F399201

General Info

Members Datasets Scaffolds Average Seq Length
307 171 614 127

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_12215096|Ga0163163_122150962
Length 141
Sequence MARDANVPDAFDVFTVVVLRRPADAPAMTDDELDELQARHLAYRAELAARGLLVANGPFDQQSDESYRGMSVFACNADDAARLSDGDPSVVAGRLAYDVMEWWVRAGSLGFPLARGPVGIRRSMPDEQADESDGPAGSTPS

Samples

Sample ID Description Type Environment
1 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
23 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
30 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
72 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
76 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
77 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
78 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
79 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
80 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
81 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
82 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
83 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
84 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
85 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
86 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
87 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
88 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
89 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
90 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
91 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
92 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
93 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
94 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
95 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
96 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
97 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
98 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
99 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
100 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
101 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
102 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
103 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
104 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
105 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
106 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
107 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
108 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
109 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
110 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
111 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
112 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
113 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
114 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
115 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
116 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
117 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
118 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
119 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
120 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
121 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
122 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
135 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
136 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
137 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
138 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
139 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
140 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
141 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
142 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
143 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
144 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
145 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
146 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
147 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
148 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
149 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
151 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
152 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
153 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
154 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
155 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
156 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
159 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
160 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
161 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
162 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
163 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
164 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
165 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
166 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
167 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
168 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
169 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
170 2808606394 Promicromonospora sp. C35 Isolate Unclassified
171 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.39
Metatranscriptomes 0.33
Isolates 2.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.33
Nodule 0.33
Rhizoplane 12.7
Rhizosphere 69.38
Stem 0
Stem Tuber 0
Unclassified 5.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163163_12215096 3300014325 Bacteria 609
2 rootH2_10042512 3300003320 Bacteria 1315
3 rootL2_10296819 3300003322 Bacteria 1267
4 Ga0070676_10594497 3300005328 Bacteria 797
5 Ga0070666_10370609 3300005335 Bacteria 1027
6 Ga0070687_100605724 3300005343 Bacteria 753
7 Ga0070692_10822295 3300005345 Bacteria 636
8 Ga0070668_101852983 3300005347 Bacteria 555
9 Ga0070675_100441278 3300005354 Bacteria 1166
10 Ga0070674_101602589 3300005356 Bacteria 587
11 Ga0070673_100715154 3300005364 Bacteria 920
12 Ga0070659_101221595 3300005366 Bacteria 665
13 Ga0070713_102425691 3300005436 Bacteria 507
14 Ga0070710_11203714 3300005437 Bacteria 560
15 Ga0070701_10162826 3300005438 Bacteria 1294
16 Ga0070684_100546247 3300005535 Unclassified 1075
17 Ga0070684_100631917 3300005535 Bacteria 996
18 Ga0070684_100768798 3300005535 Bacteria 900
19 Ga0068853_100855401 3300005539 Bacteria 872
20 Ga0070665_102202066 3300005548 Bacteria 555
21 Ga0068857_100949715 3300005577 Bacteria 826
22 Ga0068859_100501224 3300005617 Bacteria 1309
23 Ga0068861_100061192 3300005719 Bacteria 2889
24 Ga0068861_100238594 3300005719 Bacteria 1545
25 Ga0068851_10346056 3300005834 Bacteria 864
26 Ga0068870_10794475 3300005840 Bacteria 661
27 Ga0068858_100719184 3300005842 Bacteria 972
28 Ga0068858_100799193 3300005842 Bacteria 920
29 Ga0068860_102455506 3300005843 Bacteria 541
30 Ga0068862_100206563 3300005844 Bacteria 1773
31 Ga0081538_10003372 3300005981 Bacteria 15124
32 Ga0075365_10055953 3300006038 Bacteria 2621
33 Ga0075365_10156272 3300006038 Bacteria 1587
34 Ga0075365_10167393 3300006038 Bacteria 1533
