
238 Ga0496105_0014615 3300048908 Bacteria 6251
239 Ga0496106_0006957 3300048909 Bacteria 8363
240 Ga0496106_0250048 3300048909 Unclassified 1417
241 Ga0496107_0035366 3300048910 Bacteria 3581
242 Ga0496107_0304548 3300048910 Bacteria 1186
243 Ga0496107_0484861 3300048910 Unclassified 917
244 Ga0496108_0001876 3300048911 Bacteria 16829
245 Ga0496108_0475090 3300048911 Bacteria 1092
246 Ga0496109_0004919 3300048912 Bacteria 11154
247 Ga0496109_0276777 3300048912 Bacteria 1581
248 Ga0496109_0429519 3300048912 Bacteria 1248
249 Ga0496109_0792942 3300048912 Bacteria 885
250 Ga0496110_0041398 3300048913 Bacteria 4019
251 Ga0496110_0067877 3300048913 Unclassified 3156
252 Ga0496110_0793382 3300048913 Bacteria 851
253 Ga0496111_0034373 3300048914 Bacteria 3619
254 Ga0496111_0041144 3300048914 Bacteria 3316
255 Ga0496112_0033120 3300048915 Bacteria 5020
256 Ga0496112_0621871 3300048915 Bacteria 1011
257 Ga0496113_0020317 3300048916 Bacteria 4667
258 Ga0496113_0066925 3300048916 Bacteria 2722
259 Ga0496113_0611852 3300048916 Unclassified 872
260 Ga0496114_0000003 3300048917 Bacteria 630981
261 Ga0496114_0005733 3300048917 Bacteria 9747
262 Ga0496114_0915616 3300048917 Bacteria 758
263 Ga0496115_0000827 3300048918 Bacteria 22678
264 Ga0496115_0023855 3300048918 Bacteria 4750
265 Ga0496116_0143191 3300048919 Bacteria 1341
266 Ga0496119_0016268 3300048922 Bacteria 5671
267 Ga0501039_0553574 3300049575 Bacteria 902
268 Ga0501040_0189087 3300049576 Bacteria 1461
269 Ga0501040_0245629 3300049576 Bacteria 1276
270 Ga0501042_0520677 3300049578 Unclassified 864
271 Ga0501042_0684060 3300049578 Bacteria 746
272 Ga0501067_0790637 3300049583 Bacteria 534
273 Ga0501070_0591071 3300049586 Bacteria 885
274 Ga0501071_0762503 3300049587 Bacteria 746
275 Ga0501071_1221382 3300049587 Unclassified 581
276 Ga0501071_1476336 3300049587 Bacteria 525
277 Ga0501072_0135569 3300049588 Bacteria 1963
278 Ga0501072_0779652 3300049588 Unclassified 749
279 Ga0501074_1297586 3300049590 Unclassified 510
280 Ga0501075_0669999 3300049591 Unclassified 791
281 Ga0501075_1234404 3300049591 Unclassified 567
282 Ga0501076_1711234 3300049592 Bacteria 516
283 Ga0501079_0831966 3300049741 Bacteria 727
284 Ga0501079_1279743 3300049741 Bacteria 577
285 Ga0501081_0533386 3300049743 Unclassified 876
286 Ga0501083_0213859 3300049744 Bacteria 1257
287 Ga0501045_0184182 3300049824 Bacteria 1556
288 nmdc:mga00v17_142628_c1 3300050491 Bacteria 1536
289 nmdc:mga00v17_179397_c1 3300050491 Bacteria 1366
290 nmdc:mga0yw44_104282_c1 3300050492 Bacteria 1810
291 nmdc:mga0yw44_1187563_c1 3300050492 Bacteria 515
292 nmdc:mga05p37_349409_c1 3300050507 Bacteria 1741
293 nmdc:mga05p37_44576_c1 3300050507 Bacteria 5456
294 nmdc:mga09592_279686_c1 3300050508 Bacteria 1447
