F399221

General Info

Members Datasets Scaffolds Average Seq Length
307 210 614 359

Family's Representative Sequence

Representative Sequence 3300025913|Ga0207695_10037244|Ga0207695_100372444
Length 399
Sequence LPGSSQYGLDGHLGSEYATDTVNVMKRRDFILYFSTAVPAASTLTTVSRWSAARAAEPALPAAEGWRTFEVVTSVDIASPAGKTLLWVPLPSNAVTDYQRLLDVKWETPGATKAEIATVPGYDVRLLRXXXADPSALGPVSVKTRVATRDRQVDISSTTKHQRGAAHESESVLQTYLRPTSLMPTDGIVRDTALKITRGAQGDVEKARALYEWVVENTNRDPKVAGCGLGDIASLLKSGYLGGKCADLNGLFVAMCRSLGIPARDSYGVRIADSRLGFQCLGKRGDISKAQHCRAEFYTPSLGWVPVDPADVRKLVLEEEGGLPLTSPKVQAARTLLFGAWEMNWLVYNHGHDVALPGSRGLPLPFLMYPNSETAEGRLDSLNPVTFRYEIHSRQVEEA

Samples

Sample ID Description Type Environment
1 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
54 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
79 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
80 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
115 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
116 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
117 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
118 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
119 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
120 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
121 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
127 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
128 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
129 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
130 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
131 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
132 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
133 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
134 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
135 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
136 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
137 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
138 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
139 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
140 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
141 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
142 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
143 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
144 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
145 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
146 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
147 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
148 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
149 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
150 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
151 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
152 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
153 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
154 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
155 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
156 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
157 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
160 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
161 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
162 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
163 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
164 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
165 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
166 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
172 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
173 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
174 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
