F399279

General Info

Members Datasets Scaffolds Average Seq Length
307 175 614 104

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0145888|Ga0395900_0145888_136_507
Length 123
Sequence MGDGTVPKLRQSRSLKSAAVTATRKLVVFVPPQALDAVRDALFAAGAGRIGEYERCSWYTEGTGTFLAGEGADPTIGERGREERVPELRLETVYPADRESEVVEALRAAHPYEEPAFDLYLLA

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
51 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
52 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
53 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
54 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
81 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
82 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
83 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
84 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
85 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
86 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
87 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
88 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
89 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
90 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
91 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
92 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
93 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
94 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
95 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
96 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
97 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
98 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
99 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
100 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
101 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
102 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
103 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
104 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
105 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
106 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
107 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
108 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
109 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
110 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
111 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
112 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
113 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
114 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
115 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
116 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
117 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
118 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
119 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
120 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
121 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
122 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
123 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
124 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
125 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
126 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
127 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
128 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
129 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
130 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
131 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
132 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
133 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
134 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
135 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
136 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
137 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
138 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
139 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
142 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
143 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
144 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
153 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
154 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
155 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
156 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
157 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
158 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
159 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
160 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
161 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
162 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
163 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
164 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
165 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
169 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
170 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
171 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
172 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
173 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
174 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
175 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.02
Metatranscriptomes 0.98
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.77
Rhizosphere 88.93
Stem 0
Stem Tuber 0
Unclassified 6.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0145888 3300037418 Bacteria 2420
2 JGI25406J46586_10069540 3300003203 Bacteria 1109
3 Ga0070683_100009167 3300005329 Bacteria 8447
4 Ga0070683_100084458 3300005329 Bacteria 2975
5 Ga0070683_100224787 3300005329 Bacteria 1784
6 Ga0070680_100017673 3300005336 Bacteria 5626
7 Ga0070682_100259669 3300005337 Bacteria 1256
8 Ga0070682_100375496 3300005337 Bacteria 1068
9 Ga0070660_100004855 3300005339 Bacteria 9287
10 Ga0070660_100164666 3300005339 Bacteria 1788
11 Ga0070661_100178093 3300005344 Bacteria 1617
12 Ga0070661_100638033 3300005344 Bacteria 864
13 Ga0070674_100798636 3300005356 Bacteria 815
14 Ga0070688_100833962 3300005365 Bacteria 723
15 Ga0070659_100480430 3300005366 Unclassified 1057
16 Ga0070714_101115845 3300005435 Bacteria 769
17 Ga0070713_101293128 3300005436 Bacteria 707
18 Ga0070711_100752413 3300005439 Bacteria 824
19 Ga0070708_100458126 3300005445 Bacteria 1203
20 Ga0070681_10030793 3300005458 Bacteria 5385
21 Ga0070681_10194495 3300005458 Bacteria 1947
22 Ga0070706_101116540 3300005467 Unclassified 726
23 Ga0070707_100000819 3300005468 Bacteria 30825
24 Ga0070698_100002130 3300005471 Bacteria 21985
25 Ga0070698_100228748 3300005471 Bacteria 1793
26 Ga0070699_101206919 3300005518 Bacteria 694
27 Ga0070699_101748676 3300005518 Bacteria 569
28 Ga0070679_100112197 3300005530 Bacteria 2712
29 Ga0070679_102211722 3300005530 Bacteria 500
30 Ga0070684_100002789 3300005535 Bacteria 12943
31 Ga0070684_100003984 3300005535 Bacteria 11188
32 Ga0070684_100010471 3300005535 Bacteria 7348
33 Ga0070684_100514516 3300005535 Bacteria 1109
34 Ga0070697_100950681 3300005536 Bacteria 763
