F399231

General Info

Members Datasets Scaffolds Average Seq Length
307 233 614 153

Family's Representative Sequence

Representative Sequence 3300025929|Ga0207664_10453760|Ga0207664_104537602
Length 152
Sequence MTESRPPFPPFTLETARQKVQAAENAWNTRDPEQVSLAYTVDSQWRNRDEHVVGRDEIVAFLTRKWQRELDYVLRKSLWGFRENRMAVRFQYECRAAGQWFRSYGNELWEFTGSGLMARREASINDVPIEHAQRRYFGPRPQSEHGHDIPLR

Samples

Sample ID Description Type Environment
1 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
4 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
80 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
87 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
123 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
124 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
125 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
126 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
129 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
130 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
131 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
132 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
133 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
134 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
139 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
140 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
141 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
142 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
143 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
144 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
145 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
146 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
147 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
148 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
149 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
150 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
151 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
152 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
155 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
156 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
157 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
158 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
159 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
160 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
161 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
162 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
163 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
164 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
165 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
166 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
167 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
168 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
169 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
170 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
171 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
172 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
173 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
174 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
175 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
176 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
177 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
178 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
179 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
180 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
181 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
182 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
183 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
187 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
190 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
191 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
195 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
196 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
197 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
198 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
199 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
209 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
210 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
211 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
212 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
213 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
214 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
215 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
216 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
217 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
218 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
219 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
220 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
221 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
222 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
223 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
224 2547132424 Nocardia nova SH22a Isolate Unclassified
225 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
226 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
227 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
228 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
229 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
230 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
231 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
232 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
233 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.25
Metatranscriptomes 7.49
Isolates 3.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.91
Nodule 0
Rhizoplane 6.19
Rhizosphere 84.69
Stem 0
Stem Tuber 0
Unclassified 1.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207664_10453760 3300025929 Bacteria 1144
2 JGI24746J21847_1007119 3300001977 Bacteria 1718
3 JGI24745J21846_1002001 3300002073 Bacteria 2037
4 Ga0055540_1001265 3300003792 Bacteria 15402
5 Ga0058861_11324604 3300004800 Bacteria 872
6 Ga0058862_12023591 3300004803 Bacteria 1465
7 Ga0070658_11063862 3300005327 Bacteria 704
8 Ga0070676_10175167 3300005328 Bacteria 1391
9 Ga0070683_100024630 3300005329 Bacteria 5393
10 Ga0070683_100188191 3300005329 Bacteria 1960
11 Ga0070683_100401607 3300005329 Bacteria 1307
12 Ga0070683_101002457 3300005329 Bacteria 802
13 Ga0070690_100297880 3300005330 Bacteria 1156
14 Ga0070666_10295331 3300005335 Bacteria 1153
15 Ga0070680_100029318 3300005336 Bacteria 4420
16 Ga0070680_100331490 3300005336 Bacteria 1293
17 Ga0070682_100213824 3300005337 Bacteria 1368
18 Ga0070682_100841834 3300005337 Bacteria 749
19 Ga0068868_100147227 3300005338 Bacteria 1937
20 Ga0070691_10194904 3300005341 Bacteria 1062
21 Ga0070661_100105225 3300005344 Unclassified 2103
22 Ga0070692_10202730 3300005345 Bacteria 1163
23 Ga0070669_100483661 3300005353 Bacteria 1025
24 Ga0070671_100018236 3300005355 Bacteria 5699
25 Ga0070673_100003613 3300005364 Bacteria 9676
26 Ga0070709_10089578 3300005434 Bacteria 2026
27 Ga0070714_100028225 3300005435 Bacteria 4654
28 Ga0070714_100486976 3300005435 Bacteria 1175
29 Ga0070713_100283029 3300005436 Bacteria 1522
30 Ga0070710_10398773 3300005437 Bacteria 922
31 Ga0070711_100024452 3300005439 Bacteria 3939
32 Ga0070694_100455657 3300005444 Bacteria 1011
33 Ga0070663_100319724 3300005455 Bacteria 1248
34 Ga0070663_100918624 3300005455 Bacteria 757
35 Ga0070678_100030402 3300005456 Bacteria 3712
36 Ga0070678_100584086 3300005456 Bacteria 996
37 Ga0070662_100229104 3300005457 Bacteria 1486
38 Ga0070662_100489687 3300005457 Bacteria 1025
39 Ga0070681_10007770 3300005458 Bacteria 10484
40 Ga0070681_10146056 3300005458 Bacteria 2294
41 Ga0070681_10205403 3300005458 Unclassified 1887