35 Ga0075365_10221847 3300006038 Bacteria 1326
36 Ga0075365_10319466 3300006038 Bacteria 1093
37 Ga0075365_10402630 3300006038 Bacteria 966
38 Ga0075368_10000401 3300006042 Bacteria 12702
39 Ga0075368_10132896 3300006042 Bacteria 1035
40 Ga0075368_10148256 3300006042 Bacteria 979
41 Ga0075363_100060169 3300006048 Bacteria 2044
42 Ga0075363_100131358 3300006048 Bacteria 1404
43 Ga0075363_100288348 3300006048 Bacteria 951
44 Ga0075364_10046810 3300006051 Bacteria 2816
45 Ga0075364_10060276 3300006051 Bacteria 2488
46 Ga0075364_10300883 3300006051 Bacteria 1092
47 Ga0075362_10578559 3300006177 Bacteria 579
48 Ga0075367_10041367 3300006178 Bacteria 2694
49 Ga0075367_10042693 3300006178 Bacteria 2654
50 Ga0075367_10068214 3300006178 Bacteria 2133
51 Ga0075367_10139652 3300006178 Bacteria 1501
52 Ga0075370_10001982 3300006353 Bacteria 9277
53 Ga0075370_11005754 3300006353 Bacteria 511
54 Ga0068865_100141029 3300006881 Bacteria 1817
55 Ga0097620_100501220 3300006931 Bacteria 1309
56 Ga0105245_10040544 3300009098 Bacteria 4149
57 Ga0105245_10128889 3300009098 Bacteria 2371
58 Ga0114129_11389835 3300009147 Bacteria 867
59 Ga0105243_10675289 3300009148 Bacteria 1004
60 Ga0105243_11239805 3300009148 Bacteria 760
61 Ga0105242_11871087 3300009176 Bacteria 640
62 Ga0105248_10086151 3300009177 Bacteria 3535
63 Ga0105246_10199608 3300011119 Bacteria 1554
64 Ga0157371_10159337 3300013102 Bacteria 1611
65 Ga0157370_11258279 3300013104 Bacteria 667
66 Ga0157369_10812974 3300013105 Bacteria 960
67 Ga0157369_11252461 3300013105 Bacteria 757
68 Ga0157369_11829166 3300013105 Bacteria 617
69 Ga0157374_11890914 3300013296 Bacteria 623
70 Ga0157378_11840528 3300013297 Bacteria 654
71 Ga0163162_11774364 3300013306 Bacteria 705
72 Ga0157372_10558143 3300013307 Bacteria 1335
73 Ga0157372_11171441 3300013307 Bacteria 888
74 Ga0157375_10088079 3300013308 Bacteria 3159
75 Ga0157375_10247843 3300013308 Bacteria 1942
76 Ga0157375_10333424 3300013308 Bacteria 1682
77 Ga0157375_10874589 3300013308 Bacteria 1044
78 Ga0157375_11064170 3300013308 Bacteria 946
79 Ga0157375_12160469 3300013308 Bacteria 663
80 Ga0163163_10067963 3300014325 Bacteria 3545
81 Ga0163163_10551330 3300014325 Bacteria 1215
82 Ga0163163_10611163 3300014325 Unclassified 1153
83 Ga0163163_11135154 3300014325 Bacteria 844
84 Ga0163163_12581501 3300014325 Bacteria 566
85 Ga0157380_10009600 3300014326 Bacteria 6941
86 Ga0157377_11034309 3300014745 Bacteria 624
87 Ga0157379_10281450 3300014968 Bacteria 1514
88 Ga0157379_10412306 3300014968 Bacteria 1243
89 Ga0157376_11332975 3300014969 Bacteria 748
90 Ga0163161_11142614 3300017792 Bacteria 671
91 Ga0206353_10978695 3300020082 Bacteria 3451
92 Ga0207645_10459288 3300025907 Bacteria 860
93 Ga0207643_10048948 3300025908 Bacteria 2395
94 Ga0207687_10008373 3300025927 Bacteria 6767
95 Ga0207709_10622580 3300025935 Bacteria 857
96 Ga0207711_10138111 3300025941 Bacteria 2191
97 Ga0207689_11640611 3300025942 Bacteria 534
98 Ga0207661_11325799 3300025944 Bacteria 661
99 Ga0207661_11700816 3300025944 Bacteria 576
100 Ga0207661_11918726 3300025944 Bacteria 538
101 Ga0207668_10163611 3300025972 Bacteria 1737
102 Ga0207677_11273403 3300026023 Bacteria 675
103 Ga0207708_11983072 3300026075 Bacteria 510
104 Ga0207648_10936030 3300026089 Unclassified 810
105 Ga0207674_10286369 3300026116 Bacteria 1596
106 Ga0207674_11105628 3300026116 Bacteria 762
107 Ga0207675_100073006 3300026118 Bacteria 3210
108 Ga0207675_100080258 3300026118 Bacteria 3059
109 Ga0207698_10409510 3300026142 Bacteria 1298
110 Ga0209813_10227229 3300027866 Bacteria 701
