F399195

General Info

Members Datasets Scaffolds Average Seq Length
307 213 614 324

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10325262|Ga0157372_103252621
Length 350
Sequence MVGDFGVEMQARPALCCGANEAEDRMKRIAAMVAAAIVGAAALVPAVHADEPYPNRPVKLIVPYTPGTGIDILARTLGQKLSEEWKQAVVVENRPGASGAIGTEAAAKSAPDGYTLLMQASTIVIDPSLHRKAPYDPVKDFAPVAPLALGSLGLVVHPSVKAESVKELIALAKSAPGKLTYASPGSGTPHHLAMELFKQRTGIDVLHVPYKGTGGAVQDLLGGQVNMMFLPIHVALAQVKAGKLRLLAAGGTRRAAVTPETPSLAEASGVADIDVDIWYAMYAPAGTPSAIVAKLNADVNRLLKSPDVAATLSKQGLTPTGGSPADLATLTEKDLARWGRVIRDAHITAE

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
82 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
86 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
137 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
138 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
139 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
141 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
147 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
148 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
149 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
150 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
151 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
152 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
153 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
154 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
155 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
156 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
157 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
158 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
159 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
160 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
161 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
162 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
169 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
170 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
171 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
172 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
173 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
174 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
175 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
176 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
177 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
178 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
183 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
184 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
185 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
186 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
187 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
188 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
189 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
190 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
191 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
192 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
193 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
194 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
195 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
196 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
197 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
198 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
199 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