175 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
176 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
177 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
178 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
179 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
180 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
181 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
182 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
183 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
184 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
185 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
187 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
188 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
189 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
190 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
191 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
192 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
193 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
194 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
195 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
196 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
197 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
198 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
199 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
200 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
201 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
202 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
203 2738543013 Variovorax sp. BT01 Isolate Unclassified
204 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
205 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
206 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
207 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
208 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
209 639633007 Azoarcus olearius BH72 Isolate Unclassified
210 8055693939 Hafnia alvei A23BA Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.07
Metatranscriptomes 0
Isolates 2.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.28
Nodule 0.33
Rhizoplane 1.3
Rhizosphere 92.18
Stem 0
Stem Tuber 0
Unclassified 0.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207695_10037244 3300025913 Bacteria 5249
2 Ga0065704_10082677 3300005289 Bacteria 3567
3 Ga0070683_100139244 3300005329 Bacteria 2299
4 Ga0070677_10101694 3300005333 Bacteria 1268
5 Ga0068869_100168999 3300005334 Bacteria 1707
6 Ga0068868_100102094 3300005338 Bacteria 2322
7 Ga0070668_100279163 3300005347 Bacteria 1395
8 Ga0070669_100001305 3300005353 Bacteria 17985
9 Ga0070675_100345316 3300005354 Bacteria 1319
10 Ga0070674_100003307 3300005356 Bacteria 9023
11 Ga0070673_100226378 3300005364 Bacteria 1621
12 Ga0070688_100260884 3300005365 Bacteria 1237
13 Ga0070667_100048902 3300005367 Bacteria 3561
14 Ga0070714_100120009 3300005435 Bacteria 2338
15 Ga0070713_100007962 3300005436 Bacteria 7487
16 Ga0070701_10029248 3300005438 Bacteria 2715
17 Ga0070700_100078148 3300005441 Bacteria 2130
18 Ga0070708_100115027 3300005445 Bacteria 2476
19 Ga0070663_100082458 3300005455 Bacteria 2366
20 Ga0070678_100217092 3300005456 Bacteria 1588
21 Ga0070678_100454084 3300005456 Bacteria 1123
22 Ga0070662_100195231 3300005457 Bacteria 1603
23 Ga0070681_10002009 3300005458 Bacteria 18419
24 Ga0068867_100089736 3300005459 Bacteria 2331
25 Ga0068867_100161882 3300005459 Bacteria 1765
26 Ga0068867_100199522 3300005459 Bacteria 1601
27 Ga0068867_100247821 3300005459 Bacteria 1447
28 Ga0070685_10000465 3300005466 Bacteria 23628
29 Ga0070679_100215435 3300005530 Bacteria 1883