35 Ga0068853_101154518 3300005539 Unclassified 747
36 Ga0070672_101403876 3300005543 Bacteria 625
37 Ga0070693_100512299 3300005547 Bacteria 853
38 Ga0068855_100363398 3300005563 Bacteria 1592
39 Ga0068857_100019684 3300005577 Bacteria 5929
40 Ga0068857_100087165 3300005577 Bacteria 2792
41 Ga0068857_100096390 3300005577 Bacteria 2651
42 Ga0068856_100233065 3300005614 Bacteria 1856
43 Ga0068870_10191947 3300005840 Bacteria 1233
44 Ga0068858_100843623 3300005842 Bacteria 895
45 Ga0068860_100914243 3300005843 Bacteria 894
46 Ga0081455_10020306 3300005937 Bacteria 6261
47 Ga0081455_10051277 3300005937 Bacteria 3540
48 Ga0081455_10458391 3300005937 Bacteria 869
49 Ga0081538_10074955 3300005981 Bacteria 1839
50 Ga0081539_10000711 3300005985 Bacteria 66648
51 Ga0081539_10002546 3300005985 Bacteria 25327
52 Ga0070715_11043297 3300006163 Bacteria 512
53 Ga0070712_100230763 3300006175 Bacteria 1470
54 Ga0075430_100591409 3300006846 Bacteria 915
55 Ga0075431_100919525 3300006847 Unclassified 844
56 Ga0075433_10267251 3300006852 Bacteria 1516
57 Ga0075434_100643961 3300006871 Unclassified 1078
58 Ga0075434_102089844 3300006871 Bacteria 571
59 Ga0068865_100161261 3300006881 Bacteria 1711
60 Ga0075435_101146094 3300007076 Bacteria 680
61 Ga0105247_11820992 3300009101 Unclassified 507
62 Ga0114129_10444614 3300009147 Bacteria 1701
63 Ga0114129_12006881 3300009147 Bacteria 699
64 Ga0105238_11315298 3300009551 Bacteria 749
65 Ga0157370_10075414 3300013104 Bacteria 3179
66 Ga0157369_10803394 3300013105 Bacteria 966
67 Ga0157369_10852805 3300013105 Bacteria 935
68 Ga0157372_10361512 3300013307 Bacteria 1691
69 Ga0163163_10799460 3300014325 Bacteria 1007
70 Ga0182008_10620992 3300014497 Bacteria 609
71 Ga0182008_10649789 3300014497 Bacteria 597
72 Ga0157377_10187802 3300014745 Bacteria 1304
73 Ga0182007_10095590 3300015262 Bacteria 981
74 Ga0182005_1146751 3300015265 Bacteria 684
75 Ga0206356_11684383 3300020070 Bacteria 1040
76 Ga0206354_11000444 3300020081 Bacteria 783
77 Ga0206353_11354785 3300020082 Bacteria 916
78 Ga0213876_10514797 3300021384 Bacteria 637
79 Ga0207685_10452970 3300025905 Bacteria 667
80 Ga0207643_10291003 3300025908 Bacteria 1015
81 Ga0207684_11189735 3300025910 Bacteria 631
82 Ga0207707_10083375 3300025912 Bacteria 2791
83 Ga0207707_11096439 3300025912 Bacteria 649
84 Ga0207693_10231806 3300025915 Bacteria 1450
85 Ga0207693_11209833 3300025915 Bacteria 569
86 Ga0207660_10038173 3300025917 Bacteria 3352
87 Ga0207657_10042812 3300025919 Bacteria 3992
88 Ga0207657_10047436 3300025919 Bacteria 3756
89 Ga0207652_10165461 3300025921 Bacteria 1983
90 Ga0207646_10003137 3300025922 Bacteria 18943
91 Ga0207664_10987079 3300025929 Bacteria 755
92 Ga0207690_10204220 3300025932 Bacteria 1503
93 Ga0207669_10284081 3300025937 Bacteria 1250
94 Ga0207704_10463087 3300025938 Bacteria 1014
95 Ga0207661_10092169 3300025944 Bacteria 2526
96 Ga0207661_10871706 3300025944 Bacteria 829
97 Ga0207661_11343386 3300025944 Unclassified 656
98 Ga0207661_11476629 3300025944 Bacteria 623
99 Ga0207679_10095255 3300025945 Bacteria 2313
100 Ga0207667_10101962 3300025949 Bacteria 2960
101 Ga0207703_10781578 3300026035 Bacteria 911
102 Ga0207639_11082535 3300026041 Unclassified 751
103 Ga0207708_10512411 3300026075 Bacteria 1007
104 Ga0207702_10138719 3300026078 Bacteria 2197
105 Ga0207674_10002484 3300026116 Bacteria 23238
106 Ga0207674_10028403 3300026116 Bacteria 5905
107 Ga0207674_10155333 3300026116 Bacteria 2243
108 Ga0207674_10624751 3300026116 Bacteria 1040
109 Ga0207675_100849544 3300026118 Bacteria 928