111 Ga0207428_10196293 3300027907 Bacteria 1520
112 Ga0268266_10008011 3300028379 Bacteria 9446
113 Ga0268266_10595605 3300028379 Bacteria 1062
114 Ga0268265_10298226 3300028380 Bacteria 1450
115 Ga0316179_1116193 3300030734 Bacteria 1203
116 Ga0316180_1007469 3300030736 Bacteria 1402
117 Ga0307405_10595092 3300031731 Bacteria 902
118 Ga0307413_10158803 3300031824 Bacteria 1586
119 Ga0307413_11648854 3300031824 Bacteria 571
120 Ga0307410_10449333 3300031852 Bacteria 1051
121 Ga0307410_10916237 3300031852 Bacteria 752
122 Ga0307410_11614259 3300031852 Bacteria 573
123 Ga0307407_10980444 3300031903 Bacteria 652
124 Ga0307412_10040883 3300031911 Bacteria 3002
125 Ga0307409_100053660 3300031995 Bacteria 3099
126 Ga0307409_101135691 3300031995 Bacteria 803
127 Ga0307409_101258225 3300031995 Bacteria 764
128 Ga0307409_102080815 3300031995 Bacteria 597
129 Ga0307416_100038629 3300032002 Bacteria 3685
130 Ga0307416_100163414 3300032002 Bacteria 2062
131 Ga0307416_102464079 3300032002 Bacteria 619
132 Ga0307416_103727098 3300032002 Bacteria 510
133 Ga0307414_10254872 3300032004 Bacteria 1461
134 Ga0307414_10545953 3300032004 Bacteria 1032
135 Ga0307411_10540609 3300032005 Bacteria 992
136 Ga0307415_101892827 3300032126 Bacteria 579
137 Ga0373937_1984252 3300036401 Unclassified 528
138 Ga0395905_1463723 3300037471 Bacteria 587
139 Ga0395901_0278658 3300038443 Bacteria 1738
140 Ga0439438_010146 3300041405 Bacteria 2998
141 Ga0439465_0039443 3300041413 Bacteria 1525
142 Ga0439465_0066741 3300041413 Bacteria 1200
143 Ga0439465_0330422 3300041413 Bacteria 574
144 Ga0451789_0170082 3300041443 Bacteria 564
145 Ga0451797_1451748 3300041453 Bacteria 700
146 Ga0451853_0322754 3300041512 Bacteria 659
147 Ga0439442_046837 3300042002 Bacteria 911
148 Ga0450907_007125 3300042146 Bacteria 1866
149 Ga0450907_023715 3300042146 Bacteria 1036
150 Ga0439434_0066590 3300042435 Bacteria 1130
151 Ga0495641_0407883 3300046461 Bacteria 617
152 Ga0495651_0051951 3300046462 Bacteria 3159
153 Ga0495664_0639739 3300046477 Bacteria 631
154 Ga0495608_0388489 3300046511 Unclassified 855
155 Ga0495635_0155299 3300046663 Unclassified 1558
156 Ga0495674_0055655 3300047319 Unclassified 3468
157 Ga0495680_0501330 3300047322 Bacteria 824
158 Ga0495684_1063634 3300047471 Bacteria 510
159 Ga0495602_0071877 3300048088 Unclassified 2953
160 Ga0496100_0284455 3300048903 Bacteria 1234
161 Ga0496100_0355045 3300048903 Bacteria 1108
162 Ga0496100_1225822 3300048903 Bacteria 592
163 Ga0496101_0077109 3300048904 Bacteria 2456
164 Ga0496102_0022494 3300048905 Bacteria 5587
165 Ga0496102_0252203 3300048905 Bacteria 1664
166 Ga0496102_1742132 3300048905 Bacteria 541
167 Ga0496103_0271631 3300048906 Bacteria 1091
168 Ga0496103_0367795 3300048906 Bacteria 924
169 Ga0496104_0248740 3300048907 Bacteria 1691
170 Ga0496104_1006245 3300048907 Bacteria 737
171 Ga0496107_0084225 3300048910 Bacteria 2320
172 Ga0496107_1166135 3300048910 Bacteria 555
173 Ga0496108_0004869 3300048911 Bacteria 10841
174 Ga0496108_0626427 3300048911 Bacteria 936
175 Ga0496108_1104793 3300048911 Bacteria 674
176 Ga0496109_0083256 3300048912 Bacteria 2950
177 Ga0496109_0138608 3300048912 Bacteria 2274
178 Ga0496109_0329190 3300048912 Bacteria 1442
179 Ga0496109_1182716 3300048912 Bacteria 701
180 Ga0496110_0152028 3300048913 Bacteria 2096
181 Ga0496111_0241742 3300048914 Bacteria 1341
182 Ga0496111_1227644 3300048914 Bacteria 530
183 Ga0496112_0034610 3300048915 Bacteria 4916
184 Ga0496112_0295153 3300048915 Bacteria 1567
185 Ga0496112_0863014 3300048915 Bacteria 828