30 Ga0070697_100031945 3300005536 Bacteria 4236
31 Ga0070672_100044788 3300005543 Bacteria 3419
32 Ga0070672_100170930 3300005543 Bacteria 1807
33 Ga0070693_100014088 3300005547 Bacteria 4088
34 Ga0070693_100061220 3300005547 Bacteria 2187
35 Ga0070665_100000095 3300005548 Bacteria 170459
36 Ga0068855_100011329 3300005563 Bacteria 10764
37 Ga0068855_100016439 3300005563 Bacteria 8895
38 Ga0068855_100067353 3300005563 Bacteria 4172
39 Ga0068855_100358107 3300005563 Bacteria 1606
40 Ga0068855_100431888 3300005563 Bacteria 1439
41 Ga0068855_100540107 3300005563 Bacteria 1263
42 Ga0068856_100124567 3300005614 Bacteria 2580
43 Ga0068852_100335521 3300005616 Bacteria 1472
44 Ga0068859_100068936 3300005617 Bacteria 3571
45 Ga0068864_100042106 3300005618 Bacteria 3907
46 Ga0068864_100360528 3300005618 Bacteria 1374
47 Ga0068866_10125122 3300005718 Bacteria 1454
48 Ga0068870_10046967 3300005840 Bacteria 2267
49 Ga0068863_100200370 3300005841 Bacteria 1920
50 Ga0068858_100048135 3300005842 Bacteria 3951
51 Ga0068858_100069220 3300005842 Bacteria 3271
52 Ga0068860_100026230 3300005843 Bacteria 5618
53 Ga0068860_100154383 3300005843 Bacteria 2212
54 Ga0068860_100202741 3300005843 Bacteria 1923
55 Ga0081540_1040869 3300005983 Bacteria 2412
56 Ga0070716_100046113 3300006173 Bacteria 2451
57 Ga0075369_10002574 3300006186 Bacteria 6488
58 Ga0075366_10001914 3300006195 Bacteria 10526
59 Ga0097621_100022914 3300006237 Bacteria 4853
60 Ga0068871_100039106 3300006358 Bacteria 3794
61 Ga0068871_100319648 3300006358 Bacteria 1366
62 Ga0075428_100001063 3300006844 Bacteria 29141
63 Ga0075428_100219337 3300006844 Bacteria 2054
64 Ga0075431_100000702 3300006847 Bacteria 28871
65 Ga0075431_100013163 3300006847 Bacteria 8358
66 Ga0075434_100105451 3300006871 Bacteria 2829
67 Ga0075434_100120286 3300006871 Bacteria 2641
68 Ga0075434_100160049 3300006871 Bacteria 2271
69 Ga0075429_100018533 3300006880 Bacteria 6028
70 Ga0075436_100002506 3300006914 Bacteria 12629
71 Ga0075436_100007155 3300006914 Bacteria 7634
72 Ga0075436_100087383 3300006914 Bacteria 2166
73 Ga0097620_100068939 3300006931 Bacteria 3571
74 Ga0075435_100092746 3300007076 Bacteria 2494
75 Ga0075435_100149856 3300007076 Bacteria 1960
76 Ga0075435_100296395 3300007076 Bacteria 1382
77 Ga0099794_10021259 3300007265 Bacteria 2946
78 Ga0099795_10039504 3300007788 Bacteria 1671
79 Ga0105240_10000685 3300009093 Bacteria 62397
80 Ga0105240_10015537 3300009093 Bacteria 10349
81 Ga0105240_10025063 3300009093 Bacteria 7851
82 Ga0105240_10222679 3300009093 Bacteria 2197
83 Ga0111539_10001710 3300009094 Bacteria 29206
84 Ga0105245_10014975 3300009098 Bacteria 6756
85 Ga0105245_10079259 3300009098 Bacteria 2998
86 Ga0105245_10154353 3300009098 Bacteria 2173
87 Ga0105247_10008260 3300009101 Bacteria 6354
88 Ga0114129_10045400 3300009147 Bacteria 6177
89 Ga0114129_10076543 3300009147 Bacteria 4658
90 Ga0114129_10086715 3300009147 Bacteria 4342
91 Ga0105243_10024239 3300009148 Bacteria 4628
92 Ga0105241_10036445 3300009174 Bacteria 3701
93 Ga0105241_10084551 3300009174 Bacteria 2491
94 Ga0105242_10035852 3300009176 Bacteria 3978
95 Ga0105248_10111171 3300009177 Bacteria 3090
96 Ga0105238_10089981 3300009551 Bacteria 3056
97 Ga0105238_10100836 3300009551 Bacteria 2870
98 Ga0105238_10135897 3300009551 Bacteria 2436
99 Ga0105249_10344195 3300009553 Bacteria 1509
100 Ga0105239_10041745 3300010375 Bacteria 5027
101 Ga0105239_10221457 3300010375 Bacteria 2122
102 Ga0105239_10520956 3300010375 Bacteria 1353
103 Ga0105246_10072633 3300011119 Bacteria 2426
104 Ga0157374_10013777 3300013296 Bacteria 7062
105 Ga0157378_10033349 3300013297 Bacteria 4551