110 Ga0265338_10052081 3300028800 Bacteria 3678
111 Ga0265330_10123658 3300031235 Bacteria 1102
112 Ga0265328_10229054 3300031239 Bacteria 709
113 Ga0265325_10112140 3300031241 Bacteria 1324
114 Ga0265325_10249292 3300031241 Bacteria 804
115 Ga0265340_10279906 3300031247 Bacteria 741
116 Ga0265339_10034896 3300031249 Bacteria 2824
117 Ga0265331_10123619 3300031250 Bacteria 1183
118 Ga0265316_10278511 3300031344 Bacteria 1222
119 Ga0265313_10058617 3300031595 Bacteria 1814
120 Ga0265314_10108682 3300031711 Bacteria 1766
121 Ga0265314_10459407 3300031711 Bacteria 677
122 Ga0265342_10044449 3300031712 Bacteria 2677
123 Ga0395899_0019020 3300037312 Bacteria 5220
124 Ga0395899_0085615 3300037312 Bacteria 2290
125 Ga0395899_0087441 3300037312 Bacteria 2262
126 Ga0395899_0347559 3300037312 Bacteria 993
127 Ga0395899_0892846 3300037312 Unclassified 543
128 Ga0395900_0015039 3300037418 Bacteria 7888
129 Ga0395900_0026672 3300037418 Bacteria 5915
130 Ga0395900_0042669 3300037418 Bacteria 4673
131 Ga0395900_0120250 3300037418 Bacteria 2695
132 Ga0395900_0134429 3300037418 Bacteria 2533
133 Ga0395900_0185100 3300037418 Bacteria 2114
134 Ga0395900_0780483 3300037418 Bacteria 884
135 Ga0395900_1004135 3300037418 Bacteria 754
136 Ga0395898_0020626 3300037466 Bacteria 6694
137 Ga0395898_0034016 3300037466 Bacteria 5083
138 Ga0395898_0035987 3300037466 Bacteria 4920
139 Ga0395898_0036199 3300037466 Bacteria 4902
140 Ga0395898_0058371 3300037466 Bacteria 3756
141 Ga0395898_0331396 3300037466 Bacteria 1451
142 Ga0395898_0393025 3300037466 Bacteria 1322
143 Ga0395898_0422205 3300037466 Bacteria 1271
144 Ga0395898_0511935 3300037466 Bacteria 1141
145 Ga0395898_0621662 3300037466 Bacteria 1023
146 Ga0395898_1117420 3300037466 Bacteria 721
147 Ga0395898_1259216 3300037466 Bacteria 670
148 Ga0395905_0007514 3300037471 Bacteria 10840
149 Ga0395905_0008802 3300037471 Bacteria 9917
150 Ga0395905_0033208 3300037471 Bacteria 4848
151 Ga0395905_0092204 3300037471 Bacteria 2841
152 Ga0395905_0149167 3300037471 Bacteria 2200
153 Ga0395905_0195787 3300037471 Bacteria 1895
154 Ga0395905_0398685 3300037471 Bacteria 1271
155 Ga0395905_0503006 3300037471 Bacteria 1112
156 Ga0395905_0928696 3300037471 Bacteria 773
157 Ga0395905_1883830 3300037471 Bacteria 504
158 Ga0395901_0001730 3300038443 Bacteria 22543
159 Ga0395901_0007710 3300038443 Bacteria 10855
160 Ga0395901_0066446 3300038443 Bacteria 3756
161 Ga0395901_0070123 3300038443 Bacteria 3651
162 Ga0395901_0077406 3300038443 Bacteria 3471
163 Ga0395901_0284229 3300038443 Bacteria 1718
164 Ga0395901_0334489 3300038443 Bacteria 1565
165 Ga0395901_0361190 3300038443 Bacteria 1497
166 Ga0395901_0439071 3300038443 Bacteria 1336
167 Ga0395901_0586931 3300038443 Bacteria 1125
168 Ga0395901_0788115 3300038443 Bacteria 940
169 Ga0395901_1364809 3300038443 Bacteria 668
170 Ga0395901_2090044 3300038443 Bacteria 511
171 Ga0436365_0830983 3300039437 Bacteria 1035
172 Ga0436365_1778980 3300039437 Bacteria 779
173 Ga0451795_0674678 3300041456 Bacteria 751
174 Ga0451853_1286831 3300041512 Bacteria 2378
175 Ga0439448_0203619 3300042005 Bacteria 694
176 Ga0439463_108860 3300042016 Bacteria 715
177 Ga0439460_0172374 3300042461 Bacteria 729
178 Ga0466969_0056304 3300044656 Bacteria 1920
179 Ga0466966_0027225 3300044684 Bacteria 3728
180 Ga0466966_0098736 3300044684 Bacteria 1808
181 Ga0466966_0224735 3300044684 Bacteria 1133
182 Ga0466963_0318980 3300044694 Bacteria 1093
183 Ga0466963_0661279 3300044694 Unclassified 737
184 Ga0466964_0059438 3300044706 Bacteria 1587
185 Ga0466964_0146798 3300044706 Bacteria 1089