295 nmdc:mga0qj67_98783_c1 3300050509 Bacteria 2352
296 nmdc:mga06r32_35823_c1 3300050510 Bacteria 4683
297 nmdc:mga06r32_55724_c1 3300050510 Bacteria 3793
298 nmdc:mga08y16_1508664_c1 3300050511 Bacteria 632
299 nmdc:mga08y16_1762263_c1 3300050511 Bacteria 573
300 nmdc:mga08y16_462111_c1 3300050511 Bacteria 1293
301 nmdc:mga08y16_644304_c1 3300050511 Bacteria 1064
302 Ga0495601_0578731 3300053077 Bacteria 721
303 Ga0495619_0267981 3300053085 Archaea 1184
304 Ga0500641_0001015 3300053096 Bacteria 9981
305 Ga0500554_210911 3300053102 Unclassified 648
306 Ga0501084_0234289 3300054114 Bacteria 1550
307 Ga0501082_0132931 3300060353 Bacteria 2159

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046516 Ga0495628_0271195 Ga0495628_0271195_506_802 77
2 3300001977 JGI24746J21847_1001545 JGI24746J21847_10015452 87
3 3300003373 JGI25407J50210_10015868 JGI25407J50210_100158682 87
4 3300003373 JGI25407J50210_10099062 JGI25407J50210_100990621 87
5 3300005334 Ga0068869_100206795 Ga0068869_1002067952 87
6 3300005334 Ga0068869_100678467 Ga0068869_1006784671 87
7 3300005341 Ga0070691_10044480 Ga0070691_100444802 87
8 3300005347 Ga0070668_100248749 Ga0070668_1002487491 87
9 3300005347 Ga0070668_101325242 Ga0070668_1013252421 87
10 3300005356 Ga0070674_100045796 Ga0070674_1000457962 87
11 3300005367 Ga0070667_100001110 Ga0070667_10000111011 87
12 3300005436 Ga0070713_100339333 Ga0070713_1003393331 87
13 3300005441 Ga0070700_100012035 Ga0070700_1000120354 87
14 3300005445 Ga0070708_100342878 Ga0070708_1003428781 87
15 3300005458 Ga0070681_10013258 Ga0070681_100132582 87
16 3300005459 Ga0068867_100384927 Ga0068867_1003849271 87
17 3300005518 Ga0070699_101225315 Ga0070699_1012253152 87
18 3300005530 Ga0070679_100000424 Ga0070679_1000004244 87
19 3300005535 Ga0070684_100014534 Ga0070684_1000145349 87
20 3300005544 Ga0070686_100011107 Ga0070686_1000111074 87
21 3300005545 Ga0070695_101042208 Ga0070695_1010422082 87
22 3300005549 Ga0070704_100014164 Ga0070704_1000141644 87
23 3300005549 Ga0070704_100258280 Ga0070704_1002582802 87
24 3300005563 Ga0068855_101714967 Ga0068855_1017149672 87
25 3300005564 Ga0070664_100706760 Ga0070664_1007067602 87
26 3300005578 Ga0068854_100042127 Ga0068854_1000421272 87
27 3300005578 Ga0068854_101825343 Ga0068854_1018253431 87
28 3300005615 Ga0070702_101344207 Ga0070702_1013442071 87
29 3300005617 Ga0068859_100222554 Ga0068859_1002225543 87
30 3300005719 Ga0068861_100228683 Ga0068861_1002286831 87
31 3300005719 Ga0068861_101315651 Ga0068861_1013156512 87
32 3300005841 Ga0068863_100000261 Ga0068863_10000026127 87
33 3300005842 Ga0068858_100065985 Ga0068858_1000659855 87
34 3300005842 Ga0068858_100202992 Ga0068858_1002029922 87
35 3300005843 Ga0068860_100200823 Ga0068860_1002008232 87
36 3300005844 Ga0068862_100002784 Ga0068862_10000278411 87