106 Ga0163162_10000014 3300013306 Bacteria 268371
107 Ga0163162_10001956 3300013306 Bacteria 19340
108 Ga0163162_10075523 3300013306 Bacteria 3431
109 Ga0157372_10203609 3300013307 Bacteria 2293
110 Ga0157375_10004537 3300013308 Bacteria 12063
111 Ga0157375_10170946 3300013308 Bacteria 2321
112 Ga0163163_10239622 3300014325 Unclassified 1863
113 Ga0157380_10101082 3300014326 Bacteria 2402
114 Ga0157379_10025984 3300014968 Bacteria 5208
115 Ga0157379_10104662 3300014968 Bacteria 2540
116 Ga0157379_10239825 3300014968 Bacteria 1644
117 Ga0157376_10002046 3300014969 Bacteria 13533
118 Ga0157376_10075689 3300014969 Bacteria 2873
119 Ga0157376_10465109 3300014969 Bacteria 1237
120 Ga0163161_10072970 3300017792 Bacteria 2514
121 Ga0213875_10002025 3300021388 Bacteria 12485
122 Ga0209233_1009448 3300025261 Bacteria 2967
123 Ga0207692_10108511 3300025898 Bacteria 1536
124 Ga0207699_10066817 3300025906 Bacteria 2184
125 Ga0207699_10247248 3300025906 Bacteria 1228
126 Ga0207645_10128800 3300025907 Bacteria 1646
127 Ga0207643_10112704 3300025908 Bacteria 1604
128 Ga0207707_10037098 3300025912 Bacteria 4259
129 Ga0207695_10000007 3300025913 Bacteria 1092551
130 Ga0207695_10014479 3300025913 Bacteria 9336
131 Ga0207693_10101085 3300025915 Bacteria 2261
132 Ga0207662_10131421 3300025918 Bacteria 1579
133 Ga0207652_10274494 3300025921 Bacteria 1521
134 Ga0207681_10242492 3300025923 Bacteria 1403
135 Ga0207694_10032201 3300025924 Bacteria 4011
136 Ga0207694_10115177 3300025924 Bacteria 2142
137 Ga0207659_10055695 3300025926 Bacteria 2829
138 Ga0207659_10415659 3300025926 Bacteria 1127
139 Ga0207687_10195405 3300025927 Bacteria 1578
140 Ga0207700_10395625 3300025928 Bacteria 1210
141 Ga0207664_10038704 3300025929 Bacteria 3699
142 Ga0207686_10039454 3300025934 Bacteria 2865
143 Ga0207704_10282545 3300025938 Bacteria 1262
144 Ga0207665_10001851 3300025939 Bacteria 14241
145 Ga0207691_10050292 3300025940 Bacteria 3816
146 Ga0207691_10137528 3300025940 Bacteria 2154
147 Ga0207691_10317550 3300025940 Bacteria 1336
148 Ga0207711_10011720 3300025941 Bacteria 7282
149 Ga0207667_10006743 3300025949 Bacteria 13861
150 Ga0207667_10018050 3300025949 Bacteria 7923
151 Ga0207667_10070433 3300025949 Bacteria 3639
152 Ga0207667_10169434 3300025949 Bacteria 2244
153 Ga0207667_10224468 3300025949 Bacteria 1924
154 Ga0207658_10057512 3300025986 Bacteria 2890
155 Ga0207703_10026822 3300026035 Bacteria 4538
156 Ga0207708_10045116 3300026075 Bacteria 3359
157 Ga0207708_10192002 3300026075 Bacteria 1626
158 Ga0207641_10173374 3300026088 Bacteria 1971
159 Ga0207641_10255946 3300026088 Bacteria 1637
160 Ga0207648_10005322 3300026089 Bacteria 12979
161 Ga0207648_10023193 3300026089 Bacteria 5565
162 Ga0207648_10095026 3300026089 Bacteria 2607
163 Ga0207648_10221704 3300026089 Bacteria 1681
164 Ga0207676_10127954 3300026095 Bacteria 2154
165 Ga0207674_10058364 3300026116 Bacteria 3910
166 Ga0207675_100081835 3300026118 Bacteria 3028
167 Ga0207683_10041339 3300026121 Bacteria 4025
168 Ga0207698_10198179 3300026142 Bacteria 1795
169 Ga0209588_1027931 3300027671 Bacteria 1795
170 Ga0209974_10031984 3300027876 Bacteria 1743
171 Ga0268266_10000001 3300028379 Bacteria 4040580
172 Ga0268264_10012748 3300028381 Bacteria 6917
173 Ga0268264_10125084 3300028381 Bacteria 2271
174 Ga0373929_0018832 3300035085 Unclassified 1376
175 Ga0373934_0000089 3300035086 Bacteria 31589
176 Ga0373934_0055868 3300035086 Bacteria 1569
177 Ga0373923_0001361 3300035111 Bacteria 6955
178 Ga0373954_0000626 3300035118 Bacteria 13489
179 Ga0373956_0000060 3300035119 Bacteria 37581
180 Ga0373956_0004409 3300035119 Bacteria 5632
181 Ga0373946_0010119 3300035171 Bacteria 3487