186 Ga0466964_0542250 3300044706 Bacteria 630
187 Ga0466957_0081888 3300044842 Bacteria 2011
188 Ga0466960_0773501 3300044901 Bacteria 580
189 Ga0466959_0116094 3300045049 Bacteria 1906
190 Ga0466967_0014614 3300045976 Bacteria 6124
191 Ga0466967_0029907 3300045976 Bacteria 4565
192 Ga0466967_0201267 3300045976 Bacteria 1886
193 Ga0466967_0371096 3300045976 Bacteria 1388
194 Ga0466967_0493743 3300045976 Bacteria 1200
195 Ga0466967_0747013 3300045976 Bacteria 970
196 Ga0466967_0912152 3300045976 Bacteria 874
197 Ga0466967_1310534 3300045976 Bacteria 721
198 Ga0495603_0195261 3300046455 Bacteria 1170
199 Ga0495603_0777495 3300046455 Bacteria 546
200 Ga0495641_0055749 3300046461 Bacteria 1793
201 Ga0495582_0004156 3300046473 Bacteria 8139
202 Ga0495639_0582804 3300046475 Bacteria 574
203 Ga0495664_0778875 3300046477 Bacteria 563
204 Ga0495584_0169178 3300046491 Bacteria 1111
205 Ga0495585_0355848 3300046492 Unclassified 711
206 Ga0495594_0188443 3300046499 Bacteria 1175
207 Ga0495596_0157621 3300046500 Bacteria 882
208 Ga0495665_0020579 3300046531 Bacteria 3543
209 Ga0495586_0724588 3300046535 Bacteria 574
210 Ga0495656_0033530 3300046615 Bacteria 2097
211 Ga0495659_0121055 3300046664 Unclassified 1030
212 Ga0495659_0395805 3300046664 Bacteria 596
213 Ga0495588_0032344 3300046674 Bacteria 2636
214 Ga0495647_0126351 3300046681 Bacteria 1080
215 Ga0495658_0551502 3300046683 Bacteria 738
216 Ga0495613_0104837 3300046689 Bacteria 2041
217 Ga0495589_0564244 3300046794 Bacteria 519
218 Ga0495589_0564714 3300046794 Bacteria 519
219 Ga0495581_0016360 3300047315 Bacteria 4313
220 Ga0495676_0020749 3300047321 Bacteria 5757
221 Ga0496100_0003386 3300048903 Bacteria 8306
222 Ga0496101_0166497 3300048904 Bacteria 1692
223 Ga0496102_0206571 3300048905 Bacteria 1852
224 Ga0496102_0909585 3300048905 Bacteria 801
225 Ga0496102_1246932 3300048905 Bacteria 663
226 Ga0496103_0286117 3300048906 Bacteria 1060
227 Ga0496105_0900476 3300048908 Bacteria 667
228 Ga0496106_0013585 3300048909 Bacteria 6011
229 Ga0496107_0023490 3300048910 Bacteria 4359
230 Ga0496108_0044080 3300048911 Bacteria 3725
231 Ga0496108_0109187 3300048911 Bacteria 2364
232 Ga0496108_1458517 3300048911 Archaea 571
233 Ga0496109_0181308 3300048912 Bacteria 1978
234 Ga0496109_0206674 3300048912 Bacteria 1846
235 Ga0496109_0312193 3300048912 Bacteria 1483
236 Ga0496109_0789410 3300048912 Unclassified 888
237 Ga0496110_0087751 3300048913 Bacteria 2778
238 Ga0496110_0424667 3300048913 Bacteria 1212
239 Ga0496110_0714938 3300048913 Bacteria 904
240 Ga0496111_0382810 3300048914 Bacteria 1040
241 Ga0496112_0002474 3300048915 Bacteria 14909
242 Ga0496112_0011784 3300048915 Bacteria 8004
243 Ga0496112_0243047 3300048915 Bacteria 1752
244 Ga0496112_0462651 3300048915 Bacteria 1206
245 Ga0496112_1209528 3300048915 Bacteria 672
246 Ga0496112_1241439 3300048915 Bacteria 661
247 Ga0496113_0838132 3300048916 Bacteria 729
248 Ga0496114_0822981 3300048917 Unclassified 808
249 Ga0496115_0145469 3300048918 Bacteria 1956
250 Ga0501032_0947865 3300049569 Bacteria 541
251 Ga0501034_1455610 3300049571 Bacteria 559
252 Ga0501037_1027514 3300049573 Bacteria 536
253 Ga0501039_0083543 3300049575 Bacteria 2487
254 Ga0501040_0025089 3300049576 Bacteria 4005
255 Ga0501040_0177623 3300049576 Bacteria 1509
256 Ga0501040_1049138 3300049576 Unclassified 591
257 Ga0501040_1108148 3300049576 Bacteria 574
258 Ga0501040_1251451 3300049576 Bacteria 538
259 Ga0501042_0046434 3300049578 Bacteria 3096
260 Ga0501042_0679385 3300049578 Bacteria 749
261 Ga0501042_0956165 3300049578 Unclassified 624