200 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
201 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
202 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
203 2643221569 Achromobacter sp. Root565 Isolate Unclassified
204 2643221594 Achromobacter sp. Root170 Isolate Unclassified
205 2643221621 Achromobacter sp. Root83 Isolate Unclassified
206 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
207 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
208 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
209 2858950400 Achromobacter sp. K91 Isolate Unclassified
210 2941479691
211 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
212 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
213 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.11
Metatranscriptomes 0.33
Isolates 4.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.47
Nodule 0.98
Rhizoplane 2.93
Rhizosphere 76.87
Stem 0
Stem Tuber 0
Unclassified 2.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10325262 3300013307 Bacteria 1790
2 JGI25151J46595_10022854 3300003187 Bacteria 2588
3 rootH1_10045136 3300003323 Bacteria 3019
4 Ga0070658_10019437 3300005327 Bacteria 5439
5 Ga0070676_10004773 3300005328 Bacteria 7164
6 Ga0070683_100037591 3300005329 Bacteria 4432
7 Ga0070690_100010159 3300005330 Bacteria 5467
8 Ga0070670_100126125 3300005331 Bacteria 2209
9 Ga0068869_100006996 3300005334 Bacteria 7184
10 Ga0068869_100037518 3300005334 Bacteria 3446
11 Ga0070666_10001777 3300005335 Bacteria 13128
12 Ga0070666_10010772 3300005335 Bacteria 5722
13 Ga0070680_100186425 3300005336 Bacteria 1748
14 Ga0068868_100013452 3300005338 Bacteria 6000
15 Ga0068868_100414956 3300005338 Bacteria 1164
16 Ga0070689_100004203 3300005340 Bacteria 9714
17 Ga0070661_100024460 3300005344 Bacteria 4332
18 Ga0070661_100223808 3300005344 Bacteria 1444
19 Ga0070692_10165703 3300005345 Bacteria 1270
20 Ga0070668_100006810 3300005347 Bacteria 8473
21 Ga0070669_100000933 3300005353 Bacteria 21303
22 Ga0070675_100002683 3300005354 Bacteria 13373
23 Ga0070675_100037866 3300005354 Bacteria 3930
24 Ga0070671_100006507 3300005355 Bacteria 9341
25 Ga0070671_100103847 3300005355 Bacteria 2385
26 Ga0070674_100075253 3300005356 Bacteria 2397
27 Ga0070673_100003903 3300005364 Bacteria 9369
28 Ga0070673_100299795 3300005364 Bacteria 1414
29 Ga0070688_100237680 3300005365 Bacteria 1291
30 Ga0070667_100001256 3300005367 Bacteria 23016
31 Ga0070667_100009791 3300005367 Bacteria 7947
32 Ga0070714_100054479 3300005435 Bacteria 3417
33 Ga0070713_100070514 3300005436 Bacteria 2951
34 Ga0070700_100049283 3300005441 Bacteria 2614
35 Ga0070694_100115020 3300005444 Bacteria 1922
36 Ga0070678_100079350 3300005456 Bacteria 2482
37 Ga0070678_100229636 3300005456 Bacteria 1546
38 Ga0070662_100062677 3300005457 Bacteria 2718
39 Ga0070662_100099270 3300005457 Bacteria 2200
40 Ga0070681_10030216 3300005458 Bacteria 5435
41 Ga0070681_10283014 3300005458 Bacteria 1569
42 Ga0068867_100008392 3300005459 Bacteria 7286
43 Ga0068867_100016583 3300005459 Bacteria 5231
44 Ga0070706_100116299 3300005467 Bacteria 2491
45 Ga0070707_100046406 3300005468 Unclassified 4158
46 Ga0070684_100023172 3300005535 Bacteria 5188
47 Ga0068853_100015551 3300005539 Bacteria 6251
48 Ga0068853_100061667 3300005539 Bacteria 3244
49 Ga0070672_100007892 3300005543 Bacteria 7266
50 Ga0070672_100060747 3300005543 Bacteria 2977