42 Ga0068867_100764091 3300005459 Bacteria 859
43 Ga0070685_10889045 3300005466 Bacteria 662
44 Ga0070706_100244357 3300005467 Bacteria 1676
45 Ga0070679_100016814 3300005530 Bacteria 7069
46 Ga0070679_100208357 3300005530 Unclassified 1919
47 Ga0070679_100242625 3300005530 Bacteria 1759
48 Ga0070679_100708211 3300005530 Bacteria 950
49 Ga0070679_100984642 3300005530 Bacteria 787
50 Ga0070679_101230065 3300005530 Bacteria 694
51 Ga0070684_100123265 3300005535 Bacteria 2332
52 Ga0070684_101410172 3300005535 Bacteria 656
53 Ga0070697_100429026 3300005536 Bacteria 1149
54 Ga0070697_100474613 3300005536 Bacteria 1092
55 Ga0068853_101392274 3300005539 Bacteria 678
56 Ga0070672_100202012 3300005543 Bacteria 1662
57 Ga0070695_101822339 3300005545 Bacteria 511
58 Ga0070696_100001084 3300005546 Bacteria 17566
59 Ga0070693_100339629 3300005547 Bacteria 1025
60 Ga0068855_100002501 3300005563 Bacteria 22640
61 Ga0068854_100136759 3300005578 Bacteria 1876
62 Ga0068854_100421819 3300005578 Bacteria 1108
63 Ga0068852_100064358 3300005616 Bacteria 3196
64 Ga0068859_100204306 3300005617 Bacteria 2060
65 Ga0068866_10020489 3300005718 Bacteria 3031
66 Ga0068858_100629694 3300005842 Bacteria 1042
67 Ga0068860_100229405 3300005843 Bacteria 1804
68 Ga0068860_102369654 3300005843 Bacteria 551
69 Ga0068862_100913830 3300005844 Bacteria 864
70 Ga0081539_10083880 3300005985 Bacteria 1667
71 Ga0070717_10210616 3300006028 Bacteria 1706
72 Ga0070715_10003172 3300006163 Bacteria 5173
73 Ga0070716_100003296 3300006173 Bacteria 7585
74 Ga0070712_100045719 3300006175 Bacteria 3024
75 Ga0075367_10208128 3300006178 Bacteria 1223
76 Ga0097621_100245185 3300006237 Bacteria 1567
77 Ga0097621_100953365 3300006237 Bacteria 801
78 Ga0075370_10159461 3300006353 Bacteria 1324
79 Ga0068871_100702434 3300006358 Bacteria 926
80 Ga0068865_100014042 3300006881 Bacteria 5082
81 Ga0097620_100204308 3300006931 Bacteria 2060
82 Ga0105245_11494859 3300009098 Bacteria 726
83 Ga0105247_10014813 3300009101 Bacteria 4674
84 Ga0105243_10035826 3300009148 Bacteria 3848
85 Ga0105241_10208237 3300009174 Bacteria 1637
86 Ga0105242_10242475 3300009176 Bacteria 1621
87 Ga0105248_10057862 3300009177 Bacteria 4352
88 Ga0157369_10783635 3300013105 Bacteria 980
89 Ga0157369_12035250 3300013105 Bacteria 582
90 Ga0157378_10080997 3300013297 Bacteria 2934
91 Ga0157378_10559325 3300013297 Bacteria 1150
92 Ga0163162_10066222 3300013306 Bacteria 3661
93 Ga0157372_10397324 3300013307 Bacteria 1606
94 Ga0157372_10473322 3300013307 Bacteria 1460
95 Ga0157372_10621983 3300013307 Bacteria 1258
96 Ga0157372_11275274 3300013307 Bacteria 848
97 Ga0157375_10270956 3300013308 Bacteria 1860
98 Ga0163163_10899767 3300014325 Bacteria 948
99 Ga0182008_10055586 3300014497 Bacteria 1957
100 Ga0157376_10242718 3300014969 Bacteria 1679
101 Ga0163161_10074252 3300017792 Bacteria 2493
102 Ga0197907_10235697 3300020069 Bacteria 2276
103 Ga0197907_11098997 3300020069 Bacteria 901
104 Ga0197907_11397142 3300020069 Bacteria 895
105 Ga0206356_10041690 3300020070 Bacteria 613
106 Ga0206356_10905072 3300020070 Bacteria 585
107 Ga0206349_1553782 3300020075 Bacteria 936
108 Ga0206349_1744745 3300020075 Bacteria 652
109 Ga0206355_1002920 3300020076 Bacteria 510
110 Ga0206355_1161676 3300020076 Bacteria 1950
111 Ga0206355_1243399 3300020076 Bacteria 642
112 Ga0206355_1715743 3300020076 Bacteria 886
113 Ga0206351_10995990 3300020077 Bacteria 870
114 Ga0206350_10420774 3300020080 Bacteria 785
115 Ga0206350_10852484 3300020080 Bacteria 918
116 Ga0206354_10182058 3300020081 Bacteria 804
117 Ga0206353_10327414 3300020082 Bacteria 1704
118 Ga0154015_1580655 3300020610 Bacteria 577
119 Ga0224712_10083808 3300022467 Bacteria 1321
120 Ga0224712_10097605 3300022467 Bacteria 1241
121 Ga0224712_10343880 3300022467 Bacteria 704
122 Ga0224712_10363172 3300022467 Bacteria 686
123 Ga0224572_1022549 3300024225 Bacteria 1210