37 3300005937 Ga0081455_10004942 Ga0081455_1000494215 87
38 3300005937 Ga0081455_10017101 Ga0081455_100171019 87
39 3300005937 Ga0081455_10027981 Ga0081455_100279812 87
40 3300005937 Ga0081455_10046986 Ga0081455_100469864 87
41 3300005937 Ga0081455_10093809 Ga0081455_100938095 87
42 3300005937 Ga0081455_10155189 Ga0081455_101551892 87
43 3300005937 Ga0081455_10520921 Ga0081455_105209212 87
44 3300005937 Ga0081455_10747408 Ga0081455_107474082 87
45 3300005981 Ga0081538_10000609 Ga0081538_100006098 87
46 3300005981 Ga0081538_10005104 Ga0081538_100051046 87
47 3300005981 Ga0081538_10097518 Ga0081538_100975182 87
48 3300005981 Ga0081538_10099915 Ga0081538_100999152 87
49 3300005983 Ga0081540_1000868 Ga0081540_10008682 87
50 3300005983 Ga0081540_1001098 Ga0081540_100109817 87
51 3300005983 Ga0081540_1067368 Ga0081540_10673682 87
52 3300005985 Ga0081539_10038119 Ga0081539_100381192 87
53 3300006038 Ga0075365_10138220 Ga0075365_101382202 87
54 3300006038 Ga0075365_11276139 Ga0075365_112761392 87
55 3300006051 Ga0075364_10117024 Ga0075364_101170244 87
56 3300006051 Ga0075364_10325904 Ga0075364_103259042 87
57 3300006173 Ga0070716_100148849 Ga0070716_1001488492 87
58 3300006173 Ga0070716_101032604 Ga0070716_1010326042 87
59 3300006175 Ga0070712_100004572 Ga0070712_1000045724 87
60 3300006178 Ga0075367_10207821 Ga0075367_102078212 87
61 3300006844 Ga0075428_100059150 Ga0075428_1000591502 87
62 3300006846 Ga0075430_100006738 Ga0075430_10000673811 87
63 3300006846 Ga0075430_101201448 Ga0075430_1012014482 87
64 3300006847 Ga0075431_100031941 Ga0075431_1000319416 87
65 3300006847 Ga0075431_100032007 Ga0075431_1000320076 87
66 3300006852 Ga0075433_10005003 Ga0075433_100050038 87
67 3300006871 Ga0075434_100862125 Ga0075434_1008621252 87
68 3300006880 Ga0075429_100272328 Ga0075429_1002723282 87
69 3300006881 Ga0068865_100284686 Ga0068865_1002846862 87
70 3300006881 Ga0068865_101396970 Ga0068865_1013969702 87
71 3300006881 Ga0068865_102114560 Ga0068865_1021145602 87
72 3300006931 Ga0097620_100222546 Ga0097620_1002225463 87
73 3300009094 Ga0111539_10736271 Ga0111539_107362712 87
74 3300009094 Ga0111539_11752893 Ga0111539_117528932 87
75 3300009094 Ga0111539_12681734 Ga0111539_126817341 87
76 3300009098 Ga0105245_10003299 Ga0105245_100032997 87
77 3300009098 Ga0105245_11916556 Ga0105245_119165562 87
78 3300009098 Ga0105245_12102627 Ga0105245_121026272 87
79 3300009101 Ga0105247_10080024 Ga0105247_100800242 87
80 3300009101 Ga0105247_10158176 Ga0105247_101581762 87
81 3300009147 Ga0114129_10497973 Ga0114129_104979733 87
82 3300009147 Ga0114129_10982604 Ga0114129_109826042 87
83 3300009147 Ga0114129_12746815 Ga0114129_127468152 87
84 3300009148 Ga0105243_10741486 Ga0105243_107414862 87
85 3300009148 Ga0105243_12641548 Ga0105243_126415481 87