186 Ga0496112_1668907 3300048915 Bacteria 550
187 Ga0496113_0329608 3300048916 Bacteria 1224
188 Ga0496113_0713894 3300048916 Bacteria 799
189 Ga0496114_0010893 3300048917 Bacteria 7245
190 Ga0496114_0011603 3300048917 Bacteria 7044
191 Ga0496114_0090776 3300048917 Bacteria 2593
192 Ga0496114_0135087 3300048917 Bacteria 2132
193 Ga0496114_0158597 3300048917 Bacteria 1966
194 Ga0496114_0373030 3300048917 Unclassified 1263
195 Ga0496114_0785129 3300048917 Bacteria 831
196 Ga0496115_0056394 3300048918 Bacteria 3158
197 Ga0496119_0239460 3300048922 Bacteria 920
198 Ga0501031_0640843 3300049568 Bacteria 683
199 Ga0501032_0166071 3300049569 Bacteria 1448
200 Ga0501034_0007492 3300049571 Bacteria 11609
201 Ga0501034_0160799 3300049571 Bacteria 2217
202 Ga0501034_0180033 3300049571 Bacteria 2079
203 Ga0501034_0697365 3300049571 Bacteria 914
204 Ga0501036_0279289 3300049572 Bacteria 1398
205 Ga0501036_0357496 3300049572 Bacteria 1219
206 Ga0501036_0407265 3300049572 Bacteria 1134
207 Ga0501036_0757730 3300049572 Bacteria 801
208 Ga0501037_0092308 3300049573 Bacteria 2190
209 Ga0501037_0258726 3300049573 Bacteria 1216
210 Ga0501038_0209079 3300049574 Bacteria 1562
211 Ga0501038_0277999 3300049574 Bacteria 1319
212 Ga0501039_0028273 3300049575 Bacteria 4316
213 Ga0501039_0243065 3300049575 Bacteria 1415
214 Ga0501039_0430173 3300049575 Bacteria 1037
215 Ga0501039_0781664 3300049575 Bacteria 745
216 Ga0501039_1050010 3300049575 Bacteria 632
217 Ga0501040_0720224 3300049576 Bacteria 722
218 Ga0501041_0270786 3300049577 Bacteria 1068
219 Ga0501041_0510632 3300049577 Bacteria 765
220 Ga0501042_0350995 3300049578 Bacteria 1067
221 Ga0501047_0034640 3300049581 Bacteria 4876
222 Ga0501047_0148448 3300049581 Bacteria 2221
223 Ga0501048_0694984 3300049582 Bacteria 730
224 Ga0501067_0003112 3300049583 Bacteria 9159
225 Ga0501067_0073723 3300049583 Bacteria 1891
226 Ga0501067_0331612 3300049583 Bacteria 847
227 Ga0501067_0414910 3300049583 Bacteria 751
228 Ga0501068_0068222 3300049584 Bacteria 2167
229 Ga0501068_0758381 3300049584 Bacteria 636
230 Ga0501069_0044214 3300049585 Bacteria 2466
231 Ga0501069_0572413 3300049585 Bacteria 677
232 Ga0501069_0791508 3300049585 Unclassified 574
233 Ga0501070_0007895 3300049586 Bacteria 9016
234 Ga0501070_0154220 3300049586 Bacteria 1895
235 Ga0501070_0569204 3300049586 Unclassified 905
236 Ga0501071_0006863 3300049587 Bacteria 7420
237 Ga0501071_0134279 3300049587 Bacteria 1840
238 Ga0501071_0208650 3300049587 Bacteria 1469
239 Ga0501072_0062264 3300049588 Bacteria 2943
240 Ga0501072_0151270 3300049588 Unclassified 1850
241 Ga0501072_0327470 3300049588 Bacteria 1217
242 Ga0501072_0364329 3300049588 Unclassified 1147
243 Ga0501073_0012866 3300049589 Bacteria 6099
244 Ga0501073_0045220 3300049589 Bacteria 3101
245 Ga0501073_0770795 3300049589 Bacteria 663
246 Ga0501074_0016571 3300049590 Bacteria 5349
247 Ga0501074_0221497 3300049590 Bacteria 1347
248 Ga0501074_0446356 3300049590 Unclassified 917
249 Ga0501075_0705839 3300049591 Bacteria 768
250 Ga0501076_0459151 3300049592 Bacteria 1049
251 Ga0501076_0468286 3300049592 Bacteria 1038
252 Ga0501076_0565583 3300049592 Bacteria 938
253 Ga0501076_1000098 3300049592 Bacteria 689
254 Ga0501077_0019718 3300049593 Bacteria 4266
255 Ga0501077_0725376 3300049593 Bacteria 639
256 Ga0501079_0081769 3300049741 Bacteria 2498
257 Ga0501079_0351637 3300049741 Bacteria 1155
258 Ga0501080_0005353 3300049742 Bacteria 11437
259 Ga0501080_0143175 3300049742 Bacteria 2210
260 Ga0501081_0963636 3300049743 Bacteria 644
261 Ga0501083_0013558 3300049744 Bacteria 5699