182 Ga0373935_0006781 3300035692 Bacteria 6840
183 Ga0373933_0001102 3300035724 Bacteria 16108
184 Ga0373937_0000723 3300036401 Bacteria 28712
185 Ga0395900_0266528 3300037418 Bacteria 1709
186 Ga0395900_0371307 3300037418 Bacteria 1400
187 Ga0436364_1416468 3300037853 Bacteria 30239
188 Ga0395901_0106697 3300038443 Bacteria 2940
189 Ga0395901_0191284 3300038443 Bacteria 2146
190 Ga0436360_0766743 3300039438 Bacteria 2171
191 Ga0495592_0040761 3300046454 Bacteria 3483
192 Ga0495629_0247151 3300046459 Bacteria 1228
193 Ga0495641_0005546 3300046461 Bacteria 8473
194 Ga0495651_0000475 3300046462 Bacteria 30862
195 Ga0495651_0006933 3300046462 Bacteria 8663
196 Ga0495580_0000015 3300046472 Bacteria 94575
197 Ga0495580_0024284 3300046472 Bacteria 4441
198 Ga0495664_0308673 3300046477 Bacteria 954
199 Ga0495608_0191613 3300046511 Bacteria 1290
200 Ga0495618_0242152 3300046514 Bacteria 1133
201 Ga0495628_0000483 3300046516 Bacteria 36474
202 Ga0495628_0003571 3300046516 Bacteria 13916
203 Ga0495628_0004948 3300046516 Bacteria 11720
204 Ga0495630_0005606 3300046517 Bacteria 8865
205 Ga0495643_0012969 3300046522 Bacteria 5007
206 Ga0495642_0001989 3300046528 Bacteria 8548
207 Ga0495642_0047328 3300046528 Bacteria 1761
208 Ga0495652_0006195 3300046529 Bacteria 11159
209 Ga0495652_0040120 3300046529 Bacteria 4046
210 Ga0495586_0005034 3300046535 Bacteria 7073
211 Ga0495587_0037786 3300046536 Bacteria 2897
212 Ga0495621_0009425 3300046539 Bacteria 2963
213 Ga0495621_0017502 3300046539 Bacteria 2318
214 Ga0495645_0000423 3300046543 Bacteria 29063
215 Ga0495645_0105312 3300046543 Bacteria 2002
216 Ga0495667_0173366 3300046559 Bacteria 1385
217 Ga0495634_0188327 3300046642 Bacteria 1288
218 Ga0495659_0079429 3300046664 Bacteria 1243
219 Ga0495657_0036240 3300046675 Bacteria 3411
220 Ga0495657_0127538 3300046675 Bacteria 1597
221 Ga0495599_0001525 3300046678 Bacteria 13317
222 Ga0495599_0010563 3300046678 Bacteria 5650
223 Ga0495599_0040414 3300046678 Bacteria 2929
224 Ga0495658_0058295 3300046683 Bacteria 2208
225 Ga0495669_0072305 3300046684 Bacteria 1574
226 Ga0495600_0035075 3300046809 Bacteria 3257
227 Ga0495581_0040975 3300047315 Bacteria 2680
228 Ga0495674_0009364 3300047319 Bacteria 9309
229 Ga0495687_003399 3300047443 Bacteria 11588
230 Ga0495675_0002636 3300047444 Bacteria 10750
231 Ga0495593_0051079 3300047673 Bacteria 2189
232 Ga0495614_0010958 3300048089 Bacteria 3990
233 Ga0496104_0209806 3300048907 Bacteria 1859
234 Ga0496105_0076649 3300048908 Bacteria 2761
235 Ga0496109_0109546 3300048912 Bacteria 2567
236 Ga0496110_0014924 3300048913 Bacteria 6457
237 Ga0496116_0001200 3300048919 Bacteria 30339
238 Ga0496118_0052510 3300048921 Bacteria 3108
239 Ga0496125_0001761 3300048928 Bacteria 30044
240 Ga0496126_0085723 3300048929 Bacteria 2776
241 Ga0496126_0197987 3300048929 Bacteria 1698
242 Ga0501034_0013268 3300049571 Bacteria 8488
243 Ga0501034_0063021 3300049571 Bacteria 3722
244 Ga0501036_0018378 3300049572 Bacteria 5856
245 Ga0501036_0337955 3300049572 Bacteria 1258
246 Ga0501041_0034211 3300049577 Bacteria 3076
247 Ga0501041_0114820 3300049577 Bacteria 1672
248 Ga0501046_0083525 3300049580 Bacteria 2465
249 Ga0501047_0057515 3300049581 Bacteria 3760
250 Ga0501067_0084420 3300049583 Bacteria 1761
251 Ga0501068_0021693 3300049584 Bacteria 3753
252 Ga0501069_0053397 3300049585 Bacteria 2250
253 Ga0501070_0001072 3300049586 Bacteria 24500
254 Ga0501070_0169954 3300049586 Bacteria 1796
255 Ga0501070_0196226 3300049586 Bacteria 1658
256 Ga0501071_0004608 3300049587 Bacteria 8748
257 Ga0501072_0082530 3300049588 Bacteria 2548
258 Ga0501073_0002184 3300049589 Bacteria 14627