51 Ga0070672_100158416 3300005543 Bacteria 1876
52 Ga0070672_100182433 3300005543 Bacteria 1749
53 Ga0070672_100325506 3300005543 Unclassified 1307
54 Ga0070686_100155107 3300005544 Bacteria 1607
55 Ga0070693_100146783 3300005547 Unclassified 1490
56 Ga0068855_100009360 3300005563 Bacteria 11828
57 Ga0068855_100009963 3300005563 Bacteria 11455
58 Ga0068855_100010207 3300005563 Bacteria 11321
59 Ga0068855_100023252 3300005563 Bacteria 7424
60 Ga0070664_100084214 3300005564 Bacteria 2744
61 Ga0070664_100264384 3300005564 Bacteria 1548
62 Ga0068852_100013794 3300005616 Bacteria 6195
63 Ga0068859_100036005 3300005617 Bacteria 4967
64 Ga0068859_100040103 3300005617 Bacteria 4700
65 Ga0068864_100000251 3300005618 Bacteria 47937
66 Ga0068851_10008649 3300005834 Bacteria 4714
67 Ga0068863_100011130 3300005841 Bacteria 8721
68 Ga0068863_100036050 3300005841 Bacteria 4710
69 Ga0068858_100000210 3300005842 Bacteria 63073
70 Ga0068858_100001135 3300005842 Bacteria 27560
71 Ga0068860_100014125 3300005843 Bacteria 7831
72 Ga0068860_100076667 3300005843 Bacteria 3179
73 Ga0068862_100018455 3300005844 Bacteria 5810
74 Ga0081455_10006420 3300005937 Bacteria 12604
75 Ga0081455_10006972 3300005937 Bacteria 12007
76 Ga0075364_10086163 3300006051 Bacteria 2081
77 Ga0075364_10097426 3300006051 Bacteria 1956
78 Ga0070716_100278492 3300006173 Bacteria 1153
79 Ga0075362_10023719 3300006177 Bacteria 2598
80 Ga0075362_10058944 3300006177 Bacteria 1733
81 Ga0075367_10028506 3300006178 Bacteria 3186
82 Ga0075369_10008355 3300006186 Bacteria 3979
83 Ga0075366_10007747 3300006195 Bacteria 5946
84 Ga0075366_10020025 3300006195 Bacteria 3879
85 Ga0097621_100044330 3300006237 Bacteria 3589
86 Ga0097621_100116913 3300006237 Bacteria 2259
87 Ga0075370_10012778 3300006353 Bacteria 4447
88 Ga0075370_10065318 3300006353 Bacteria 2075
89 Ga0075428_100018679 3300006844 Bacteria 7665
90 Ga0075429_100053750 3300006880 Bacteria 3504
91 Ga0068865_100001941 3300006881 Bacteria 12183
92 Ga0097620_100036005 3300006931 Bacteria 4967
93 Ga0097620_100040105 3300006931 Bacteria 4700
94 Ga0105240_10001172 3300009093 Bacteria 45943
95 Ga0105240_10012402 3300009093 Bacteria 11767
96 Ga0105240_10517630 3300009093 Bacteria 1324
97 Ga0111539_10176434 3300009094 Bacteria 2496
98 Ga0105245_10328327 3300009098 Bacteria 1509
99 Ga0105243_10061673 3300009148 Bacteria 3000
100 Ga0105241_10003943 3300009174 Bacteria 10982
101 Ga0105241_10185140 3300009174 Bacteria 1730
102 Ga0105242_10015559 3300009176 Bacteria 5910
103 Ga0105248_10075673 3300009177 Bacteria 3784
104 Ga0105248_10191048 3300009177 Unclassified 2307
105 Ga0105248_10647714 3300009177 Bacteria 1192
106 Ga0105237_10000806 3300009545 Bacteria 42774
107 Ga0105238_10029143 3300009551 Bacteria 5624
108 Ga0105238_10076726 3300009551 Bacteria 3334
109 Ga0105249_10015329 3300009553 Bacteria 6782
110 Ga0105239_10000292 3300010375 Bacteria 73809
111 Ga0157374_10030993 3300013296 Bacteria 4856
112 Ga0163162_10011710 3300013306 Bacteria 8554
113 Ga0157372_10014280 3300013307 Bacteria 8491
114 Ga0157375_10013832 3300013308 Bacteria 7192
115 Ga0157375_10107413 3300013308 Bacteria 2884
116 Ga0163163_10001708 3300014325 Bacteria 18543
117 Ga0163163_10210780 3300014325 Bacteria 1992
118 Ga0157380_10003191 3300014326 Bacteria 11190
119 Ga0157380_10020025 3300014326 Bacteria 4995
120 Ga0157379_10007940 3300014968 Bacteria 9203
121 Ga0157379_10041669 3300014968 Bacteria 4099