262 Ga0501046_0206337 3300049580 Bacteria 1460
263 Ga0501046_0365797 3300049580 Bacteria 1045
264 Ga0501047_0020275 3300049581 Bacteria 6384
265 Ga0501047_0099813 3300049581 Bacteria 2782
266 Ga0501067_0265860 3300049583 Bacteria 955
267 Ga0501067_0664144 3300049583 Bacteria 585
268 Ga0501068_0085501 3300049584 Bacteria 1941
269 Ga0501069_0753300 3300049585 Bacteria 589
270 Ga0501070_0084122 3300049586 Bacteria 2634
271 Ga0501070_0230444 3300049586 Bacteria 1518
272 Ga0501071_0062693 3300049587 Bacteria 2694
273 Ga0501072_0199049 3300049588 Bacteria 1597
274 Ga0501073_0401891 3300049589 Bacteria 946
275 Ga0501074_0175048 3300049590 Bacteria 1531
276 Ga0501074_0187889 3300049590 Bacteria 1473
277 Ga0501075_0265391 3300049591 Bacteria 1308
278 Ga0501076_0495893 3300049592 Bacteria 1006
279 Ga0501076_0660707 3300049592 Bacteria 863
280 Ga0501076_1168013 3300049592 Unclassified 634
281 Ga0501079_0087521 3300049741 Bacteria 2411
282 Ga0501080_0100378 3300049742 Bacteria 2685
283 Ga0501080_0296127 3300049742 Bacteria 1468
284 Ga0501080_0611463 3300049742 Bacteria 967
285 Ga0501080_0636533 3300049742 Bacteria 944
286 Ga0501081_0047880 3300049743 Bacteria 2941
287 Ga0501081_0160675 3300049743 Bacteria 1619
288 Ga0501081_0689042 3300049743 Bacteria 767
289 Ga0501044_0447505 3300049823 Bacteria 1199
290 Ga0501044_0505877 3300049823 Bacteria 1109
291 Ga0501045_0029991 3300049824 Bacteria 3934
292 nmdc:mga05p37_1006918_c1 3300050507 Bacteria 884
293 nmdc:mga05p37_983239_c1 3300050507 Bacteria 899
294 nmdc:mga09592_56809_c1 3300050508 Bacteria 3307
295 nmdc:mga06r32_1027156_c1 3300050510 Unclassified 776
296 nmdc:mga0n895_1027084_c1 3300050512 Bacteria 804
297 nmdc:mga0n895_1414336_c1 3300050512 Bacteria 664
298 nmdc:mga0n895_423047_c1 3300050512 Unclassified 1346
299 nmdc:mga0rr50_1515421_c1 3300050513 Unclassified 567
300 Ga0501084_0097848 3300054114 Bacteria 2463
301 Ga0501084_0136771 3300054114 Bacteria 2063
302 Ga0501084_0266030 3300054114 Bacteria 1448
303 Ga0501084_1219207 3300054114 Bacteria 631
304 Ga0501082_0099402 3300060353 Bacteria 2515
305 Ga0466962_0207370 3300061719 Bacteria 958
306 Ga0530510_0301847 3300061734 Bacteria 1198
307 Ga0530510_0677557 3300061734 Bacteria 785
308 Ga0395900_0145888
309 JGI25406J46586_10069540
310 Ga0070683_100009167
311 Ga0070683_100084458
312 Ga0070683_100224787
313 Ga0070680_100017673
314 Ga0070682_100259669
315 Ga0070682_100375496
316 Ga0070660_100004855
317 Ga0070660_100164666
318 Ga0070661_100178093
319 Ga0070661_100638033
320 Ga0070674_100798636
321 Ga0070688_100833962
322 Ga0070659_100480430
323 Ga0070714_101115845
324 Ga0070713_101293128
325 Ga0070711_100752413
326 Ga0070708_100458126
327 Ga0070681_10030793
328 Ga0070681_10194495
329 Ga0070706_101116540
330 Ga0070707_100000819
331 Ga0070698_100002130
332 Ga0070698_100228748
333 Ga0070699_101206919
334 Ga0070699_101748676
335 Ga0070679_100112197
336 Ga0070679_102211722
337 Ga0070684_100002789
338 Ga0070684_100003984
339 Ga0070684_100010471
340 Ga0070684_100514516
341 Ga0070697_100950681
342 Ga0068853_101154518
343 Ga0070672_101403876
344 Ga0070693_100512299
345 Ga0068855_100363398
346 Ga0068857_100019684
347 Ga0068857_100087165
348 Ga0068857_100096390
349 Ga0068856_100233065
350 Ga0068870_10191947
351 Ga0068858_100843623
352 Ga0068860_100914243
353 Ga0081455_10020306
354 Ga0081455_10051277
355 Ga0081455_10458391
356 Ga0081538_10074955
357 Ga0081539_10000711
358 Ga0081539_10002546
359 Ga0070715_11043297
360 Ga0070712_100230763
361 Ga0075430_100591409
362 Ga0075431_100919525
363 Ga0075433_10267251
364 Ga0075434_100643961