262 Ga0501083_0187181 3300049744 Bacteria 1351
263 Ga0501035_1457932 3300049822 Bacteria 523
264 Ga0501045_0436179 3300049824 Bacteria 974
265 nmdc:mga03683_313551_c1 3300050489 Bacteria 737
266 nmdc:mga03683_62007_c1 3300050489 Bacteria 1583
267 nmdc:mga00v17_8944_c1 3300050491 Bacteria 5403
268 nmdc:mga0yw44_147540_c1 3300050492 Bacteria 1532
269 nmdc:mga0yw44_509651_c1 3300050492 Bacteria 816
270 nmdc:mga0yw44_603503_c1 3300050492 Bacteria 746
271 nmdc:mga0yw44_64765_c1 3300050492 Bacteria 2250
272 nmdc:mga0yw44_65481_c1 3300050492 Bacteria 2240
273 nmdc:mga0yw44_718538_c1 3300050492 Bacteria 678
274 nmdc:mga0yw44_755031_c1 3300050492 Bacteria 661
275 nmdc:mga0yw44_994987_c1 3300050492 Unclassified 568
276 nmdc:mga06z11_24589_c1 3300050494 Bacteria 2844
277 nmdc:mga06z11_273826_c1 3300050494 Bacteria 999
278 nmdc:mga06z11_41137_c1 3300050494 Bacteria 2311
279 nmdc:mga04h51_47018_c1 3300050495 Bacteria 1433
280 nmdc:mga07m45_269264_c1 3300050496 Bacteria 991
281 nmdc:mga07m45_805197_c1 3300050496 Bacteria 538
282 nmdc:mga07m45_8923_c1 3300050496 Bacteria 5177
283 nmdc:mga07m45_90889_c1 3300050496 Bacteria 1749
284 nmdc:mga08y16_136845_c1 3300050511 Bacteria 2546
285 Ga0495601_0099957 3300053077 Bacteria 1873
286 Ga0495601_0491034 3300053077 Bacteria 793
287 Ga0495619_0175131 3300053085 Bacteria 1484
288 Ga0495619_1057527 3300053085 Bacteria 541
289 Ga0500641_0370069 3300053096 Bacteria 571
290 Ga0500568_0030423 3300053139 Bacteria 2235
291 Ga0501084_0014907 3300054114 Bacteria 6446
292 Ga0501084_0612682 3300054114 Bacteria 920
293 Ga0501084_1169871 3300054114 Unclassified 645
294 Ga0501084_1615397 3300054114 Bacteria 542
295 Ga0501082_0091313 3300060353 Bacteria 2629
296 Ga0501082_0116105 3300060353 Bacteria 2318
297 Ga0501082_1531423 3300060353 Bacteria 582
298 Ga0530510_0344015 3300061734 Bacteria 1120
299 Ga0530510_0387246 3300061734 Bacteria 1053
300 Ga0530510_0406252 3300061734 Bacteria 1027
301 2738698166 2738541272 Bacteria 6848551
302 2739327937 2738543027 Bacteria 6409078
303 2739609923 2739367654 Bacteria 6049412
304 2760303854 2758568522 Bacteria 5953541
305 2760622218 2758568621 Bacteria 5967089
306 2809027710 2808606394 Bacteria 6248540
307 8054612031 8054609563 Bacteria 5170090
308 Ga0163163_12215096
309 rootH2_10042512
310 rootL2_10296819
311 Ga0070676_10594497
312 Ga0070666_10370609
313 Ga0070687_100605724
314 Ga0070692_10822295
315 Ga0070668_101852983
316 Ga0070675_100441278
317 Ga0070674_101602589
318 Ga0070673_100715154
319 Ga0070659_101221595
320 Ga0070713_102425691
321 Ga0070710_11203714
322 Ga0070701_10162826
323 Ga0070684_100546247
324 Ga0070684_100631917
325 Ga0070684_100768798
326 Ga0068853_100855401
327 Ga0070665_102202066
328 Ga0068857_100949715
329 Ga0068859_100501224
330 Ga0068861_100061192
331 Ga0068861_100238594
332 Ga0068851_10346056
333 Ga0068870_10794475
334 Ga0068858_100719184
335 Ga0068858_100799193
336 Ga0068860_102455506
337 Ga0068862_100206563
338 Ga0081538_10003372
339 Ga0075365_10055953
340 Ga0075365_10156272
341 Ga0075365_10167393
342 Ga0075365_10221847
343 Ga0075365_10319466
344 Ga0075365_10402630
345 Ga0075368_10000401
346 Ga0075368_10132896
347 Ga0075368_10148256
348 Ga0075363_100060169
349 Ga0075363_100131358
350 Ga0075363_100288348
351 Ga0075364_10046810
352 Ga0075364_10060276
353 Ga0075364_10300883
354 Ga0075362_10578559
355 Ga0075367_10041367
356 Ga0075367_10042693
357 Ga0075367_10068214
358 Ga0075367_10139652
359 Ga0075370_10001982
360 Ga0075370_11005754
361 Ga0068865_100141029
362 Ga0097620_100501220
363 Ga0105245_10040544