259 Ga0501073_0093488 3300049589 Bacteria 2089
260 Ga0501074_0040014 3300049590 Bacteria 3395
261 Ga0501074_0040673 3300049590 Bacteria 3366
262 Ga0501075_0015049 3300049591 Bacteria 5549
263 Ga0501075_0026771 3300049591 Bacteria 4247
264 Ga0501076_0003520 3300049592 Bacteria 11003
265 Ga0501077_0001815 3300049593 Bacteria 12903
266 Ga0501079_0004184 3300049741 Bacteria 10698
267 Ga0501079_0012004 3300049741 Bacteria 6612
268 Ga0501080_0042455 3300049742 Bacteria 4234
269 Ga0501080_0148219 3300049742 Bacteria 2169
270 Ga0501083_0029529 3300049744 Bacteria 3769
271 Ga0501035_0204327 3300049822 Bacteria 1693
272 Ga0501044_0094061 3300049823 Bacteria 3022
273 Ga0501044_0165566 3300049823 Bacteria 2185
274 nmdc:mga0k408_9567_c1 3300050493 Bacteria 5229
275 nmdc:mga07m45_19514_c1 3300050496 Bacteria 3674
276 nmdc:mga05p37_157166_c1 3300050507 Bacteria 2778
277 nmdc:mga05p37_285882_c1 3300050507 Bacteria 1965
278 nmdc:mga06r32_49167_c1 3300050510 Bacteria 4032
279 nmdc:mga06r32_7729_c1 3300050510 Bacteria 9667
280 nmdc:mga08y16_4009_c1 3300050511 Bacteria 15352
281 nmdc:mga0n895_138613_c1 3300050512 Bacteria 2460
282 nmdc:mga0n895_159151_c1 3300050512 Bacteria 2289
283 nmdc:mga0n895_3515_c1 3300050512 Bacteria 12662
284 nmdc:mga0rr50_56438_c1 3300050513 Bacteria 2934
285 nmdc:mga08x19_161320_c1 3300050514 Bacteria 1523
286 nmdc:mga08x19_19294_c1 3300050514 Bacteria 4182
287 nmdc:mga08x19_1933_c1 3300050514 Bacteria 12677
288 nmdc:mga08x19_32995_c1 3300050514 Bacteria 3266
289 nmdc:mga08x19_61963_c1 3300050514 Bacteria 2424
290 nmdc:mga0sz30_68108_c1 3300050516 Bacteria 1529
291 Ga0495601_0062572 3300053077 Bacteria 2364
292 Ga0495619_0078079 3300053085 Bacteria 2225
293 Ga0500637_0067495 3300053178 Bacteria 2055
294 Ga0501084_0011513 3300054114 Bacteria 7324
295 Ga0501084_0139533 3300054114 Bacteria 2041
296 Ga0501082_0002568 3300060353 Bacteria 15888
297 Ga0501082_0017219 3300060353 Bacteria 6227
298 Ga0530510_0148577 3300061734 Bacteria 1729
299 2671692751 2671180139 Bacteria 4196045
300 2739248953 2738543013 Bacteria 5618633
301 2842721558 2842718218 Bacteria 4560148
302 2891635132 2891633521 Bacteria 4602265
303 2894027698 2894023352 Bacteria 5167372
304 2932424822 2932422444 Bacteria 4678430
305 2974320818 2974320154 Bacteria 4571377
306 639785209 639633007 Bacteria 4376040
307 8055697694 8055693939 Bacteria 4772047
308 Ga0207695_10037244
309 Ga0065704_10082677
310 Ga0070683_100139244
311 Ga0070677_10101694
312 Ga0068869_100168999
313 Ga0068868_100102094
314 Ga0070668_100279163
315 Ga0070669_100001305
316 Ga0070675_100345316
317 Ga0070674_100003307
318 Ga0070673_100226378
319 Ga0070688_100260884
320 Ga0070667_100048902
321 Ga0070714_100120009
322 Ga0070713_100007962
323 Ga0070701_10029248
324 Ga0070700_100078148
325 Ga0070708_100115027
326 Ga0070663_100082458
327 Ga0070678_100217092
328 Ga0070678_100454084
329 Ga0070662_100195231
330 Ga0070681_10002009
331 Ga0068867_100089736
332 Ga0068867_100161882
333 Ga0068867_100199522
334 Ga0068867_100247821
335 Ga0070685_10000465
336 Ga0070679_100215435
337 Ga0070697_100031945
338 Ga0070672_100044788
339 Ga0070672_100170930
340 Ga0070693_100014088
341 Ga0070693_100061220
342 Ga0070665_100000095
343 Ga0068855_100011329
344 Ga0068855_100016439
345 Ga0068855_100067353
346 Ga0068855_100358107
347 Ga0068855_100431888
348 Ga0068855_100540107
349 Ga0068856_100124567
350 Ga0068852_100335521
351 Ga0068859_100068936
352 Ga0068864_100042106
353 Ga0068864_100360528
354 Ga0068866_10125122
355 Ga0068870_10046967
356 Ga0068863_100200370
357 Ga0068858_100048135
358 Ga0068858_100069220
359 Ga0068860_100026230
360 Ga0068860_100154383
361 Ga0068860_100202741
362 Ga0081540_1040869