365 Ga0075434_102089844
366 Ga0068865_100161261
367 Ga0075435_101146094
368 Ga0105247_11820992
369 Ga0114129_10444614
370 Ga0114129_12006881
371 Ga0105238_11315298
372 Ga0157370_10075414
373 Ga0157369_10803394
374 Ga0157369_10852805
375 Ga0157372_10361512
376 Ga0163163_10799460
377 Ga0182008_10620992
378 Ga0182008_10649789
379 Ga0157377_10187802
380 Ga0182007_10095590
381 Ga0182005_1146751
382 Ga0206356_11684383
383 Ga0206354_11000444
384 Ga0206353_11354785
385 Ga0213876_10514797
386 Ga0207685_10452970
387 Ga0207643_10291003
388 Ga0207684_11189735
389 Ga0207707_10083375
390 Ga0207707_11096439
391 Ga0207693_10231806
392 Ga0207693_11209833
393 Ga0207660_10038173
394 Ga0207657_10042812
395 Ga0207657_10047436
396 Ga0207652_10165461
397 Ga0207646_10003137
398 Ga0207664_10987079
399 Ga0207690_10204220
400 Ga0207669_10284081
401 Ga0207704_10463087
402 Ga0207661_10092169
403 Ga0207661_10871706
404 Ga0207661_11343386
405 Ga0207661_11476629
406 Ga0207679_10095255
407 Ga0207667_10101962
408 Ga0207703_10781578
409 Ga0207639_11082535
410 Ga0207708_10512411
411 Ga0207702_10138719
412 Ga0207674_10002484
413 Ga0207674_10028403
414 Ga0207674_10155333
415 Ga0207674_10624751
416 Ga0207675_100849544
417 Ga0265338_10052081
418 Ga0265330_10123658
419 Ga0265328_10229054
420 Ga0265325_10112140
421 Ga0265325_10249292
422 Ga0265340_10279906
423 Ga0265339_10034896
424 Ga0265331_10123619
425 Ga0265316_10278511
426 Ga0265313_10058617
427 Ga0265314_10108682
428 Ga0265314_10459407
429 Ga0265342_10044449
430 Ga0395899_0019020
431 Ga0395899_0085615
432 Ga0395899_0087441
433 Ga0395899_0347559
434 Ga0395899_0892846
435 Ga0395900_0015039
436 Ga0395900_0026672
437 Ga0395900_0042669
438 Ga0395900_0120250
439 Ga0395900_0134429
440 Ga0395900_0185100
441 Ga0395900_0780483
442 Ga0395900_1004135
443 Ga0395898_0020626
444 Ga0395898_0034016
445 Ga0395898_0035987
446 Ga0395898_0036199
447 Ga0395898_0058371
448 Ga0395898_0331396
449 Ga0395898_0393025
450 Ga0395898_0422205
451 Ga0395898_0511935
452 Ga0395898_0621662
453 Ga0395898_1117420
454 Ga0395898_1259216
455 Ga0395905_0007514
456 Ga0395905_0008802
457 Ga0395905_0033208
458 Ga0395905_0092204
459 Ga0395905_0149167
460 Ga0395905_0195787
461 Ga0395905_0398685
462 Ga0395905_0503006
463 Ga0395905_0928696
464 Ga0395905_1883830
465 Ga0395901_0001730
466 Ga0395901_0007710
467 Ga0395901_0066446
468 Ga0395901_0070123
469 Ga0395901_0077406
470 Ga0395901_0284229
471 Ga0395901_0334489
472 Ga0395901_0361190
473 Ga0395901_0439071
474 Ga0395901_0586931
475 Ga0395901_0788115
476 Ga0395901_1364809
477 Ga0395901_2090044
478 Ga0436365_0830983
479 Ga0436365_1778980
480 Ga0451795_0674678
481 Ga0451853_1286831
482 Ga0439448_0203619
483 Ga0439463_108860
484 Ga0439460_0172374
485 Ga0466969_0056304
486 Ga0466966_0027225
487 Ga0466966_0098736
488 Ga0466966_0224735
489 Ga0466963_0318980
490 Ga0466963_0661279
491 Ga0466964_0059438
492 Ga0466964_0146798
493 Ga0466964_0542250
494 Ga0466957_0081888
495 Ga0466960_0773501
496 Ga0466959_0116094
497 Ga0466967_0014614
498 Ga0466967_0029907
499 Ga0466967_0201267
500 Ga0466967_0371096
501 Ga0466967_0493743
502 Ga0466967_0747013
503 Ga0466967_0912152
504 Ga0466967_1310534
505 Ga0495603_0195261
506 Ga0495603_0777495
507 Ga0495641_0055749
508 Ga0495582_0004156
509 Ga0495639_0582804
510 Ga0495664_0778875
511 Ga0495584_0169178
512 Ga0495585_0355848
513 Ga0495594_0188443
514 Ga0495596_0157621
515 Ga0495665_0020579
516 Ga0495586_0724588
517 Ga0495656_0033530
518 Ga0495659_0121055
519 Ga0495659_0395805
520 Ga0495588_0032344
521 Ga0495647_0126351
522 Ga0495658_0551502
523 Ga0495613_0104837
