F399125

General Info

Members Datasets Scaffolds Average Seq Length
307 224 288 143

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10618857|Ga0070717_106188572
Length 164
Sequence MSSRGRPSVAPGRTRLYGGPMTSVKQFQVAFDCAEPERVARFWCEVLGYVVPPPPEGFVTWDDYSRSLPPEDRDSWFACVDPSGVGPRLYFQRVPEGKAVKNRVHLDVRVGTGLVGAERLAVLEAECTRLVALGAVRVRLLTADEDNESCIVMQDIEGNEFDLD

Samples

Sample ID Description Type Environment
1 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
2 2643221613 Oerskovia sp. Root22 Isolate Unclassified
3 2643221647 Streptomyces sp. Root369 Isolate Unclassified
4 2643221721 Oerskovia sp. Root918 Isolate Unclassified
5 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
6 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
7 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
8 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
9 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
10 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
11 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
12 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
13 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
14 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
15 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
16 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
17 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
18 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
54 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
79 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
80 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
81 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
82 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
83 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
84 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
85 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
86 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
87 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
91 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
92 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
93 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
94 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
95 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
96 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
97 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
98 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
99 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
100 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
101 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
102 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
103 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
104 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
105 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
106 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
107 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
116 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
117 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
118 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
119 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
120 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
121 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
122 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
123 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
124 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
125 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
126 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
127 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