363 Ga0070716_100046113
364 Ga0075369_10002574
365 Ga0075366_10001914
366 Ga0097621_100022914
367 Ga0068871_100039106
368 Ga0068871_100319648
369 Ga0075428_100001063
370 Ga0075428_100219337
371 Ga0075431_100000702
372 Ga0075431_100013163
373 Ga0075434_100105451
374 Ga0075434_100120286
375 Ga0075434_100160049
376 Ga0075429_100018533
377 Ga0075436_100002506
378 Ga0075436_100007155
379 Ga0075436_100087383
380 Ga0097620_100068939
381 Ga0075435_100092746
382 Ga0075435_100149856
383 Ga0075435_100296395
384 Ga0099794_10021259
385 Ga0099795_10039504
386 Ga0105240_10000685
387 Ga0105240_10015537
388 Ga0105240_10025063
389 Ga0105240_10222679
390 Ga0111539_10001710
391 Ga0105245_10014975
392 Ga0105245_10079259
393 Ga0105245_10154353
394 Ga0105247_10008260
395 Ga0114129_10045400
396 Ga0114129_10076543
397 Ga0114129_10086715
398 Ga0105243_10024239
399 Ga0105241_10036445
400 Ga0105241_10084551
401 Ga0105242_10035852
402 Ga0105248_10111171
403 Ga0105238_10089981
404 Ga0105238_10100836
405 Ga0105238_10135897
406 Ga0105249_10344195
407 Ga0105239_10041745
408 Ga0105239_10221457
409 Ga0105239_10520956
410 Ga0105246_10072633
411 Ga0157374_10013777
412 Ga0157378_10033349
413 Ga0163162_10000014
414 Ga0163162_10001956
415 Ga0163162_10075523
416 Ga0157372_10203609
417 Ga0157375_10004537
418 Ga0157375_10170946
419 Ga0163163_10239622
420 Ga0157380_10101082
421 Ga0157379_10025984
422 Ga0157379_10104662
423 Ga0157379_10239825
424 Ga0157376_10002046
425 Ga0157376_10075689
426 Ga0157376_10465109
427 Ga0163161_10072970
428 Ga0213875_10002025
429 Ga0209233_1009448
430 Ga0207692_10108511
431 Ga0207699_10066817
432 Ga0207699_10247248
433 Ga0207645_10128800
434 Ga0207643_10112704
435 Ga0207707_10037098
436 Ga0207695_10000007
437 Ga0207695_10014479
438 Ga0207693_10101085
439 Ga0207662_10131421
440 Ga0207652_10274494
441 Ga0207681_10242492
442 Ga0207694_10032201
443 Ga0207694_10115177
444 Ga0207659_10055695
445 Ga0207659_10415659
446 Ga0207687_10195405
447 Ga0207700_10395625
448 Ga0207664_10038704
449 Ga0207686_10039454
450 Ga0207704_10282545
451 Ga0207665_10001851
452 Ga0207691_10050292
453 Ga0207691_10137528
454 Ga0207691_10317550
455 Ga0207711_10011720
456 Ga0207667_10006743
457 Ga0207667_10018050
458 Ga0207667_10070433
459 Ga0207667_10169434
460 Ga0207667_10224468
461 Ga0207658_10057512
462 Ga0207703_10026822
463 Ga0207708_10045116
464 Ga0207708_10192002
465 Ga0207641_10173374
466 Ga0207641_10255946
467 Ga0207648_10005322
468 Ga0207648_10023193
469 Ga0207648_10095026
470 Ga0207648_10221704
471 Ga0207676_10127954
472 Ga0207674_10058364
473 Ga0207675_100081835
474 Ga0207683_10041339
475 Ga0207698_10198179
476 Ga0209588_1027931
477 Ga0209974_10031984
478 Ga0268266_10000001
479 Ga0268264_10012748
480 Ga0268264_10125084
481 Ga0373929_0018832
482 Ga0373934_0000089
483 Ga0373934_0055868
484 Ga0373923_0001361
485 Ga0373954_0000626
486 Ga0373956_0000060
487 Ga0373956_0004409
488 Ga0373946_0010119
489 Ga0373935_0006781
490 Ga0373933_0001102
491 Ga0373937_0000723
492 Ga0395900_0266528
493 Ga0395900_0371307
494 Ga0436364_1416468
495 Ga0395901_0106697
496 Ga0395901_0191284
497 Ga0436360_0766743
498 Ga0495592_0040761
499 Ga0495629_0247151
500 Ga0495641_0005546
501 Ga0495651_0000475
502 Ga0495651_0006933
503 Ga0495580_0000015
504 Ga0495580_0024284
505 Ga0495664_0308673
506 Ga0495608_0191613
507 Ga0495618_0242152
508 Ga0495628_0000483
509 Ga0495628_0003571
510 Ga0495628_0004948
511 Ga0495630_0005606
512 Ga0495643_0012969
513 Ga0495642_0001989
514 Ga0495642_0047328
515 Ga0495652_0006195
516 Ga0495652_0040120
517 Ga0495586_0005034
518 Ga0495587_0037786
519 Ga0495621_0009425
520 Ga0495621_0017502
521 Ga0495645_0000423
522 Ga0495645_0105312