124 Ga0209051_1001152 3300025303 Bacteria 24033
125 Ga0207692_10009166 3300025898 Bacteria 4123
126 Ga0207710_10041024 3300025900 Bacteria 2052
127 Ga0207680_10111766 3300025903 Bacteria 1773
128 Ga0207647_10122176 3300025904 Bacteria 1535
129 Ga0207685_10003552 3300025905 Bacteria 3810
130 Ga0207699_10262784 3300025906 Bacteria 1193
131 Ga0207705_11440852 3300025909 Bacteria 523
132 Ga0207684_10359463 3300025910 Bacteria 1253
133 Ga0207654_10353172 3300025911 Bacteria 1013
134 Ga0207707_10002983 3300025912 Bacteria 15054
135 Ga0207707_10423661 3300025912 Bacteria 1141
136 Ga0207695_10015704 3300025913 Bacteria 8903
137 Ga0207693_10011161 3300025915 Bacteria 7276
138 Ga0207663_10279605 3300025916 Bacteria 1239
139 Ga0207660_10006087 3300025917 Bacteria 7828
140 Ga0207660_10028622 3300025917 Bacteria 3812
141 Ga0207649_11079957 3300025920 Bacteria 633
142 Ga0207652_10001673 3300025921 Bacteria 19421
143 Ga0207681_10057331 3300025923 Bacteria 2662
144 Ga0207644_10198803 3300025931 Bacteria 1580
145 Ga0207686_10084075 3300025934 Bacteria 2084
146 Ga0207669_10651320 3300025937 Bacteria 861
147 Ga0207665_10020487 3300025939 Bacteria 4345
148 Ga0207691_11393674 3300025940 Bacteria 576
149 Ga0207711_10119664 3300025941 Bacteria 2350
150 Ga0207661_10108935 3300025944 Bacteria 2339
151 Ga0207661_10363756 3300025944 Bacteria 1307
152 Ga0207661_10492594 3300025944 Bacteria 1120
153 Ga0207661_10548087 3300025944 Bacteria 1059
154 Ga0207667_10063469 3300025949 Unclassified 3859
155 Ga0207651_10036661 3300025960 Bacteria 3204
156 Ga0207712_10057863 3300025961 Bacteria 2737
157 Ga0207640_10741412 3300025981 Bacteria 846
158 Ga0207703_10052440 3300026035 Bacteria 3312
159 Ga0207639_10181698 3300026041 Bacteria 1790
160 Ga0207678_10275176 3300026067 Bacteria 1444
161 Ga0207678_11491717 3300026067 Bacteria 597
162 Ga0207702_10232096 3300026078 Bacteria 1725
163 Ga0207683_11216226 3300026121 Bacteria 698
164 Ga0268264_10933088 3300028381 Bacteria 872
165 Ga0268264_11303562 3300028381 Bacteria 736
166 Ga0307517_10245548 3300028786 Bacteria 1057
167 Ga0307515_10133959 3300028794 Bacteria 2708
168 Ga0307512_10079055 3300030522 Bacteria 2378
169 Ga0307513_10138681 3300031456 Bacteria 2362
170 Ga0307509_10048076 3300031507 Bacteria 4584
171 Ga0307408_100203937 3300031548 Bacteria 1603
172 Ga0307514_10082216 3300031649 Bacteria 2377
173 Ga0307516_10519879 3300031730 Bacteria 844
174 Ga0307507_10440075 3300033179 Bacteria 724
175 Ga0307510_10012308 3300033180 Bacteria 10147
176 Ga0307510_10112187 3300033180 Bacteria 2464
177 Ga0373959_0020504 3300034820 Bacteria 1262
178 Ga0373931_0040120 3300035691 Bacteria 2455
179 Ga0395899_0209260 3300037312 Bacteria 1356
180 Ga0395900_0399379 3300037418 Bacteria 1339
181 Ga0395898_0026127 3300037466 Bacteria 5877
182 Ga0395898_0088333 3300037466 Unclassified 2984
183 Ga0395901_0066159 3300038443 Bacteria 3765
184 Ga0395901_0092458 3300038443 Bacteria 3167
185 Ga0395901_0111120 3300038443 Bacteria 2878
186 Ga0395901_0120113 3300038443 Bacteria 2762
187 Ga0451802_1796496 3300041460 Bacteria 1153
188 Ga0451804_0324394 3300041463 Bacteria 594
189 Ga0450900_049267 3300042136 Bacteria 643
190 Ga0439458_0000886 3300042157 Bacteria 7737
191 Ga0466965_0057070 3300044683 Bacteria 1945
192 Ga0466966_0077586 3300044684 Bacteria 2073
193 Ga0466961_0138406 3300044693 Bacteria 1525
194 Ga0466963_0003751 3300044694 Bacteria 8748
195 Ga0466963_0005406 3300044694 Bacteria 7480
196 Ga0466963_0294608 3300044694 Bacteria 1141
197 Ga0466971_0116416 3300044719 Bacteria 1235
198 Ga0466968_0120487 3300044735 Bacteria 1187
199 Ga0466957_0010300 3300044842 Bacteria 5359
200 Ga0466957_0033362 3300044842 Bacteria 3089
201 Ga0466959_0006052 3300045049 Bacteria 8349
202 Ga0466958_0051748 3300045836 Bacteria 2487
203 Ga0466967_0024276 3300045976 Bacteria 4982
204 Ga0466967_0044475 3300045976 Bacteria 3852
205 Ga0466967_0202315 3300045976 Bacteria 1881