128 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
129 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
130 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
131 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
132 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
135 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
136 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
137 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
138 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
139 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
140 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
141 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
142 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
143 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
144 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
145 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
146 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
147 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
148 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
149 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
150 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
151 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
152 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
153 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
154 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
155 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
156 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
157 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
158 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
159 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
162 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
163 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
164 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
165 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
166 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
167 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
168 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
169 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
170 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
171 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
172 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
173 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
174 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
175 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
176 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
177 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
178 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
179 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
180 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
191 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
192 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
193 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
194 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
195 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
196 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
197 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
198 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
211 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
212 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
213 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
214 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
215 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
216 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
217 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
218 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
219 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
220 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
221 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
222 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
223 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
224 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.81
Metatranscriptomes 0
Isolates 6.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.58
Nodule 0
Rhizoplane 3.91
Rhizosphere 80.46
Stem 0
Stem Tuber 0
Unclassified 12.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100774130 3300005329 Bacteria 920
2 Ga0070682_100374232 3300005337 Bacteria 1069
3 Ga0070668_100938856 3300005347 Bacteria 775
4 Ga0070659_100848843 3300005366 Bacteria 796
5 Ga0070709_10055807 3300005434 Bacteria 2495
6 Ga0070714_100062988 3300005435 Bacteria 3188
7 Ga0070714_100104637 3300005435 Bacteria 2498
8 Ga0070714_100253647 3300005435 Bacteria 1627
9 Ga0070714_100348511 3300005435 Bacteria 1390
10 Ga0070713_100070109 3300005436 Bacteria 2958
11 Ga0070713_100106109 3300005436 Bacteria 2442
12 Ga0070713_100569961 3300005436 Bacteria 1073
13 Ga0070710_10085204 3300005437 Bacteria 1853
14 Ga0070711_100660243 3300005439 Bacteria 877
15 Ga0070694_100598718 3300005444 Bacteria 887
16 Ga0070685_10082660 3300005466 Bacteria 1928
17 Ga0070679_100402596 3300005530 Bacteria 1314
18 Ga0070664_100836030 3300005564 Bacteria 862
19 Ga0068866_10343026 3300005718 Bacteria 947
20 Ga0068863_100313532 3300005841 Bacteria 1523
21 Ga0068858_101261901 3300005842 Bacteria 727
22 Ga0081455_10652653 3300005937 Bacteria 677
23 Ga0070717_10439027 3300006028 Bacteria 1175
24 Ga0070717_10618857 3300006028 Bacteria 982
25 Ga0070717_10748440 3300006028 Bacteria 888
26 Ga0070717_11920274 3300006028 Bacteria 534
27 Ga0075363_100470497 3300006048 Bacteria 744
28 Ga0070715_10105199 3300006163 Bacteria 1323
29 Ga0070716_100111550 3300006173 Bacteria 1696
30 Ga0075369_10140750 3300006186 Bacteria 1100
31 Ga0097621_101035324 3300006237 Bacteria 769
32 Ga0099794_10487591 3300007265 Bacteria 648
33 Ga0105247_10133406 3300009101 Bacteria 1620
34 Ga0105243_10514389 3300009148 Bacteria 1137
35 Ga0105241_10262772 3300009174 Bacteria 1467
36 Ga0105248_10501820 3300009177 Bacteria 1368
37 Ga0105237_10006117 3300009545 Bacteria 13454
38 Ga0105239_10355614 3300010375 Bacteria 1654
39 Ga0105246_10801790 3300011119 Bacteria 836
40 Ga0157369_10002584 3300013105 Bacteria 21674
41 Ga0157369_10049026 3300013105 Bacteria 4580
42 Ga0157375_10390063 3300013308 Bacteria 1559
43 Ga0163163_11004731 3300014325 Bacteria 897
44 Ga0213875_10000800 3300021388 Bacteria 23523
45 Ga0213875_10136263 3300021388 Bacteria 1148
46 Ga0207696_1112231 3300025711 Bacteria 738
47 Ga0207642_10370644 3300025899 Bacteria 850
48 Ga0207647_10013682 3300025904 Bacteria 5619
49 Ga0207685_10080873 3300025905 Bacteria 1344
50 Ga0207643_10069453 3300025908 Bacteria 2025
51 Ga0207707_10312424 3300025912 Bacteria 1358
52 Ga0207671_10028034 3300025914 Bacteria 4209
53 Ga0207693_10010380 3300025915 Bacteria 7561
54 Ga0207663_11019444 3300025916 Bacteria 664
55 Ga0207660_10316824 3300025917 Bacteria 1245
56 Ga0207652_10530545 3300025921 Bacteria 1059
57 Ga0207700_10177187 3300025928 Bacteria 1782
58 Ga0207700_10305786 3300025928 Bacteria 1374
59 Ga0207700_10352816 3300025928 Bacteria 1281
60 Ga0207664_10044893 3300025929 Bacteria 3463
61 Ga0207664_10878888 3300025929 Bacteria 805
62 Ga0207644_10821114 3300025931 Bacteria 778
63 Ga0207709_10839032 3300025935 Bacteria 744
64 Ga0207669_10088318 3300025937 Bacteria 2010
65 Ga0207711_10337072 3300025941 Bacteria 1395