364 Ga0105245_10128889
365 Ga0114129_11389835
366 Ga0105243_10675289
367 Ga0105243_11239805
368 Ga0105242_11871087
369 Ga0105248_10086151
370 Ga0105246_10199608
371 Ga0157371_10159337
372 Ga0157370_11258279
373 Ga0157369_10812974
374 Ga0157369_11252461
375 Ga0157369_11829166
376 Ga0157374_11890914
377 Ga0157378_11840528
378 Ga0163162_11774364
379 Ga0157372_10558143
380 Ga0157372_11171441
381 Ga0157375_10088079
382 Ga0157375_10247843
383 Ga0157375_10333424
384 Ga0157375_10874589
385 Ga0157375_11064170
386 Ga0157375_12160469
387 Ga0163163_10067963
388 Ga0163163_10551330
389 Ga0163163_10611163
390 Ga0163163_11135154
391 Ga0163163_12581501
392 Ga0157380_10009600
393 Ga0157377_11034309
394 Ga0157379_10281450
395 Ga0157379_10412306
396 Ga0157376_11332975
397 Ga0163161_11142614
398 Ga0206353_10978695
399 Ga0207645_10459288
400 Ga0207643_10048948
401 Ga0207687_10008373
402 Ga0207709_10622580
403 Ga0207711_10138111
404 Ga0207689_11640611
405 Ga0207661_11325799
406 Ga0207661_11700816
407 Ga0207661_11918726
408 Ga0207668_10163611
409 Ga0207677_11273403
410 Ga0207708_11983072
411 Ga0207648_10936030
412 Ga0207674_10286369
413 Ga0207674_11105628
414 Ga0207675_100073006
415 Ga0207675_100080258
416 Ga0207698_10409510
417 Ga0209813_10227229
418 Ga0207428_10196293
419 Ga0268266_10008011
420 Ga0268266_10595605
421 Ga0268265_10298226
422 Ga0316179_1116193
423 Ga0316180_1007469
424 Ga0307405_10595092
425 Ga0307413_10158803
426 Ga0307413_11648854
427 Ga0307410_10449333
428 Ga0307410_10916237
429 Ga0307410_11614259
430 Ga0307407_10980444
431 Ga0307412_10040883
432 Ga0307409_100053660
433 Ga0307409_101135691
434 Ga0307409_101258225
435 Ga0307409_102080815
436 Ga0307416_100038629
437 Ga0307416_100163414
438 Ga0307416_102464079
439 Ga0307416_103727098
440 Ga0307414_10254872
441 Ga0307414_10545953
442 Ga0307411_10540609
443 Ga0307415_101892827
444 Ga0373937_1984252
445 Ga0395905_1463723
446 Ga0395901_0278658
447 Ga0439438_010146
448 Ga0439465_0039443
449 Ga0439465_0066741
450 Ga0439465_0330422
451 Ga0451789_0170082
452 Ga0451797_1451748
453 Ga0451853_0322754
454 Ga0439442_046837
455 Ga0450907_007125
456 Ga0450907_023715
457 Ga0439434_0066590
458 Ga0495641_0407883
459 Ga0495651_0051951
460 Ga0495664_0639739
461 Ga0495608_0388489
462 Ga0495635_0155299
463 Ga0495674_0055655
464 Ga0495680_0501330
465 Ga0495684_1063634
466 Ga0495602_0071877
467 Ga0496100_0284455
468 Ga0496100_0355045
469 Ga0496100_1225822
470 Ga0496101_0077109
471 Ga0496102_0022494
472 Ga0496102_0252203
473 Ga0496102_1742132
474 Ga0496103_0271631
475 Ga0496103_0367795
476 Ga0496104_0248740
477 Ga0496104_1006245
478 Ga0496107_0084225
479 Ga0496107_1166135
480 Ga0496108_0004869
481 Ga0496108_0626427
482 Ga0496108_1104793
483 Ga0496109_0083256
484 Ga0496109_0138608
485 Ga0496109_0329190
486 Ga0496109_1182716
487 Ga0496110_0152028
488 Ga0496111_0241742
489 Ga0496111_1227644
490 Ga0496112_0034610
491 Ga0496112_0295153
492 Ga0496112_0863014
493 Ga0496112_1668907
494 Ga0496113_0329608
495 Ga0496113_0713894
496 Ga0496114_0010893
497 Ga0496114_0011603
498 Ga0496114_0090776
499 Ga0496114_0135087
500 Ga0496114_0158597
501 Ga0496114_0373030
502 Ga0496114_0785129
503 Ga0496115_0056394
504 Ga0496119_0239460
505 Ga0501031_0640843
506 Ga0501032_0166071
507 Ga0501034_0007492
508 Ga0501034_0160799
509 Ga0501034_0180033
510 Ga0501034_0697365
511 Ga0501036_0279289
512 Ga0501036_0357496
513 Ga0501036_0407265
514 Ga0501036_0757730
515 Ga0501037_0092308
516 Ga0501037_0258726
517 Ga0501038_0209079
518 Ga0501038_0277999
519 Ga0501039_0028273
520 Ga0501039_0243065