86 3300009176 Ga0105242_10000378 Ga0105242_1000037839 87
87 3300009176 Ga0105242_10375574 Ga0105242_103755743 87
88 3300009176 Ga0105242_12417317 Ga0105242_124173172 87
89 3300009177 Ga0105248_11041475 Ga0105248_110414752 87
90 3300009553 Ga0105249_10002088 Ga0105249_100020882 87
91 3300009553 Ga0105249_10381425 Ga0105249_103814251 87
92 3300009553 Ga0105249_10631398 Ga0105249_106313981 87
93 3300010375 Ga0105239_11233925 Ga0105239_112339251 87
94 3300010375 Ga0105239_11323190 Ga0105239_113231902 87
95 3300010375 Ga0105239_11458791 Ga0105239_114587912 87
96 3300011119 Ga0105246_10249181 Ga0105246_102491812 87
97 3300011119 Ga0105246_10747627 Ga0105246_107476272 87
98 3300013104 Ga0157370_11030940 Ga0157370_110309402 87
99 3300013296 Ga0157374_10001797 Ga0157374_100017974 87
100 3300013296 Ga0157374_10058364 Ga0157374_100583642 87
101 3300013296 Ga0157374_12518328 Ga0157374_125183282 87
102 3300013297 Ga0157378_10557571 Ga0157378_105575712 87
103 3300013306 Ga0163162_10117522 Ga0163162_101175223 87
104 3300013306 Ga0163162_11482622 Ga0163162_114826222 87
105 3300013307 Ga0157372_11102419 Ga0157372_111024192 87
106 3300013308 Ga0157375_10149963 Ga0157375_101499633 87
107 3300014325 Ga0163163_10677032 Ga0163163_106770322 87
108 3300014326 Ga0157380_10001943 Ga0157380_100019434 87
109 3300014745 Ga0157377_10234865 Ga0157377_102348652 87
110 3300014745 Ga0157377_10284339 Ga0157377_102843391 87
111 3300014968 Ga0157379_10015110 Ga0157379_100151104 87
112 3300014968 Ga0157379_10018096 Ga0157379_100180964 87
113 3300014968 Ga0157379_10082060 Ga0157379_100820601 87
114 3300014969 Ga0157376_12873893 Ga0157376_128738931 87
115 3300017792 Ga0163161_11463001 Ga0163161_114630012 87
116 3300025915 Ga0207693_10006358 Ga0207693_100063588 87
117 3300025916 Ga0207663_10045264 Ga0207663_100452642 87
118 3300025923 Ga0207681_10452419 Ga0207681_104524191 87
119 3300025933 Ga0207706_10733058 Ga0207706_107330582 87
120 3300025934 Ga0207686_10017669 Ga0207686_100176692 87
121 3300025938 Ga0207704_10128086 Ga0207704_101280862 87
122 3300025938 Ga0207704_11224691 Ga0207704_112246911 87
123 3300025949 Ga0207667_11888079 Ga0207667_118880792 87
124 3300025961 Ga0207712_10015646 Ga0207712_100156465 87
125 3300025961 Ga0207712_10394452 Ga0207712_103944522 87
126 3300025972 Ga0207668_10008828 Ga0207668_100088285 87
127 3300025981 Ga0207640_10489394 Ga0207640_104893942 87
128 3300025986 Ga0207658_10001811 Ga0207658_1000181117 87
129 3300026035 Ga0207703_10025893 Ga0207703_100258932 87
130 3300026035 Ga0207703_10171531 Ga0207703_101715312 87
131 3300026067 Ga0207678_10089693 Ga0207678_100896932 87
132 3300026075 Ga0207708_11197788 Ga0207708_111977882 87
133 3300026118 Ga0207675_101162447 Ga0207675_1011624471 87