66 Ga0207661_10226272 3300025944 Bacteria 1655
67 Ga0207668_11472250 3300025972 Bacteria 614
68 Ga0207703_10966216 3300026035 Bacteria 817
69 Ga0207639_10903573 3300026041 Bacteria 825
70 Ga0207702_10764530 3300026078 Bacteria 954
71 Ga0207683_10532177 3300026121 Bacteria 1086
72 Ga0207698_12031555 3300026142 Bacteria 589
73 Ga0307517_10235627 3300028786 Bacteria 1092
74 Ga0265338_10000772 3300028800 Bacteria 54559
75 Ga0307511_10032519 3300030521 Bacteria 4632
76 Ga0307512_10020724 3300030522 Bacteria 5941
77 Ga0307513_10028172 3300031456 Bacteria 6427
78 Ga0307516_10393350 3300031730 Bacteria 1046
79 Ga0307405_10675100 3300031731 Bacteria 853
80 Ga0307405_11036447 3300031731 Bacteria 702
81 Ga0307413_10753038 3300031824 Bacteria 814
82 Ga0307518_10117623 3300031838 Bacteria 1886
83 Ga0307518_10135672 3300031838 Bacteria 1723
84 Ga0307518_10347580 3300031838 Bacteria 866
85 Ga0307412_10279646 3300031911 Bacteria 1310
86 Ga0307409_101602780 3300031995 Bacteria 679
87 Ga0307416_101902371 3300032002 Bacteria 698
88 Ga0307415_100826245 3300032126 Bacteria 848
89 Ga0307507_10072548 3300033179 Bacteria 3102
90 Ga0307510_10017239 3300033180 Bacteria 8523
91 Ga0307510_10419173 3300033180 Bacteria 781
92 Ga0373926_0002307 3300035083 Bacteria 6029
93 Ga0373934_0035474 3300035086 Bacteria 1962
94 Ga0373934_0119396 3300035086 Bacteria 1072
95 Ga0373936_0000602 3300035113 Bacteria 12454
96 Ga0373936_0088284 3300035113 Bacteria 1297
97 Ga0373945_0000122 3300035116 Bacteria 19157
98 Ga0373953_0122705 3300035117 Bacteria 1104
99 Ga0373956_0281502 3300035119 Bacteria 791
100 Ga0373957_0020778 3300035120 Bacteria 2324
101 Ga0373943_0000154 3300035170 Bacteria 26850
102 Ga0373946_0000320 3300035171 Bacteria 15539
103 Ga0373955_0168010 3300035172 Bacteria 1297
104 Ga0373955_0698486 3300035172 Bacteria 623
105 Ga0373924_0452806 3300035410 Bacteria 575
106 Ga0373935_0916695 3300035692 Bacteria 649
107 Ga0373927_0000295 3300035695 Bacteria 39423
108 Ga0373933_0035217 3300035724 Bacteria 2922
109 Ga0373933_0038580 3300035724 Bacteria 2807
110 Ga0373933_0057154 3300035724 Bacteria 2344
111 Ga0373947_0000143 3300035725 Bacteria 37108
112 Ga0373937_0029864 3300036401 Bacteria 4937
113 Ga0373937_0054456 3300036401 Bacteria 3671
114 Ga0373925_0001994 3300037068 Bacteria 16911
115 Ga0373925_0475952 3300037068 Bacteria 1024
116 Ga0395899_0384744 3300037312 Bacteria 932
117 Ga0395900_0843197 3300037418 Bacteria 842
118 Ga0395898_0000804 3300037466 Bacteria 52956
119 Ga0395898_0167715 3300037466 Bacteria 2099
120 Ga0436364_0761177 3300037853 Bacteria 2227
121 Ga0436364_1195389 3300037853 Bacteria 9815
122 Ga0395901_0175197 3300038443 Bacteria 2250
123 Ga0395901_0362659 3300038443 Bacteria 1494
124 Ga0439461_0000964 3300041410 Bacteria 4315
125 Ga0439466_0003556 3300041411 Bacteria 6021
126 Ga0439466_0046343 3300041411 Bacteria 1436
127 Ga0439465_0001193 3300041413 Bacteria 8357
128 Ga0451853_0162272 3300041512 Bacteria 3383
129 Ga0439431_0000660 3300041997 Bacteria 7338
130 Ga0439445_0005627 3300042004 Bacteria 2861
131 Ga0439448_0057399 3300042005 Bacteria 1283
132 Ga0439434_0045813 3300042435 Bacteria 1349
133 Ga0466969_0153470 3300044656 Bacteria 1060
134 Ga0466965_0038748 3300044683 Bacteria 2342
135 Ga0466965_0169585 3300044683 Bacteria 1148
136 Ga0466965_0641806 3300044683 Bacteria 606
137 Ga0466966_0014422 3300044684 Bacteria 5233
138 Ga0466961_0023856 3300044693 Bacteria 3936
139 Ga0466961_0107037 3300044693 Bacteria 1760
140 Ga0466963_0329095 3300044694 Bacteria 1075
141 Ga0466971_0212756 3300044719 Bacteria 914
142 Ga0466970_0256662 3300044765 Bacteria 980
143 Ga0466957_0768961 3300044842 Bacteria 683
144 Ga0466960_0008740 3300044901 Bacteria 4157