122 Ga0163161_10005245 3300017792 Bacteria 9019
123 Ga0163161_10060387 3300017792 Bacteria 2759
124 Ga0163161_10104017 3300017792 Bacteria 2116
125 Ga0206353_11158709 3300020082 Bacteria 1254
126 Ga0213876_10013810 3300021384 Bacteria 4279
127 Ga0209677_101082 3300025253 Bacteria 12847
128 Ga0209675_1001703 3300025291 Bacteria 12156
129 Ga0209676_1003997 3300025292 Bacteria 8507
130 Ga0209025_1000110 3300025294 Bacteria 220002
131 Ga0209051_1001306 3300025303 Bacteria 21908
132 Ga0209051_1020418 3300025303 Bacteria 2853
133 Ga0207656_10005288 3300025321 Bacteria 4554
134 Ga0207682_10033333 3300025893 Bacteria 2073
135 Ga0207642_10009910 3300025899 Bacteria 3335
136 Ga0207688_10066634 3300025901 Bacteria 2037
137 Ga0207680_10012074 3300025903 Bacteria 4389
138 Ga0207680_10022200 3300025903 Bacteria 3448
139 Ga0207680_10119204 3300025903 Bacteria 1723
140 Ga0207645_10004894 3300025907 Bacteria 9820
141 Ga0207645_10036504 3300025907 Bacteria 3155
142 Ga0207705_10036112 3300025909 Bacteria 3537
143 Ga0207705_10244724 3300025909 Bacteria 1367
144 Ga0207684_10083585 3300025910 Unclassified 2718
145 Ga0207654_10036801 3300025911 Bacteria 2737
146 Ga0207707_10098594 3300025912 Unclassified 2554
147 Ga0207707_10124870 3300025912 Bacteria 2251
148 Ga0207707_10257801 3300025912 Bacteria 1514
149 Ga0207695_10002211 3300025913 Bacteria 29270
150 Ga0207671_10032641 3300025914 Bacteria 3874
151 Ga0207660_10157759 3300025917 Bacteria 1748
152 Ga0207662_10007197 3300025918 Bacteria 6052
153 Ga0207646_10017598 3300025922 Bacteria 6679
154 Ga0207681_10000565 3300025923 Bacteria 25285
155 Ga0207694_10043448 3300025924 Bacteria 3469
156 Ga0207650_10142026 3300025925 Bacteria 1888
157 Ga0207659_10000715 3300025926 Bacteria 19724
158 Ga0207659_10009176 3300025926 Bacteria 6177
159 Ga0207659_10053576 3300025926 Bacteria 2878
160 Ga0207700_10198727 3300025928 Bacteria 1688
161 Ga0207644_10007245 3300025931 Bacteria 7220
162 Ga0207706_10003299 3300025933 Bacteria 15455
163 Ga0207706_10059771 3300025933 Bacteria 3357
164 Ga0207706_10147727 3300025933 Bacteria 2068
165 Ga0207709_10029496 3300025935 Bacteria 3184
166 Ga0207670_10008332 3300025936 Bacteria 5845
167 Ga0207669_10015197 3300025937 Bacteria 3877
168 Ga0207669_10044747 3300025937 Bacteria 2603
169 Ga0207704_10001465 3300025938 Bacteria 10550
170 Ga0207691_10188521 3300025940 Bacteria 1800
171 Ga0207691_10191891 3300025940 Bacteria 1781
172 Ga0207691_10197183 3300025940 Bacteria 1753
173 Ga0207711_10011331 3300025941 Bacteria 7407
174 Ga0207711_10024990 3300025941 Bacteria 5011
175 Ga0207689_10005434 3300025942 Bacteria 11402
176 Ga0207689_10015951 3300025942 Bacteria 6359
177 Ga0207661_10086664 3300025944 Bacteria 2599
178 Ga0207661_10132072 3300025944 Bacteria 2140
179 Ga0207667_10051656 3300025949 Bacteria 4332
180 Ga0207667_10086337 3300025949 Bacteria 3247
181 Ga0207667_10129508 3300025949 Bacteria 2599
182 Ga0207651_10162892 3300025960 Bacteria 1750
183 Ga0207651_10318324 3300025960 Bacteria 1300
184 Ga0207668_10001216 3300025972 Bacteria 15297
185 Ga0207658_10003507 3300025986 Bacteria 11070
186 Ga0207658_10021633 3300025986 Bacteria 4467
187 Ga0207703_10001247 3300026035 Bacteria 23852
188 Ga0207703_10003582 3300026035 Bacteria 12979
189 Ga0207639_10015856 3300026041 Bacteria 5321
190 Ga0207708_10078716 3300026075 Bacteria 2532
191 Ga0207641_10002184 3300026088 Bacteria 18407
192 Ga0207648_10009973 3300026089 Bacteria 9042