206 Ga0495617_053292 3300046452 Bacteria 1343
207 Ga0495629_0354440 3300046459 Bacteria 1001
208 Ga0495638_0031490 3300046460 Bacteria 3409
209 Ga0495580_0120259 3300046472 Bacteria 1824
210 Ga0495605_0025438 3300046474 Bacteria 3084
211 Ga0495664_0326676 3300046477 Bacteria 925
212 Ga0495584_0311760 3300046491 Bacteria 799
213 Ga0495585_0354361 3300046492 Bacteria 712
214 Ga0495607_0115178 3300046501 Bacteria 1419
215 Ga0495583_0036459 3300046506 Bacteria 2339
216 Ga0495606_0037977 3300046507 Bacteria 3263
217 Ga0495616_0008376 3300046513 Bacteria 6132
218 Ga0495620_0003368 3300046515 Bacteria 9158
219 Ga0495631_0086121 3300046518 Bacteria 1353
220 Ga0495643_0002749 3300046522 Bacteria 13509
221 Ga0495648_0141922 3300046524 Bacteria 1263
222 Ga0495666_0026436 3300046526 Bacteria 2860
223 Ga0495640_0013438 3300046533 Bacteria 6220
224 Ga0495668_0006551 3300046616 Bacteria 7607
225 Ga0495634_0120537 3300046642 Bacteria 1680
226 Ga0495625_0097559 3300046660 Bacteria 2022
227 Ga0495661_0064191 3300046665 Bacteria 2168
228 Ga0495657_0098794 3300046675 Bacteria 1862
229 Ga0495613_0006692 3300046689 Bacteria 8606
230 Ga0495613_0059359 3300046689 Bacteria 2804
231 Ga0495649_0046170 3300046694 Bacteria 2372
232 Ga0495649_0130341 3300046694 Bacteria 1327
233 Ga0495589_0036252 3300046794 Bacteria 2472
234 Ga0495660_0495905 3300046810 Bacteria 523
235 Ga0495604_0546210 3300047317 Bacteria 747
236 Ga0495686_0148366 3300047472 Bacteria 1378
237 Ga0495602_0223371 3300048088 Bacteria 1420
238 Ga0495626_0032813 3300048091 Bacteria 2491
239 Ga0496100_0126844 3300048903 Bacteria 1792
240 Ga0496100_1189638 3300048903 Bacteria 601
241 Ga0496101_0234005 3300048904 Bacteria 1429
242 Ga0496101_0280393 3300048904 Bacteria 1302
243 Ga0496102_0001221 3300048905 Bacteria 23316
244 Ga0496102_0060178 3300048905 Bacteria 3474
245 Ga0496102_0364730 3300048905 Bacteria 1360
246 Ga0496103_0013449 3300048906 Bacteria 4854
247 Ga0496103_0098872 3300048906 Bacteria 1845
248 Ga0496105_0264687 3300048908 Bacteria 1390
249 Ga0496106_0050530 3300048909 Bacteria 3133
250 Ga0496106_0237471 3300048909 Bacteria 1456
251 Ga0496107_0092829 3300048910 Bacteria 2207
252 Ga0496109_0292727 3300048912 Bacteria 1535
253 Ga0496111_0131417 3300048914 Bacteria 1852
254 Ga0496112_1186960 3300048915 Bacteria 680
255 Ga0496114_0066704 3300048917 Bacteria 3018
256 Ga0496125_0682680 3300048928 Bacteria 548
257 Ga0495678_096768 3300049459 Bacteria 1029
258 Ga0501294_031968 3300049517 Bacteria 618
259 Ga0501296_033980 3300049519 Bacteria 697
260 Ga0501298_108663 3300049521 Bacteria 641
261 Ga0501032_0230516 3300049569 Bacteria 1204
262 Ga0501033_0053015 3300049570 Bacteria 3005
263 Ga0501033_0361809 3300049570 Bacteria 1015
264 Ga0501033_0966111 3300049570 Bacteria 570
265 Ga0501034_0173004 3300049571 Bacteria 2126
266 Ga0501037_0212490 3300049573 Bacteria 1364
267 Ga0501038_0220004 3300049574 Bacteria 1515
268 Ga0501038_0324853 3300049574 Bacteria 1203
269 Ga0501040_0289034 3300049576 Bacteria 1171
270 Ga0501041_0104381 3300049577 Bacteria 1756
271 Ga0501046_0321709 3300049580 Bacteria 1127
272 Ga0501047_0024855 3300049581 Bacteria 5752
273 Ga0501069_0297105 3300049585 Bacteria 947
274 Ga0501070_0145489 3300049586 Bacteria 1956
275 Ga0501070_0379169 3300049586 Bacteria 1146
276 Ga0501070_0575937 3300049586 Bacteria 899
277 Ga0501070_0701318 3300049586 Bacteria 800
278 Ga0501072_0512907 3300049588 Bacteria 948
279 Ga0501074_0155260 3300049590 Bacteria 1635
280 Ga0501080_0096915 3300049742 Bacteria 2739
281 Ga0501081_0514114 3300049743 Bacteria 893
282 Ga0501044_0014612 3300049823 Bacteria 8466
283 Ga0501044_0105961 3300049823 Bacteria 2824
284 nmdc:mga03n38_3316_c1 3300050490 Bacteria 5151
285 nmdc:mga06z11_311957_c1 3300050494 Bacteria 937
286 nmdc:mga06z11_749701_c1 3300050494 Bacteria 595
287 Ga0500583_0254722 3300053092 Bacteria 866
288 Ga0500555_010815 3300053103 Bacteria 2619