134 3300026121 Ga0207683_10152605 Ga0207683_101526052 87
135 3300027907 Ga0207428_10876234 Ga0207428_108762342 87
136 3300028380 Ga0268265_10001768 Ga0268265_1000176814 87
137 3300028381 Ga0268264_10101700 Ga0268264_101017002 87
138 3300028563 Ga0265319_1000010 Ga0265319_100001056 87
139 3300028666 Ga0265336_10048923 Ga0265336_100489232 87
140 3300028800 Ga0265338_10000287 Ga0265338_1000028753 87
141 3300031238 Ga0265332_10050794 Ga0265332_100507942 87
142 3300031241 Ga0265325_10402566 Ga0265325_104025662 87
143 3300031852 Ga0307410_10071518 Ga0307410_100715182 87
144 3300031901 Ga0307406_11516340 Ga0307406_115163402 87
145 3300031995 Ga0307409_100120574 Ga0307409_1001205742 87
146 3300031995 Ga0307409_100890315 Ga0307409_1008903152 87
147 3300031995 Ga0307409_101823568 Ga0307409_1018235682 87
148 3300032002 Ga0307416_101084579 Ga0307416_1010845792 87
149 3300032002 Ga0307416_102803438 Ga0307416_1028034382 87
150 3300032126 Ga0307415_100541378 Ga0307415_1005413782 87
151 3300035092 Ga0373952_0242651 Ga0373952_0242651_90_419 87
152 3300035241 Ga0373961_0129330 Ga0373961_0129330_449_733 87
153 3300036401 Ga0373937_0395072 Ga0373937_0395072_171_434 87
154 3300037068 Ga0373925_1576080 Ga0373925_1576080_156_440 87
155 3300037312 Ga0395899_0634393 Ga0395899_0634393_310_609 87
156 3300037312 Ga0395899_0908091 Ga0395899_0908091_37_324 87
157 3300037418 Ga0395900_0361067 Ga0395900_0361067_42_320 87
158 3300037418 Ga0395900_0362758 Ga0395900_0362758_653_931 87
159 3300037418 Ga0395900_0424601 Ga0395900_0424601_575_850 87
160 3300037418 Ga0395900_0467156 Ga0395900_0467156_349_639 87
161 3300037418 Ga0395900_0627745 Ga0395900_0627745_216_494 87
162 3300037418 Ga0395900_0953454 Ga0395900_0953454_121_399 87
163 3300037466 Ga0395898_0023186 Ga0395898_0023186_2918_3196 87
164 3300037466 Ga0395898_0030992 Ga0395898_0030992_295_573 87
165 3300037466 Ga0395898_0035266 Ga0395898_0035266_4303_4590 87
166 3300037466 Ga0395898_0265786 Ga0395898_0265786_229_507 87
167 3300037466 Ga0395898_1611493 Ga0395898_1611493_198_461 87
168 3300037466 Ga0395898_1955002 Ga0395898_1955002_86_373 87
169 3300037471 Ga0395905_0146108 Ga0395905_0146108_826_1104 87
170 3300037471 Ga0395905_0146499 Ga0395905_0146499_708_1010 87
171 3300037471 Ga0395905_0264930 Ga0395905_0264930_277_555 87
172 3300037471 Ga0395905_0331337 Ga0395905_0331337_320_598 87
173 3300037471 Ga0395905_1188084 Ga0395905_1188084_206_493 87
174 3300038443 Ga0395901_0014051 Ga0395901_0014051_6913_7191 87
175 3300038443 Ga0395901_0131936 Ga0395901_0131936_585_872 87
176 3300038443 Ga0395901_0173224 Ga0395901_0173224_645_923 87
177 3300038443 Ga0395901_1194139 Ga0395901_1194139_270_548 87
178 3300038443 Ga0395901_1250523 Ga0395901_1250523_129_407 87
179 3300038443 Ga0395901_1533777 Ga0395901_1533777_66_344 87