193 Ga0207648_10025165 3300026089 Bacteria 5306
194 Ga0207676_10003892 3300026095 Bacteria 10546
195 Ga0207675_100164488 3300026118 Bacteria 2118
196 Ga0207683_10035912 3300026121 Bacteria 4312
197 Ga0207683_10049904 3300026121 Bacteria 3664
198 Ga0207683_10197055 3300026121 Bacteria 1830
199 Ga0207698_10125721 3300026142 Bacteria 2180
200 Ga0207698_10184788 3300026142 Bacteria 1851
201 Ga0209371_1013201 3300027312 Bacteria 2337
202 Ga0207428_10090836 3300027907 Bacteria 2371
203 Ga0268265_10024681 3300028380 Bacteria 4257
204 Ga0268264_10063397 3300028381 Bacteria 3106
205 Ga0268264_10097859 3300028381 Bacteria 2544
206 Ga0268256_1014483 3300030500 Bacteria 2337
207 Ga0307412_10000200 3300031911 Bacteria 40978
208 Ga0307414_10097300 3300032004 Bacteria 2204
209 Ga0373945_0007746 3300035116 Bacteria 3484
210 Ga0373946_0044842 3300035171 Bacteria 1827
211 Ga0373935_0017137 3300035692 Bacteria 4390
212 Ga0373933_0192244 3300035724 Bacteria 1304
213 Ga0373947_0095216 3300035725 Bacteria 1863
214 Ga0373937_0013470 3300036401 Bacteria 7203
215 Ga0373937_0171516 3300036401 Bacteria 2036
216 Ga0373925_0081679 3300037068 Bacteria 2458
217 Ga0395900_0011310 3300037418 Bacteria 9130
218 Ga0436365_0053118 3300039437 Bacteria 2598
219 Ga0436365_0217321 3300039437 Bacteria 7470
220 Ga0436363_1224698 3300039450 Bacteria 2135
221 Ga0439436_0024756 3300041404 Bacteria 1770
222 Ga0439464_0000905 3300042439 Bacteria 6633
223 Ga0451576_0183751 3300045051 Bacteria 2183
224 Ga0495580_0005023 3300046472 Bacteria 11028
225 Ga0495628_0210245 3300046516 Bacteria 1464
226 Ga0495666_0001999 3300046526 Bacteria 10067
227 Ga0495665_0002504 3300046531 Bacteria 9921
228 Ga0495621_0004252 3300046539 Bacteria 4007
229 Ga0495645_0061476 3300046543 Bacteria 2721
230 Ga0495645_0106069 3300046543 Bacteria 1993
231 Ga0495658_0056754 3300046683 Bacteria 2234
232 Ga0495613_0039797 3300046689 Bacteria 3484
233 Ga0495600_0077853 3300046809 Bacteria 2166
234 Ga0495604_0009273 3300047317 Bacteria 7789
235 Ga0495636_0023384 3300047318 Bacteria 2501
236 Ga0495674_0337614 3300047319 Bacteria 1225
237 Ga0495676_0338370 3300047321 Unclassified 1008
238 Ga0496102_0377549 3300048905 Bacteria 1334
239 Ga0496102_0447642 3300048905 Unclassified 1212
240 Ga0496105_0170759 3300048908 Bacteria 1783
241 Ga0496108_0099805 3300048911 Bacteria 2475
242 Ga0496108_0214152 3300048911 Unclassified 1673
243 Ga0496110_0253434 3300048913 Bacteria 1602
244 Ga0496114_0008458 3300048917 Bacteria 8155
245 Ga0496114_0165115 3300048917 Bacteria 1927
246 Ga0496116_0015057 3300048919 Bacteria 6132
247 Ga0496117_0058463 3300048920 Bacteria 2670
248 Ga0496118_0002848 3300048921 Bacteria 22568
249 Ga0496118_0012142 3300048921 Bacteria 8311
250 Ga0496119_0018156 3300048922 Bacteria 5253
251 Ga0496120_0002648 3300048923 Bacteria 17676
252 Ga0496121_0000195 3300048924 Bacteria 136162
253 Ga0496122_0000498 3300048925 Bacteria 81668
254 Ga0496122_0046543 3300048925 Bacteria 3358
255 Ga0496122_0051910 3300048925 Bacteria 3109
256 Ga0496123_0000390 3300048926 Bacteria 82150
257 Ga0496123_0009300 3300048926 Bacteria 8868
258 Ga0496123_0016857 3300048926 Bacteria 5905
259 Ga0496125_0000364 3300048928 Bacteria 85440
260 Ga0496125_0000408 3300048928 Bacteria 80485
261 Ga0496125_0012281 3300048928 Bacteria 8513
262 Ga0496125_0057822 3300048928 Bacteria 3137
263 Ga0496125_0061233 3300048928 Bacteria 3019