289 Ga0500604_0036549 3300053151 Bacteria 1465
290 Ga0500622_0186539 3300053156 Bacteria 954
291 Ga0500622_0281931 3300053156 Bacteria 716
292 Ga0501084_0666368 3300054114 Bacteria 878
293 Ga0501084_1059154 3300054114 Bacteria 681
294 Ga0501082_0154150 3300060353 Bacteria 1996
295 Ga0501082_0526878 3300060353 Bacteria 1033
296 Ga0530510_0098236 3300061734 Bacteria 2141
297 Ga0530510_0565262 3300061734 Bacteria 864
298 2548698170 2547132424 Bacteria 8348532
299 2585315137 2582581314 Bacteria 11452267
300 2616696356 2616644814 Bacteria 11555299
301 2738664630 2738541264 Bacteria 5935393
302 2739143765 2738541356 Bacteria 5935017
303 2785374120 2784746768 Bacteria 10036182
304 2862282719 2862281513 Bacteria 9621493
305 2997459219 2997451912 Bacteria 8492419
306 8025536027 8025530807 Bacteria 8495698
307 8056668472 8056667051 Bacteria 6953971
308 Ga0207664_10453760
309 JGI24746J21847_1007119
310 JGI24745J21846_1002001
311 Ga0055540_1001265
312 Ga0058861_11324604
313 Ga0058862_12023591
314 Ga0070658_11063862
315 Ga0070676_10175167
316 Ga0070683_100024630
317 Ga0070683_100188191
318 Ga0070683_100401607
319 Ga0070683_101002457
320 Ga0070690_100297880
321 Ga0070666_10295331
322 Ga0070680_100029318
323 Ga0070680_100331490
324 Ga0070682_100213824
325 Ga0070682_100841834
326 Ga0068868_100147227
327 Ga0070691_10194904
328 Ga0070661_100105225
329 Ga0070692_10202730
330 Ga0070669_100483661
331 Ga0070671_100018236
332 Ga0070673_100003613
333 Ga0070709_10089578
334 Ga0070714_100028225
335 Ga0070714_100486976
336 Ga0070713_100283029
337 Ga0070710_10398773
338 Ga0070711_100024452
339 Ga0070694_100455657
340 Ga0070663_100319724
341 Ga0070663_100918624
342 Ga0070678_100030402
343 Ga0070678_100584086
344 Ga0070662_100229104
345 Ga0070662_100489687
346 Ga0070681_10007770
347 Ga0070681_10146056
348 Ga0070681_10205403
349 Ga0068867_100764091
350 Ga0070685_10889045
351 Ga0070706_100244357
352 Ga0070679_100016814
353 Ga0070679_100208357
354 Ga0070679_100242625
355 Ga0070679_100708211
356 Ga0070679_100984642
357 Ga0070679_101230065
358 Ga0070684_100123265
359 Ga0070684_101410172
360 Ga0070697_100429026
361 Ga0070697_100474613
362 Ga0068853_101392274
363 Ga0070672_100202012
364 Ga0070695_101822339
365 Ga0070696_100001084
366 Ga0070693_100339629
367 Ga0068855_100002501
368 Ga0068854_100136759
369 Ga0068854_100421819
370 Ga0068852_100064358
371 Ga0068859_100204306
372 Ga0068866_10020489
373 Ga0068858_100629694
374 Ga0068860_100229405
375 Ga0068860_102369654
376 Ga0068862_100913830
377 Ga0081539_10083880
378 Ga0070717_10210616
379 Ga0070715_10003172
380 Ga0070716_100003296
381 Ga0070712_100045719
382 Ga0075367_10208128
383 Ga0097621_100245185
384 Ga0097621_100953365
385 Ga0075370_10159461
386 Ga0068871_100702434
387 Ga0068865_100014042
388 Ga0097620_100204308
389 Ga0105245_11494859
390 Ga0105247_10014813
391 Ga0105243_10035826
392 Ga0105241_10208237
393 Ga0105242_10242475
394 Ga0105248_10057862
395 Ga0157369_10783635
396 Ga0157369_12035250
397 Ga0157378_10080997
398 Ga0157378_10559325
399 Ga0163162_10066222
400 Ga0157372_10397324
401 Ga0157372_10473322
402 Ga0157372_10621983
403 Ga0157372_11275274
404 Ga0157375_10270956
405 Ga0163163_10899767
406 Ga0182008_10055586
407 Ga0157376_10242718
408 Ga0163161_10074252
409 Ga0197907_10235697
410 Ga0197907_11098997
411 Ga0197907_11397142
412 Ga0206356_10041690
413 Ga0206356_10905072
414 Ga0206349_1553782
415 Ga0206349_1744745
416 Ga0206355_1002920
417 Ga0206355_1161676
418 Ga0206355_1243399
419 Ga0206355_1715743
420 Ga0206351_10995990
421 Ga0206350_10420774
422 Ga0206350_10852484
423 Ga0206354_10182058
424 Ga0206353_10327414
425 Ga0154015_1580655
426 Ga0224712_10083808
427 Ga0224712_10097605
428 Ga0224712_10343880
429 Ga0224712_10363172
430 Ga0224572_1022549
431 Ga0209051_1001152
432 Ga0207692_10009166
433 Ga0207710_10041024
434 Ga0207680_10111766
435 Ga0207647_10122176
436 Ga0207685_10003552