180 3300039437 Ga0436365_0794302 Ga0436365_0794302_83_352 87
181 3300041463 Ga0451804_0210505 Ga0451804_0210505_162_425 87
182 3300042009 Ga0439451_136288 Ga0439451_136288_209_484 87
183 3300045976 Ga0466967_0690272 Ga0466967_0690272_339_605 87
184 3300046454 Ga0495592_0141460 Ga0495592_0141460_235_498 87
185 3300046461 Ga0495641_0017169 Ga0495641_0017169_2690_2953 87
186 3300046461 Ga0495641_0272285 Ga0495641_0272285_455_736 87
187 3300046462 Ga0495651_0242006 Ga0495651_0242006_382_645 87
188 3300046476 Ga0495662_0000069 Ga0495662_0000069_26595_26858 87
189 3300046491 Ga0495584_0097406 Ga0495584_0097406_1001_1276 87
190 3300046492 Ga0495585_0413110 Ga0495585_0413110_331_606 87
191 3300046499 Ga0495594_0000009 Ga0495594_0000009_25689_26003 87
192 3300046500 Ga0495596_0163133 Ga0495596_0163133_106_435 87
193 3300046513 Ga0495616_0274562 Ga0495616_0274562_386_676 87
194 3300046514 Ga0495618_0541920 Ga0495618_0541920_220_513 87
195 3300046516 Ga0495628_0129994 Ga0495628_0129994_1185_1460 87
196 3300046516 Ga0495628_0283000 Ga0495628_0283000_884_1147 87
197 3300046523 Ga0495644_0091687 Ga0495644_0091687_182_472 87
198 3300046529 Ga0495652_0060643 Ga0495652_0060643_2856_3119 87
199 3300046536 Ga0495587_0683876 Ga0495587_0683876_102_365 87
200 3300046538 Ga0495609_0444802 Ga0495609_0444802_122_451 87
201 3300046543 Ga0495645_0356298 Ga0495645_0356298_69_332 87
202 3300046557 Ga0495622_0000097 Ga0495622_0000097_74916_75230 87
203 3300046559 Ga0495667_0144219 Ga0495667_0144219_185_448 87
204 3300046615 Ga0495656_0154579 Ga0495656_0154579_22_315 87
205 3300046615 Ga0495656_0348577 Ga0495656_0348577_300_575 87
206 3300046616 Ga0495668_0224816 Ga0495668_0224816_586_915 87
207 3300046642 Ga0495634_0006840 Ga0495634_0006840_1104_1367 87
208 3300046642 Ga0495634_0043009 Ga0495634_0043009_1412_1687 87
209 3300046660 Ga0495625_0231896 Ga0495625_0231896_806_1069 87
210 3300046678 Ga0495599_0393083 Ga0495599_0393083_271_534 87
211 3300046680 Ga0495646_0168154 Ga0495646_0168154_386_649 87
212 3300046689 Ga0495613_0878570 Ga0495613_0878570_231_515 87
213 3300047317 Ga0495604_0002435 Ga0495604_0002435_10875_11171 87
214 3300047319 Ga0495674_0000039 Ga0495674_0000039_76323_76586 87
215 3300047320 Ga0495672_0113315 Ga0495672_0113315_149_412 87
216 3300047321 Ga0495676_0024706 Ga0495676_0024706_277_540 87
217 3300047321 Ga0495676_0321576 Ga0495676_0321576_713_997 87
218 3300047321 Ga0495676_0482597 Ga0495676_0482597_471_746 87
219 3300047446 Ga0495679_195023 Ga0495679_195023_28_315 87
220 3300047471 Ga0495684_0774835 Ga0495684_0774835_42_305 87
221 3300048903 Ga0496100_0005897 Ga0496100_0005897_4847_5131 87
222 3300048903 Ga0496100_0653284 Ga0496100_0653284_249_539 87
223 3300048904 Ga0496101_0031031 Ga0496101_0031031_2878_3162 87