264 Ga0496126_0016001 3300048929 Bacteria 7520
265 Ga0496126_0267903 3300048929 Bacteria 1418
266 Ga0501031_0196324 3300049568 Bacteria 1317
267 Ga0501034_0000718 3300049571 Bacteria 50352
268 Ga0501039_0140678 3300049575 Bacteria 1896
269 Ga0501046_0229877 3300049580 Bacteria 1371
270 Ga0501067_0063478 3300049583 Bacteria 2045
271 Ga0501069_0004061 3300049585 Bacteria 7558
272 Ga0501073_0259035 3300049589 Bacteria 1200
273 Ga0501074_0056279 3300049590 Bacteria 2834
274 Ga0501080_0054315 3300049742 Bacteria 3729
275 Ga0501083_0198631 3300049744 Bacteria 1308
276 Ga0501035_0238890 3300049822 Bacteria 1546
277 nmdc:mga03683_24707_c1 3300050489 Bacteria 1771
278 nmdc:mga00v17_105914_c1 3300050491 Bacteria 1780
279 nmdc:mga00v17_71424_c1 3300050491 Bacteria 2151
280 nmdc:mga0yw44_266_c1 3300050492 Bacteria 16414
281 nmdc:mga0yw44_31537_c1 3300050492 Bacteria 3083
282 nmdc:mga0yw44_77022_c1 3300050492 Bacteria 2083
283 nmdc:mga07m45_3182_c1 3300050496 Bacteria 7883
284 nmdc:mga05p37_421353_c1 3300050507 Bacteria 1553
285 nmdc:mga09592_804_c1 3300050508 Bacteria 12320
286 nmdc:mga08y16_154691_c1 3300050511 Bacteria 2383
287 nmdc:mga08y16_7678_c1 3300050511 Bacteria 11291
288 Ga0495601_0017863 3300053077 Bacteria 4311
289 Ga0500635_0000238 3300053080 Bacteria 24308
290 Ga0495619_0015203 3300053085 Bacteria 4866
291 Ga0495619_0046318 3300053085 Bacteria 2859
292 Ga0495619_0105943 3300053085 Bacteria 1917
293 Ga0500590_018161 3300053148 Bacteria 3639
294 2513956209 2513237150 Bacteria 6553639
295 2514042519 2513237165 Bacteria 6771773
296 2599904208 2599185292 Bacteria 6290804
297 2643859357 2643221569 Bacteria 6064337
298 2643979737 2643221594 Bacteria 5811388
299 2644123118 2643221621 Bacteria 6212786
300 2809033642 2808606395 Bacteria 6020352
301 2834644103 2834641062 Bacteria 5559922
302 2857537877 2857537821 Bacteria 5248181
303 2858954375 2858950400 Bacteria 6783797
304 2941484103
305 644746420 644736347 Bacteria 6476522
306 8002392545 8002392321 Bacteria 4159911
307 8003402941 8003400568 Bacteria 5535898
308 Ga0157372_10325262
309 JGI25151J46595_10022854
310 rootH1_10045136
311 Ga0070658_10019437
312 Ga0070676_10004773
313 Ga0070683_100037591
314 Ga0070690_100010159
315 Ga0070670_100126125
316 Ga0068869_100006996
317 Ga0068869_100037518
318 Ga0070666_10001777
319 Ga0070666_10010772
320 Ga0070680_100186425
321 Ga0068868_100013452
322 Ga0068868_100414956
323 Ga0070689_100004203
324 Ga0070661_100024460
325 Ga0070661_100223808
326 Ga0070692_10165703
327 Ga0070668_100006810
328 Ga0070669_100000933
329 Ga0070675_100002683
330 Ga0070675_100037866
331 Ga0070671_100006507
332 Ga0070671_100103847
333 Ga0070674_100075253
334 Ga0070673_100003903
335 Ga0070673_100299795
336 Ga0070688_100237680
337 Ga0070667_100001256
338 Ga0070667_100009791
339 Ga0070714_100054479
340 Ga0070713_100070514
341 Ga0070700_100049283
342 Ga0070694_100115020
343 Ga0070678_100079350
344 Ga0070678_100229636
345 Ga0070662_100062677
346 Ga0070662_100099270
347 Ga0070681_10030216
348 Ga0070681_10283014
349 Ga0068867_100008392
350 Ga0068867_100016583
351 Ga0070706_100116299
352 Ga0070707_100046406
353 Ga0070684_100023172
354 Ga0068853_100015551
355 Ga0068853_100061667
356 Ga0070672_100007892
357 Ga0070672_100060747
358 Ga0070672_100158416
359 Ga0070672_100182433
360 Ga0070672_100325506
361 Ga0070686_100155107
362 Ga0070693_100146783
363 Ga0068855_100009360
364 Ga0068855_100009963
365 Ga0068855_100010207