145 Ga0466958_0167113 3300045836 Bacteria 1392
146 Ga0466967_0008307 3300045976 Bacteria 7591
147 Ga0466967_0021641 3300045976 Bacteria 5229
148 Ga0466967_0222070 3300045976 Bacteria 1796
149 Ga0495592_0059020 3300046454 Bacteria 2827
150 Ga0495592_0138568 3300046454 Bacteria 1695
151 Ga0495592_0335508 3300046454 Bacteria 973
152 Ga0495629_0027664 3300046459 Bacteria 4025
153 Ga0495629_0293983 3300046459 Bacteria 1113
154 Ga0495629_0457844 3300046459 Bacteria 863
155 Ga0495641_0007538 3300046461 Bacteria 6777
156 Ga0495651_0003137 3300046462 Bacteria 12748
157 Ga0495651_0079183 3300046462 Bacteria 2484
158 Ga0495651_0244385 3300046462 Bacteria 1229
159 Ga0495653_0028837 3300046463 Bacteria 4437
160 Ga0495653_0047695 3300046463 Bacteria 3312
161 Ga0495582_0032310 3300046473 Bacteria 2879
162 Ga0495639_0303411 3300046475 Bacteria 796
163 Ga0495662_0004776 3300046476 Bacteria 6792
164 Ga0495662_0228095 3300046476 Bacteria 918
165 Ga0495664_0003056 3300046477 Bacteria 9066
166 Ga0495664_0005174 3300046477 Bacteria 7157
167 Ga0495608_0039443 3300046511 Bacteria 3165
168 Ga0495618_0009275 3300046514 Bacteria 5938
169 Ga0495618_0208563 3300046514 Bacteria 1235
170 Ga0495618_0263465 3300046514 Bacteria 1079
171 Ga0495628_0057029 3300046516 Bacteria 3073
172 Ga0495628_0083498 3300046516 Bacteria 2480
173 Ga0495630_0238869 3300046517 Bacteria 1388
174 Ga0495630_0259888 3300046517 Bacteria 1326
175 Ga0495648_0005460 3300046524 Bacteria 10553
176 Ga0495652_0037752 3300046529 Bacteria 4188
177 Ga0495652_0086406 3300046529 Bacteria 2575
178 Ga0495652_0514294 3300046529 Bacteria 828
179 Ga0495654_0033666 3300046530 Bacteria 2592
180 Ga0495665_0055853 3300046531 Bacteria 2085
181 Ga0495640_0171025 3300046533 Bacteria 1388
182 Ga0495640_0201491 3300046533 Bacteria 1261
183 Ga0495586_0111071 3300046535 Bacteria 1526
184 Ga0495586_0737626 3300046535 Bacteria 568
185 Ga0495587_0001841 3300046536 Bacteria 14139
186 Ga0495587_0363712 3300046536 Bacteria 805
187 Ga0495587_0389050 3300046536 Bacteria 775
188 Ga0495645_0009117 3300046543 Bacteria 6933
189 Ga0495645_0051163 3300046543 Bacteria 3006
190 Ga0495645_0059242 3300046543 Bacteria 2777
191 Ga0495622_0137158 3300046557 Bacteria 1112
192 Ga0495667_0005468 3300046559 Bacteria 8584
193 Ga0495667_0007456 3300046559 Bacteria 7416
194 Ga0495634_0014934 3300046642 Bacteria 5584
195 Ga0495611_0033918 3300046648 Bacteria 2254
196 Ga0495625_0536613 3300046660 Bacteria 710
197 Ga0495635_0004287 3300046663 Bacteria 9874
198 Ga0495635_0014284 3300046663 Bacteria 5556
199 Ga0495635_0018192 3300046663 Bacteria 4905
200 Ga0495588_0194789 3300046674 Bacteria 1070
201 Ga0495657_0001614 3300046675 Bacteria 19370
202 Ga0495657_0020017 3300046675 Bacteria 4818
203 Ga0495657_0021598 3300046675 Bacteria 4618
204 Ga0495599_0021108 3300046678 Bacteria 4061
205 Ga0495599_0179671 3300046678 Bacteria 1305
206 Ga0495646_0091202 3300046680 Bacteria 1759
207 Ga0495647_0206771 3300046681 Bacteria 862
208 Ga0495613_0097927 3300046689 Bacteria 2119
209 Ga0495613_0458419 3300046689 Bacteria 863
210 Ga0495624_0011510 3300046690 Bacteria 6081
211 Ga0495624_0400617 3300046690 Bacteria 824
212 Ga0495600_0008444 3300046809 Bacteria 6327
213 Ga0495600_0025229 3300046809 Bacteria 3830
214 Ga0495600_0248092 3300046809 Bacteria 1133
215 Ga0495581_0004708 3300047315 Bacteria 7878
216 Ga0495581_0014168 3300047315 Bacteria 4621
217 Ga0495581_0565578 3300047315 Bacteria 659
218 Ga0495604_0027003 3300047317 Bacteria 4568
219 Ga0495604_0087578 3300047317 Bacteria 2319
220 Ga0495674_0000541 3300047319 Bacteria 34957
221 Ga0495674_0265879 3300047319 Bacteria 1408
222 Ga0495674_0297390 3300047319 Bacteria 1319
223 Ga0495672_0001138 3300047320 Bacteria 26870