224 3300048904 Ga0496101_1034935 Ga0496101_1034935_215_505 87
225 3300048904 Ga0496101_1585718 Ga0496101_1585718_24_299 87
226 3300048905 Ga0496102_0006408 Ga0496102_0006408_3125_3409 87
227 3300048905 Ga0496102_0345906 Ga0496102_0345906_409_738 87
228 3300048905 Ga0496102_0386579 Ga0496102_0386579_103_375 87
229 3300048906 Ga0496103_0002557 Ga0496103_0002557_7095_7379 87
230 3300048906 Ga0496103_0019977 Ga0496103_0019977_911_1183 87
231 3300048906 Ga0496103_0646180 Ga0496103_0646180_268_531 87
232 3300048907 Ga0496104_0000008 Ga0496104_0000008_135364_135660 87
233 3300048907 Ga0496104_0000010 Ga0496104_0000010_229166_229429 87
234 3300048907 Ga0496104_0030394 Ga0496104_0030394_4266_4550 87
235 3300048908 Ga0496105_0000003 Ga0496105_0000003_135364_135660 87
236 3300048908 Ga0496105_0000005 Ga0496105_0000005_229166_229429 87
237 3300048908 Ga0496105_0000051 Ga0496105_0000051_53083_53400 87
238 3300048908 Ga0496105_0014615 Ga0496105_0014615_2279_2563 87
239 3300048909 Ga0496106_0006957 Ga0496106_0006957_1747_2031 87
240 3300048909 Ga0496106_0250048 Ga0496106_0250048_20_310 87
241 3300048910 Ga0496107_0035366 Ga0496107_0035366_689_973 87
242 3300048910 Ga0496107_0304548 Ga0496107_0304548_614_943 87
243 3300048910 Ga0496107_0484861 Ga0496107_0484861_328_618 87
244 3300048911 Ga0496108_0001876 Ga0496108_0001876_3875_4159 87
245 3300048911 Ga0496108_0475090 Ga0496108_0475090_140_415 87
246 3300048912 Ga0496109_0004919 Ga0496109_0004919_7482_7766 87
247 3300048912 Ga0496109_0276777 Ga0496109_0276777_729_1013 87
248 3300048912 Ga0496109_0429519 Ga0496109_0429519_851_1126 87
249 3300048912 Ga0496109_0792942 Ga0496109_0792942_445_708 87
250 3300048913 Ga0496110_0041398 Ga0496110_0041398_2915_3199 87
251 3300048913 Ga0496110_0067877 Ga0496110_0067877_697_987 87
252 3300048913 Ga0496110_0793382 Ga0496110_0793382_167_430 87
253 3300048914 Ga0496111_0034373 Ga0496111_0034373_1416_1700 87
254 3300048914 Ga0496111_0041144 Ga0496111_0041144_1968_2297 87
255 3300048915 Ga0496112_0033120 Ga0496112_0033120_2137_2421 87
256 3300048915 Ga0496112_0621871 Ga0496112_0621871_666_941 87
257 3300048916 Ga0496113_0020317 Ga0496113_0020317_2216_2491 87
258 3300048916 Ga0496113_0066925 Ga0496113_0066925_266_550 87
259 3300048916 Ga0496113_0611852 Ga0496113_0611852_134_424 87
260 3300048917 Ga0496114_0000003 Ga0496114_0000003_480514_480777 87
261 3300048917 Ga0496114_0005733 Ga0496114_0005733_6478_6762 87
262 3300048917 Ga0496114_0915616 Ga0496114_0915616_101_397 87
263 3300048918 Ga0496115_0000827 Ga0496115_0000827_15793_16056 87
264 3300048918 Ga0496115_0023855 Ga0496115_0023855_1866_2150 87
265 3300048919 Ga0496116_0143191 Ga0496116_0143191_719_991 87
266 3300048922 Ga0496119_0016268 Ga0496119_0016268_476_739 87
267 3300049575 Ga0501039_0553574 Ga0501039_0553574_540_803 87