366 Ga0068855_100023252
367 Ga0070664_100084214
368 Ga0070664_100264384
369 Ga0068852_100013794
370 Ga0068859_100036005
371 Ga0068859_100040103
372 Ga0068864_100000251
373 Ga0068851_10008649
374 Ga0068863_100011130
375 Ga0068863_100036050
376 Ga0068858_100000210
377 Ga0068858_100001135
378 Ga0068860_100014125
379 Ga0068860_100076667
380 Ga0068862_100018455
381 Ga0081455_10006420
382 Ga0081455_10006972
383 Ga0075364_10086163
384 Ga0075364_10097426
385 Ga0070716_100278492
386 Ga0075362_10023719
387 Ga0075362_10058944
388 Ga0075367_10028506
389 Ga0075369_10008355
390 Ga0075366_10007747
391 Ga0075366_10020025
392 Ga0097621_100044330
393 Ga0097621_100116913
394 Ga0075370_10012778
395 Ga0075370_10065318
396 Ga0075428_100018679
397 Ga0075429_100053750
398 Ga0068865_100001941
399 Ga0097620_100036005
400 Ga0097620_100040105
401 Ga0105240_10001172
402 Ga0105240_10012402
403 Ga0105240_10517630
404 Ga0111539_10176434
405 Ga0105245_10328327
406 Ga0105243_10061673
407 Ga0105241_10003943
408 Ga0105241_10185140
409 Ga0105242_10015559
410 Ga0105248_10075673
411 Ga0105248_10191048
412 Ga0105248_10647714
413 Ga0105237_10000806
414 Ga0105238_10029143
415 Ga0105238_10076726
416 Ga0105249_10015329
417 Ga0105239_10000292
418 Ga0157374_10030993
419 Ga0163162_10011710
420 Ga0157372_10014280
421 Ga0157375_10013832
422 Ga0157375_10107413
423 Ga0163163_10001708
424 Ga0163163_10210780
425 Ga0157380_10003191
426 Ga0157380_10020025
427 Ga0157379_10007940
428 Ga0157379_10041669
429 Ga0163161_10005245
430 Ga0163161_10060387
431 Ga0163161_10104017
432 Ga0206353_11158709
433 Ga0213876_10013810
434 Ga0209677_101082
435 Ga0209675_1001703
436 Ga0209676_1003997
437 Ga0209025_1000110
438 Ga0209051_1001306
439 Ga0209051_1020418
440 Ga0207656_10005288
441 Ga0207682_10033333
442 Ga0207642_10009910
443 Ga0207688_10066634
444 Ga0207680_10012074
445 Ga0207680_10022200
446 Ga0207680_10119204
447 Ga0207645_10004894
448 Ga0207645_10036504
449 Ga0207705_10036112
450 Ga0207705_10244724
451 Ga0207684_10083585
452 Ga0207654_10036801
453 Ga0207707_10098594
454 Ga0207707_10124870
455 Ga0207707_10257801
456 Ga0207695_10002211
457 Ga0207671_10032641
458 Ga0207660_10157759
459 Ga0207662_10007197
460 Ga0207646_10017598
461 Ga0207681_10000565
462 Ga0207694_10043448
463 Ga0207650_10142026
464 Ga0207659_10000715
465 Ga0207659_10009176
466 Ga0207659_10053576
467 Ga0207700_10198727
468 Ga0207644_10007245
469 Ga0207706_10003299
470 Ga0207706_10059771
471 Ga0207706_10147727
472 Ga0207709_10029496
473 Ga0207670_10008332
474 Ga0207669_10015197
475 Ga0207669_10044747
476 Ga0207704_10001465
477 Ga0207691_10188521
478 Ga0207691_10191891
479 Ga0207691_10197183
480 Ga0207711_10011331
481 Ga0207711_10024990
482 Ga0207689_10005434
483 Ga0207689_10015951
484 Ga0207661_10086664
485 Ga0207661_10132072
486 Ga0207667_10051656
487 Ga0207667_10086337
488 Ga0207667_10129508
489 Ga0207651_10162892
490 Ga0207651_10318324
491 Ga0207668_10001216
492 Ga0207658_10003507
493 Ga0207658_10021633
494 Ga0207703_10001247
495 Ga0207703_10003582
496 Ga0207639_10015856
497 Ga0207708_10078716
498 Ga0207641_10002184
499 Ga0207648_10009973
500 Ga0207648_10025165
501 Ga0207676_10003892
502 Ga0207675_100164488
503 Ga0207683_10035912
504 Ga0207683_10049904
505 Ga0207683_10197055
506 Ga0207698_10125721
507 Ga0207698_10184788
508 Ga0209371_1013201
509 Ga0207428_10090836
510 Ga0268265_10024681
511 Ga0268264_10063397
512 Ga0268264_10097859
513 Ga0268256_1014483