224 Ga0495676_0028621 3300047321 Bacteria 4754
225 Ga0495676_0029110 3300047321 Bacteria 4705
226 Ga0495680_0010708 3300047322 Bacteria 8178
227 Ga0495680_0031405 3300047322 Bacteria 4324
228 Ga0495675_0113135 3300047444 Bacteria 1693
229 Ga0495673_0000696 3300047469 Bacteria 32803
230 Ga0495684_0015990 3300047471 Bacteria 5778
231 Ga0495684_0065676 3300047471 Bacteria 2758
232 Ga0495593_0000736 3300047673 Bacteria 18999
233 Ga0495593_0116104 3300047673 Bacteria 1364
234 Ga0495593_0124753 3300047673 Bacteria 1309
235 Ga0495614_0007337 3300048089 Bacteria 4909
236 Ga0496100_0029492 3300048903 Bacteria 3394
237 Ga0496101_0076264 3300048904 Bacteria 2469
238 Ga0496102_0000006 3300048905 Bacteria 471494
239 Ga0496103_0000006 3300048906 Bacteria 470539
240 Ga0496104_0126037 3300048907 Bacteria 2459
241 Ga0496105_0035719 3300048908 Bacteria 4092
242 Ga0496106_0023994 3300048909 Bacteria 4532
243 Ga0496107_0028956 3300048910 Bacteria 3938
244 Ga0496108_0000280 3300048911 Bacteria 43780
245 Ga0496109_2002131 3300048912 Bacteria 511
246 Ga0496115_0069927 3300048918 Bacteria 2844
247 Ga0496115_0280574 3300048918 Bacteria 1368
248 Ga0496116_0000025 3300048919 Bacteria 470539
249 Ga0496117_0000006 3300048920 Bacteria 758420
250 Ga0496118_0000004 3300048921 Bacteria 758420
251 Ga0496120_0282916 3300048923 Bacteria 766
252 Ga0496121_0119442 3300048924 Bacteria 1993
253 Ga0496122_0246060 3300048925 Bacteria 1004
254 Ga0496126_0000985 3300048929 Bacteria 48830
255 Ga0496126_0076888 3300048929 Bacteria 2960
256 Ga0496126_0168403 3300048929 Bacteria 1868
257 Ga0501032_0023140 3300049569 Bacteria 4301
258 Ga0501032_0250842 3300049569 Bacteria 1149
259 Ga0501033_0001558 3300049570 Bacteria 20229
260 Ga0501033_0228659 3300049570 Bacteria 1322
261 Ga0501034_0143868 3300049571 Bacteria 2363
262 Ga0501034_0658121 3300049571 Bacteria 949
263 Ga0501037_0856548 3300049573 Bacteria 598
264 Ga0501038_0040039 3300049574 Bacteria 4096
265 Ga0501039_0093540 3300049575 Bacteria 2343
266 Ga0501042_0619380 3300049578 Bacteria 787
267 Ga0501046_0114651 3300049580 Bacteria 2055
268 Ga0501047_0005935 3300049581 Bacteria 11486
269 Ga0501047_0098988 3300049581 Bacteria 2795
270 Ga0501048_0002212 3300049582 Bacteria 14809
271 Ga0501070_0002178 3300049586 Bacteria 17230
272 Ga0501035_0643227 3300049822 Bacteria 860
273 nmdc:mga03n38_413965_c1 3300050490 Bacteria 744
274 nmdc:mga09592_98710_c1 3300050508 Bacteria 2500
275 nmdc:mga0n895_1758350_c1 3300050512 Bacteria 581
276 nmdc:mga08x19_996821_c1 3300050514 Bacteria 595
277 nmdc:mga0sz30_120308_c1 3300050516 Bacteria 1153
278 nmdc:mga0sz30_22854_c1 3300050516 Bacteria 2540
279 Ga0495595_0420430 3300053084 Bacteria 678
280 Ga0495619_0126103 3300053085 Bacteria 1757
281 Ga0500578_0443872 3300053086 Bacteria 740
282 Ga0500640_043845 3300053095 Bacteria 1963
283 Ga0500553_073946 3300053101 Bacteria 1557
284 Ga0500559_0392831 3300053136 Bacteria 646
285 Ga0500586_213913 3300053145 Bacteria 625
286 Ga0500633_0340860 3300053160 Bacteria 547
287 Ga0466962_0040675 3300061719 Bacteria 2224
288 Ga0466962_0416398 3300061719 Bacteria 674

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005366 Ga0070659_100848843 Ga0070659_1008488431 133
2 3300050508 nmdc:mga09592_98710_c1 nmdc:mga09592_98710_c1_138_560 135
3 3300044683 Ga0466965_0169585 Ga0466965_0169585_369_791 137
4 3300044694 Ga0466963_0329095 Ga0466963_0329095_590_1012 137
5 3300044842 Ga0466957_0768961 Ga0466957_0768961_60_482 137
6 3300045976 Ga0466967_0021641 Ga0466967_0021641_1281_1703 137
7 3300041410 Ga0439461_0000964 Ga0439461_0000964_3334_3768 138
8 3300041411 Ga0439466_0003556 Ga0439466_0003556_2932_3366 138