268 3300049576 Ga0501040_0189087 Ga0501040_0189087_490_765 87
269 3300049576 Ga0501040_0245629 Ga0501040_0245629_705_968 87
270 3300049578 Ga0501042_0520677 Ga0501042_0520677_156_419 87
271 3300049578 Ga0501042_0684060 Ga0501042_0684060_175_450 87
272 3300049583 Ga0501067_0790637 Ga0501067_0790637_164_439 87
273 3300049586 Ga0501070_0591071 Ga0501070_0591071_585_848 87
274 3300049587 Ga0501071_0762503 Ga0501071_0762503_31_297 87
275 3300049587 Ga0501071_1221382 Ga0501071_1221382_156_419 87
276 3300049587 Ga0501071_1476336 Ga0501071_1476336_12_323 87
277 3300049588 Ga0501072_0135569 Ga0501072_0135569_952_1215 87
278 3300049588 Ga0501072_0779652 Ga0501072_0779652_212_478 87
279 3300049590 Ga0501074_1297586 Ga0501074_1297586_140_415 87
280 3300049591 Ga0501075_0669999 Ga0501075_0669999_102_365 87
281 3300049591 Ga0501075_1234404 Ga0501075_1234404_280_555 87
282 3300049592 Ga0501076_1711234 Ga0501076_1711234_207_482 87
283 3300049741 Ga0501079_0831966 Ga0501079_0831966_93_368 87
284 3300049741 Ga0501079_1279743 Ga0501079_1279743_111_374 87
285 3300049743 Ga0501081_0533386 Ga0501081_0533386_306_581 87
286 3300049744 Ga0501083_0213859 Ga0501083_0213859_509_772 87
287 3300049824 Ga0501045_0184182 Ga0501045_0184182_682_945 87
288 3300050491 nmdc:mga00v17_142628_c1 nmdc:mga00v17_142628_c1_515_793 87
289 3300050491 nmdc:mga00v17_179397_c1 nmdc:mga00v17_179397_c1_750_1028 87
290 3300050492 nmdc:mga0yw44_104282_c1 nmdc:mga0yw44_104282_c1_398_676 87
291 3300050492 nmdc:mga0yw44_1187563_c1 nmdc:mga0yw44_1187563_c1_78_377 87
292 3300050507 nmdc:mga05p37_349409_c1 nmdc:mga05p37_349409_c1_1061_1384 87
293 3300050507 nmdc:mga05p37_44576_c1 nmdc:mga05p37_44576_c1_1185_1460 87
294 3300050508 nmdc:mga09592_279686_c1 nmdc:mga09592_279686_c1_213_506 87
295 3300050509 nmdc:mga0qj67_98783_c1 nmdc:mga0qj67_98783_c1_1988_2281 87
296 3300050510 nmdc:mga06r32_35823_c1 nmdc:mga06r32_35823_c1_3389_3682 87
297 3300050510 nmdc:mga06r32_55724_c1 nmdc:mga06r32_55724_c1_2813_3142 87
298 3300050511 nmdc:mga08y16_1508664_c1 nmdc:mga08y16_1508664_c1_220_489 87
299 3300050511 nmdc:mga08y16_1762263_c1 nmdc:mga08y16_1762263_c1_45_374 87
300 3300050511 nmdc:mga08y16_462111_c1 nmdc:mga08y16_462111_c1_962_1246 87
301 3300050511 nmdc:mga08y16_644304_c1 nmdc:mga08y16_644304_c1_471_746 87
302 3300053077 Ga0495601_0578731 Ga0495601_0578731_202_465 87
303 3300053085 Ga0495619_0267981 Ga0495619_0267981_686_949 87
304 3300053096 Ga0500641_0001015 Ga0500641_0001015_9364_9627 87
305 3300053102 Ga0500554_210911 Ga0500554_210911_208_492 87
306 3300054114 Ga0501084_0234289 Ga0501084_0234289_459_722 87
307 3300060353 Ga0501082_0132931 Ga0501082_0132931_275_550 87

Feature Viewer

pLDDT pTM Quality
86.92 0.47 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map