523 Ga0495667_0173366
524 Ga0495634_0188327
525 Ga0495659_0079429
526 Ga0495657_0036240
527 Ga0495657_0127538
528 Ga0495599_0001525
529 Ga0495599_0010563
530 Ga0495599_0040414
531 Ga0495658_0058295
532 Ga0495669_0072305
533 Ga0495600_0035075
534 Ga0495581_0040975
535 Ga0495674_0009364
536 Ga0495687_003399
537 Ga0495675_0002636
538 Ga0495593_0051079
539 Ga0495614_0010958
540 Ga0496104_0209806
541 Ga0496105_0076649
542 Ga0496109_0109546
543 Ga0496110_0014924
544 Ga0496116_0001200
545 Ga0496118_0052510
546 Ga0496125_0001761
547 Ga0496126_0085723
548 Ga0496126_0197987
549 Ga0501034_0013268
550 Ga0501034_0063021
551 Ga0501036_0018378
552 Ga0501036_0337955
553 Ga0501041_0034211
554 Ga0501041_0114820
555 Ga0501046_0083525
556 Ga0501047_0057515
557 Ga0501067_0084420
558 Ga0501068_0021693
559 Ga0501069_0053397
560 Ga0501070_0001072
561 Ga0501070_0169954
562 Ga0501070_0196226
563 Ga0501071_0004608
564 Ga0501072_0082530
565 Ga0501073_0002184
566 Ga0501073_0093488
567 Ga0501074_0040014
568 Ga0501074_0040673
569 Ga0501075_0015049
570 Ga0501075_0026771
571 Ga0501076_0003520
572 Ga0501077_0001815
573 Ga0501079_0004184
574 Ga0501079_0012004
575 Ga0501080_0042455
576 Ga0501080_0148219
577 Ga0501083_0029529
578 Ga0501035_0204327
579 Ga0501044_0094061
580 Ga0501044_0165566
581 nmdc:mga0k408_9567_c1
582 nmdc:mga07m45_19514_c1
583 nmdc:mga05p37_157166_c1
584 nmdc:mga05p37_285882_c1
585 nmdc:mga06r32_49167_c1
586 nmdc:mga06r32_7729_c1
587 nmdc:mga08y16_4009_c1
588 nmdc:mga0n895_138613_c1
589 nmdc:mga0n895_159151_c1
590 nmdc:mga0n895_3515_c1
591 nmdc:mga0rr50_56438_c1
592 nmdc:mga08x19_161320_c1
593 nmdc:mga08x19_19294_c1
594 nmdc:mga08x19_1933_c1
595 nmdc:mga08x19_32995_c1
596 nmdc:mga08x19_61963_c1
597 nmdc:mga0sz30_68108_c1
598 Ga0495601_0062572
599 Ga0495619_0078079
600 Ga0500637_0067495
601 Ga0501084_0011513
602 Ga0501084_0139533
603 Ga0501082_0002568
604 Ga0501082_0017219
605 Ga0530510_0148577
606 2671692751
607 2739248953
608 2842721558
609 2891635132
610 2894027698
611 2932424822
612 2974320818
613 639785209
614 8055697694

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01841

Transglut_core

Transglutaminase-like superfamily

190

309

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3isr-assembly1.cif.gz_B the crystal structure of a putative cysteine protease from cytophaga hutchinsonii to 1.9a 0.7129 33 363
3isr-assembly1.cif.gz_B the crystal structure of a putative cysteine protease from cytophaga hutchinsonii to 1.9a 0.6575 33 363
2pmw-assembly1.cif.gz_B the crystal structure of proprotein convertase subtilisin kexin type 9 (pcsk9) 0.539 32 116
6u26-assembly2.cif.gz_B pcsk9 in complex with compound 16 0.4931 31 119
6u38-assembly1.cif.gz_B pcsk9 in complex with a fab and compound 8 0.4869 32 119
ID Description Score Start End Superfamily
af_O53920_94_280_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.8368 116 324 3.10.620.30
af_O53920_94_280_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.8081 116 324 3.10.620.30
af_Q54XE1_797_949_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.7826 129 313 3.10.620.30
af_Q54XE1_797_949_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.778 129 313 3.10.620.30
af_P9WL93_122_301_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.746 131 277 3.10.620.30
ID Description Score Start End GO Terms
AF-A0A1F4F5R3-F1-model_v4 Transglutaminase-like domain-containing protein 0.9779 181 351
AF-A0A1I4UD48-F1-model_v4 Transglutaminase-like superfamily protein 0.9764 156 363
AF-A0A327KDN6-F1-model_v4 Transglutaminase 0.9728 39 362
AF-A0A258K2I3-F1-model_v4 Transglutaminase 0.9719 149 363
AF-A0A0A0CZX6-F1-model_v4 Transglutaminase 0.967 117 363

Map