524 Ga0495589_0564244
525 Ga0495589_0564714
526 Ga0495581_0016360
527 Ga0495676_0020749
528 Ga0496100_0003386
529 Ga0496101_0166497
530 Ga0496102_0206571
531 Ga0496102_0909585
532 Ga0496102_1246932
533 Ga0496103_0286117
534 Ga0496105_0900476
535 Ga0496106_0013585
536 Ga0496107_0023490
537 Ga0496108_0044080
538 Ga0496108_0109187
539 Ga0496108_1458517
540 Ga0496109_0181308
541 Ga0496109_0206674
542 Ga0496109_0312193
543 Ga0496109_0789410
544 Ga0496110_0087751
545 Ga0496110_0424667
546 Ga0496110_0714938
547 Ga0496111_0382810
548 Ga0496112_0002474
549 Ga0496112_0011784
550 Ga0496112_0243047
551 Ga0496112_0462651
552 Ga0496112_1209528
553 Ga0496112_1241439
554 Ga0496113_0838132
555 Ga0496114_0822981
556 Ga0496115_0145469
557 Ga0501032_0947865
558 Ga0501034_1455610
559 Ga0501037_1027514
560 Ga0501039_0083543
561 Ga0501040_0025089
562 Ga0501040_0177623
563 Ga0501040_1049138
564 Ga0501040_1108148
565 Ga0501040_1251451
566 Ga0501042_0046434
567 Ga0501042_0679385
568 Ga0501042_0956165
569 Ga0501046_0206337
570 Ga0501046_0365797
571 Ga0501047_0020275
572 Ga0501047_0099813
573 Ga0501067_0265860
574 Ga0501067_0664144
575 Ga0501068_0085501
576 Ga0501069_0753300
577 Ga0501070_0084122
578 Ga0501070_0230444
579 Ga0501071_0062693
580 Ga0501072_0199049
581 Ga0501073_0401891
582 Ga0501074_0175048
583 Ga0501074_0187889
584 Ga0501075_0265391
585 Ga0501076_0495893
586 Ga0501076_0660707
587 Ga0501076_1168013
588 Ga0501079_0087521
589 Ga0501080_0100378
590 Ga0501080_0296127
591 Ga0501080_0611463
592 Ga0501080_0636533
593 Ga0501081_0047880
594 Ga0501081_0160675
595 Ga0501081_0689042
596 Ga0501044_0447505
597 Ga0501044_0505877
598 Ga0501045_0029991
599 nmdc:mga05p37_1006918_c1
600 nmdc:mga05p37_983239_c1
601 nmdc:mga09592_56809_c1
602 nmdc:mga06r32_1027156_c1
603 nmdc:mga0n895_1027084_c1
604 nmdc:mga0n895_1414336_c1
605 nmdc:mga0n895_423047_c1
606 nmdc:mga0rr50_1515421_c1
607 Ga0501084_0097848
608 Ga0501084_0136771
609 Ga0501084_0266030
610 Ga0501084_1219207
611 Ga0501082_0099402
612 Ga0466962_0207370
613 Ga0530510_0301847
614 Ga0530510_0677557

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gx8-assembly1.cif.gz_B the crystal structure of bacillus cereus protein related to nif3 0.9058 3 103
2gx8-assembly1.cif.gz_C-2 the crystal structure of bacillus cereus protein related to nif3 0.8727 3 103
3lnl-assembly1.cif.gz_B crystal structure of staphylococcus aureus protein sa1388 0.8198 2 103
1ufl-assembly1.cif.gz_B crystal structure of tt1020 from thermus thermophilus hb8 0.8177 3 104
2eg1-assembly1.cif.gz_A the crystal structure of pii protein 0.8109 3 101
ID Description Score Start End Superfamily
af_Q54BW8_1_102_3.30.70.120 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9616 3 103 3.30.70.120
af_P9WFM1_132_234_3.30.70.120 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9511 1 102 3.30.70.120
af_Q54BW8_1_102_3.30.70.120 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9434 3 103 3.30.70.120
af_P9WFM1_132_234_3.30.70.120 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9335 1 102 3.30.70.120
2gx8B02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9058 3 103 3.30.70.120
ID Description Score Start End GO Terms
AF-A0A3A0BA66-F1-model_v4 Nif3-like dinuclear metal center hexameric protein 0.9735 2 101
AF-A0A4Z0WAZ3-F1-model_v4 NGG1p interacting factor NIF3 0.9706 2 103
AF-A0A4U9L0I8-F1-model_v4 deleted 0.9687 3 103
AF-A0A1Z8LAL6-F1-model_v4 GTP cyclohydrolase 1 type 2 homolog 0.9684 3 101 GO:0005737
GO:0046872
AF-A0A0R2DMI5-F1-model_v4 GTP cyclohydrolase 1 type 2 homolog 0.9674 3 101 GO:0005737
GO:0046872

Map