437 Ga0207699_10262784
438 Ga0207705_11440852
439 Ga0207684_10359463
440 Ga0207654_10353172
441 Ga0207707_10002983
442 Ga0207707_10423661
443 Ga0207695_10015704
444 Ga0207693_10011161
445 Ga0207663_10279605
446 Ga0207660_10006087
447 Ga0207660_10028622
448 Ga0207649_11079957
449 Ga0207652_10001673
450 Ga0207681_10057331
451 Ga0207644_10198803
452 Ga0207686_10084075
453 Ga0207669_10651320
454 Ga0207665_10020487
455 Ga0207691_11393674
456 Ga0207711_10119664
457 Ga0207661_10108935
458 Ga0207661_10363756
459 Ga0207661_10492594
460 Ga0207661_10548087
461 Ga0207667_10063469
462 Ga0207651_10036661
463 Ga0207712_10057863
464 Ga0207640_10741412
465 Ga0207703_10052440
466 Ga0207639_10181698
467 Ga0207678_10275176
468 Ga0207678_11491717
469 Ga0207702_10232096
470 Ga0207683_11216226
471 Ga0268264_10933088
472 Ga0268264_11303562
473 Ga0307517_10245548
474 Ga0307515_10133959
475 Ga0307512_10079055
476 Ga0307513_10138681
477 Ga0307509_10048076
478 Ga0307408_100203937
479 Ga0307514_10082216
480 Ga0307516_10519879
481 Ga0307507_10440075
482 Ga0307510_10012308
483 Ga0307510_10112187
484 Ga0373959_0020504
485 Ga0373931_0040120
486 Ga0395899_0209260
487 Ga0395900_0399379
488 Ga0395898_0026127
489 Ga0395898_0088333
490 Ga0395901_0066159
491 Ga0395901_0092458
492 Ga0395901_0111120
493 Ga0395901_0120113
494 Ga0451802_1796496
495 Ga0451804_0324394
496 Ga0450900_049267
497 Ga0439458_0000886
498 Ga0466965_0057070
499 Ga0466966_0077586
500 Ga0466961_0138406
501 Ga0466963_0003751
502 Ga0466963_0005406
503 Ga0466963_0294608
504 Ga0466971_0116416
505 Ga0466968_0120487
506 Ga0466957_0010300
507 Ga0466957_0033362
508 Ga0466959_0006052
509 Ga0466958_0051748
510 Ga0466967_0024276
511 Ga0466967_0044475
512 Ga0466967_0202315
513 Ga0495617_053292
514 Ga0495629_0354440
515 Ga0495638_0031490
516 Ga0495580_0120259
517 Ga0495605_0025438
518 Ga0495664_0326676
519 Ga0495584_0311760
520 Ga0495585_0354361
521 Ga0495607_0115178
522 Ga0495583_0036459
523 Ga0495606_0037977
524 Ga0495616_0008376
525 Ga0495620_0003368
526 Ga0495631_0086121
527 Ga0495643_0002749
528 Ga0495648_0141922
529 Ga0495666_0026436
530 Ga0495640_0013438
531 Ga0495668_0006551
532 Ga0495634_0120537
533 Ga0495625_0097559
534 Ga0495661_0064191
535 Ga0495657_0098794
536 Ga0495613_0006692
537 Ga0495613_0059359
538 Ga0495649_0046170
539 Ga0495649_0130341
540 Ga0495589_0036252
541 Ga0495660_0495905
542 Ga0495604_0546210
543 Ga0495686_0148366
544 Ga0495602_0223371
545 Ga0495626_0032813
546 Ga0496100_0126844
547 Ga0496100_1189638
548 Ga0496101_0234005
549 Ga0496101_0280393
550 Ga0496102_0001221
551 Ga0496102_0060178
552 Ga0496102_0364730
553 Ga0496103_0013449
554 Ga0496103_0098872
555 Ga0496105_0264687
556 Ga0496106_0050530
557 Ga0496106_0237471
558 Ga0496107_0092829
559 Ga0496109_0292727
560 Ga0496111_0131417
561 Ga0496112_1186960
562 Ga0496114_0066704
563 Ga0496125_0682680
564 Ga0495678_096768
565 Ga0501294_031968
566 Ga0501296_033980
567 Ga0501298_108663
568 Ga0501032_0230516
569 Ga0501033_0053015
570 Ga0501033_0361809
571 Ga0501033_0966111
572 Ga0501034_0173004
573 Ga0501037_0212490
574 Ga0501038_0220004
575 Ga0501038_0324853
576 Ga0501040_0289034
577 Ga0501041_0104381
578 Ga0501046_0321709
579 Ga0501047_0024855
580 Ga0501069_0297105
581 Ga0501070_0145489
582 Ga0501070_0379169
583 Ga0501070_0575937
584 Ga0501070_0701318
585 Ga0501072_0512907
586 Ga0501074_0155260
587 Ga0501080_0096915
588 Ga0501081_0514114
589 Ga0501044_0014612
590 Ga0501044_0105961
591 nmdc:mga03n38_3316_c1
592 nmdc:mga06z11_311957_c1
593 nmdc:mga06z11_749701_c1
594 Ga0500583_0254722
595 Ga0500555_010815
596 Ga0500604_0036549
597 Ga0500622_0186539
598 Ga0500622_0281931
599 Ga0501084_0666368
600 Ga0501084_1059154
601 Ga0501082_0154150
602 Ga0501082_0526878
603 Ga0530510_0098236
604 Ga0530510_0565262
605 2548698170
606 2585315137
607 2616696356
608 2738664630
609 2739143765
610 2785374120
611 2862282719
612 2997459219
613 8025536027
614 8056668472