521 Ga0501039_0430173
522 Ga0501039_0781664
523 Ga0501039_1050010
524 Ga0501040_0720224
525 Ga0501041_0270786
526 Ga0501041_0510632
527 Ga0501042_0350995
528 Ga0501047_0034640
529 Ga0501047_0148448
530 Ga0501048_0694984
531 Ga0501067_0003112
532 Ga0501067_0073723
533 Ga0501067_0331612
534 Ga0501067_0414910
535 Ga0501068_0068222
536 Ga0501068_0758381
537 Ga0501069_0044214
538 Ga0501069_0572413
539 Ga0501069_0791508
540 Ga0501070_0007895
541 Ga0501070_0154220
542 Ga0501070_0569204
543 Ga0501071_0006863
544 Ga0501071_0134279
545 Ga0501071_0208650
546 Ga0501072_0062264
547 Ga0501072_0151270
548 Ga0501072_0327470
549 Ga0501072_0364329
550 Ga0501073_0012866
551 Ga0501073_0045220
552 Ga0501073_0770795
553 Ga0501074_0016571
554 Ga0501074_0221497
555 Ga0501074_0446356
556 Ga0501075_0705839
557 Ga0501076_0459151
558 Ga0501076_0468286
559 Ga0501076_0565583
560 Ga0501076_1000098
561 Ga0501077_0019718
562 Ga0501077_0725376
563 Ga0501079_0081769
564 Ga0501079_0351637
565 Ga0501080_0005353
566 Ga0501080_0143175
567 Ga0501081_0963636
568 Ga0501083_0013558
569 Ga0501083_0187181
570 Ga0501035_1457932
571 Ga0501045_0436179
572 nmdc:mga03683_313551_c1
573 nmdc:mga03683_62007_c1
574 nmdc:mga00v17_8944_c1
575 nmdc:mga0yw44_147540_c1
576 nmdc:mga0yw44_509651_c1
577 nmdc:mga0yw44_603503_c1
578 nmdc:mga0yw44_64765_c1
579 nmdc:mga0yw44_65481_c1
580 nmdc:mga0yw44_718538_c1
581 nmdc:mga0yw44_755031_c1
582 nmdc:mga0yw44_994987_c1
583 nmdc:mga06z11_24589_c1
584 nmdc:mga06z11_273826_c1
585 nmdc:mga06z11_41137_c1
586 nmdc:mga04h51_47018_c1
587 nmdc:mga07m45_269264_c1
588 nmdc:mga07m45_805197_c1
589 nmdc:mga07m45_8923_c1
590 nmdc:mga07m45_90889_c1
591 nmdc:mga08y16_136845_c1
592 Ga0495601_0099957
593 Ga0495601_0491034
594 Ga0495619_0175131
595 Ga0495619_1057527
596 Ga0500641_0370069
597 Ga0500568_0030423
598 Ga0501084_0014907
599 Ga0501084_0612682
600 Ga0501084_1169871
601 Ga0501084_1615397
602 Ga0501082_0091313
603 Ga0501082_0116105
604 Ga0501082_1531423
605 Ga0530510_0344015
606 Ga0530510_0387246
607 Ga0530510_0406252
608 2738698166
609 2739327937
610 2739609923
611 2760303854
612 2760622218
613 2809027710
614 8054612031

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

14

103

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fpi-assembly1.cif.gz_E crystal structure of 5-chloromuconolactone isomerase from rhodococcus opacus 1cp 0.757 14 109
3znj-assembly3.cif.gz_9 crystal structure of unliganded clcf from r.opacus 1cp in crystal form 1. 0.7525 14 110
3znj-assembly1.cif.gz_3 crystal structure of unliganded clcf from r.opacus 1cp in crystal form 1. 0.7459 14 110
3zo7-assembly1.cif.gz_F crystal structure of clcfe27a with substrate 0.7423 14 109
3zo7-assembly1.cif.gz_E crystal structure of clcfe27a with substrate 0.7379 13 109
ID Description Score Start End Superfamily
af_O07243_108_202_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.8096 15 100 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7671 13 108 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7323 13 108 3.30.70.1060
3znj100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.725 14 110 3.30.70.1060
af_O07243_108_202_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7128 15 100 3.30.70.1060
ID Description Score Start End GO Terms
AF-A0A4R4M9K8-F1-model_v4 deleted 1.002 18 96
AF-A0A6I1G3W9-F1-model_v4 YCII-related domain-containing protein 0.9839 1 126
AF-A0A6I2FEG0-F1-model_v4 YCII-related domain-containing protein 0.9817 1 125
AF-A0A4R4M9K8-F1-model_v4 deleted 0.9773 18 96
AF-A0A077LSR1-F1-model_v4 YCII-related protein 0.9765 1 124

Map