514 Ga0307412_10000200
515 Ga0307414_10097300
516 Ga0373945_0007746
517 Ga0373946_0044842
518 Ga0373935_0017137
519 Ga0373933_0192244
520 Ga0373947_0095216
521 Ga0373937_0013470
522 Ga0373937_0171516
523 Ga0373925_0081679
524 Ga0395900_0011310
525 Ga0436365_0053118
526 Ga0436365_0217321
527 Ga0436363_1224698
528 Ga0439436_0024756
529 Ga0439464_0000905
530 Ga0451576_0183751
531 Ga0495580_0005023
532 Ga0495628_0210245
533 Ga0495666_0001999
534 Ga0495665_0002504
535 Ga0495621_0004252
536 Ga0495645_0061476
537 Ga0495645_0106069
538 Ga0495658_0056754
539 Ga0495613_0039797
540 Ga0495600_0077853
541 Ga0495604_0009273
542 Ga0495636_0023384
543 Ga0495674_0337614
544 Ga0495676_0338370
545 Ga0496102_0377549
546 Ga0496102_0447642
547 Ga0496105_0170759
548 Ga0496108_0099805
549 Ga0496108_0214152
550 Ga0496110_0253434
551 Ga0496114_0008458
552 Ga0496114_0165115
553 Ga0496116_0015057
554 Ga0496117_0058463
555 Ga0496118_0002848
556 Ga0496118_0012142
557 Ga0496119_0018156
558 Ga0496120_0002648
559 Ga0496121_0000195
560 Ga0496122_0000498
561 Ga0496122_0046543
562 Ga0496122_0051910
563 Ga0496123_0000390
564 Ga0496123_0009300
565 Ga0496123_0016857
566 Ga0496125_0000364
567 Ga0496125_0000408
568 Ga0496125_0012281
569 Ga0496125_0057822
570 Ga0496125_0061233
571 Ga0496126_0016001
572 Ga0496126_0267903
573 Ga0501031_0196324
574 Ga0501034_0000718
575 Ga0501039_0140678
576 Ga0501046_0229877
577 Ga0501067_0063478
578 Ga0501069_0004061
579 Ga0501073_0259035
580 Ga0501074_0056279
581 Ga0501080_0054315
582 Ga0501083_0198631
583 Ga0501035_0238890
584 nmdc:mga03683_24707_c1
585 nmdc:mga00v17_105914_c1
586 nmdc:mga00v17_71424_c1
587 nmdc:mga0yw44_266_c1
588 nmdc:mga0yw44_31537_c1
589 nmdc:mga0yw44_77022_c1
590 nmdc:mga07m45_3182_c1
591 nmdc:mga05p37_421353_c1
592 nmdc:mga09592_804_c1
593 nmdc:mga08y16_154691_c1
594 nmdc:mga08y16_7678_c1
595 Ga0495601_0017863
596 Ga0500635_0000238
597 Ga0495619_0015203
598 Ga0495619_0046318
599 Ga0495619_0105943
600 Ga0500590_018161
601 2513956209
602 2514042519
603 2599904208
604 2643859357
605 2643979737
606 2644123118
607 2809033642
608 2834644103
609 2857537877
610 2858954375
611 2941484103
612 644746420
613 8002392545
614 8003402941

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

73

347

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.9541 39 335
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.951 39 335
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.9437 38 335
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.9406 38 335
7ndr-assembly1.cif.gz_E crystal structure of tphc in an open conformation 0.9264 41 332
ID Description Score Start End Superfamily
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9461 137 259 3.40.190.10
2f5xC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9429 139 259 3.40.190.10
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9424 137 255 3.40.190.10
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9386 137 259 3.40.190.10
2dvzA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9379 38 335 3.40.190.150
ID Description Score Start End GO Terms
AF-A0A519I8E8-F1-model_v4 deleted 0.9787 114 335
AF-A0A537UVY4-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.978 142 335
AF-J2SVG2-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9752 65 335
AF-A0A439F197-F1-model_v4 deleted 0.9749 92 335
AF-A0A536XT46-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9741 67 335

Map