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07080

DUF1348

Protein of unknown function (DUF1348)

9

137

0.98

PF12680

SnoaL_2

SnoaL-like domain

20

120

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2imj-assembly2.cif.gz_D x-ray crystal structure of protein pfl_3262 from pseudomonas fluorescens. northeast structural genomics consortium target plr14. 0.9443 1 148
4hvn-assembly1.cif.gz_B crystal structure of hypothetical protein with ketosteroid isomerase-like protein fold from catenulispora acidiphila dsm 44928 in complex with trimethylamine. 0.8836 20 124
6uad-assembly1.cif.gz_A ketosteroid isomerase (c. testosteroni) with truncated & designed loop for precise positioning of a catalytic e38 0.8797 11 126
3ipt-assembly2.cif.gz_D crystal structure of ketosteroid isomerase y16s/d40n from pseudomonas putida with bound equilenin 0.8712 12 123
1ohp-assembly2.cif.gz_C crystal structure of 5-3-ketosteroid isomerase mutant d38n from pseudomonas testosteroni complexed with 5alpha-estran-3,17-dione 0.8586 11 126
ID Description Score Start End Superfamily
2imjD01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9587 12 148 3.10.450.50
2imjD01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9318 12 148 3.10.450.50
af_A0A1D8PLG7_12_136_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8701 35 126 3.10.450.50
4u13B00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8653 20 124 3.10.450.50
af_A0A1D8PLG7_39_140_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8652 38 126 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A7I8ENZ9-F1-model_v4 DUF4440 domain-containing protein 1.004 8 96
AF-A0A1H4QTG3-F1-model_v4 SnoaL-like domain-containing protein 1.002 7 137
AF-A0A7Y7B283-F1-model_v4 Nuclear transport factor 2 family protein 1.002 11 136
AF-A0A0H1B429-F1-model_v4 DUF4440 domain-containing protein 1.002 8 92
AF-A0A1W2CS99-F1-model_v4 DUF4440 domain-containing protein 1.001 8 136

Map