9 3300041997 Ga0439431_0000660 Ga0439431_0000660_2441_2875 138
10 3300042004 Ga0439445_0005627 Ga0439445_0005627_1700_2134 138
11 3300042435 Ga0439434_0045813 Ga0439434_0045813_525_959 138
12 iso_pu_bacteria 2643221647 2644267526 138
13 iso_pu_bacteria 2862507626 2862515061 138
14 iso_pu_bacteria 3006486233 3006487156 138
15 iso_pu_bacteria 8023623736 8023629326 138
16 3300006028 Ga0070717_11920274 Ga0070717_119202741 140
17 3300007265 Ga0099794_10487591 Ga0099794_104875911 140
18 3300021388 Ga0213875_10136263 Ga0213875_101362631 140
19 3300035086 Ga0373934_0119396 Ga0373934_0119396_182_613 140
20 3300035113 Ga0373936_0088284 Ga0373936_0088284_337_768 140
21 3300035117 Ga0373953_0122705 Ga0373953_0122705_377_808 140
22 3300035120 Ga0373957_0020778 Ga0373957_0020778_1703_2134 140
23 3300035172 Ga0373955_0168010 Ga0373955_0168010_344_775 140
24 3300035410 Ga0373924_0452806 Ga0373924_0452806_32_463 140
25 3300035692 Ga0373935_0916695 Ga0373935_0916695_48_479 140
26 3300035724 Ga0373933_0035217 Ga0373933_0035217_2304_2735 140
27 3300036401 Ga0373937_0029864 Ga0373937_0029864_830_1261 140
28 3300037068 Ga0373925_0475952 Ga0373925_0475952_322_753 140
29 3300037853 Ga0436364_0761177 Ga0436364_0761177_745_1176 140
30 3300046454 Ga0495592_0138568 Ga0495592_0138568_1026_1457 140
31 3300046463 Ga0495653_0047695 Ga0495653_0047695_2512_2943 140
32 3300046511 Ga0495608_0039443 Ga0495608_0039443_656_1087 140
33 3300046514 Ga0495618_0263465 Ga0495618_0263465_192_623 140
34 3300046517 Ga0495630_0259888 Ga0495630_0259888_841_1272 140
35 3300046529 Ga0495652_0514294 Ga0495652_0514294_198_629 140
36 3300046533 Ga0495640_0201491 Ga0495640_0201491_390_821 140
37 3300046559 Ga0495667_0007456 Ga0495667_0007456_3990_4421 140
38 3300046663 Ga0495635_0018192 Ga0495635_0018192_1759_2190 140
39 3300046675 Ga0495657_0021598 Ga0495657_0021598_1042_1473 140
40 3300046678 Ga0495599_0179671 Ga0495599_0179671_201_632 140
41 3300046680 Ga0495646_0091202 Ga0495646_0091202_427_858 140
42 3300046809 Ga0495600_0248092 Ga0495600_0248092_189_620 140
43 3300047315 Ga0495581_0565578 Ga0495581_0565578_217_648 140
44 3300047319 Ga0495674_0265879 Ga0495674_0265879_279_710 140
45 3300047322 Ga0495680_0031405 Ga0495680_0031405_3695_4126 140
46 3300047471 Ga0495684_0065676 Ga0495684_0065676_1909_2340 140
47 3300047673 Ga0495593_0124753 Ga0495593_0124753_701_1132 140
48 3300049578 Ga0501042_0619380 Ga0501042_0619380_235_669 140
49 iso_pu_bacteria 2616644941 2616904088 140
50 iso_pu_bacteria 2643221613 2644084352 140
51 iso_pu_bacteria 2643221721 2644664400 140
52 iso_pu_bacteria 2808606359 2808848880 140
53 iso_pu_bacteria 2808606522 2809592872 140
54 iso_pu_bacteria 2811994879 2812353591 140
55 iso_pu_bacteria 2839986021 2839986278 140
56 iso_pu_bacteria 2852635781 2852638876 140
57 iso_pu_bacteria 2884693830 2884698757 140
58 iso_pu_bacteria 2895442618 2895450126 140
59 iso_pu_bacteria 2902792274 2902798899 140
60 iso_pu_bacteria 2932431166 2932431312 140
61 iso_pu_bacteria 2935890801 2935891871 140
62 iso_pu_bacteria 2946064051 2946072113 140
63 3300044656 Ga0466969_0153470 Ga0466969_0153470_64_489 141
64 3300044719 Ga0466971_0212756 Ga0466971_0212756_284_709 141
65 3300044765 Ga0466970_0256662 Ga0466970_0256662_286_711 141
66 3300045836 Ga0466958_0167113 Ga0466958_0167113_218_643 141
67 3300049570 Ga0501033_0001558 Ga0501033_0001558_10206_10631 141
68 3300061719 Ga0466962_0040675 Ga0466962_0040675_895_1320 141
69 iso_pu_bacteria 2919042368 2919044757 141
70 3300005937 Ga0081455_10652653 Ga0081455_106526531 142
71 3300025931 Ga0207644_10821114 Ga0207644_108211141 142
72 3300028786 Ga0307517_10235627 Ga0307517_102356272 142
73 3300030522 Ga0307512_10020724 Ga0307512_100207246 142
74 3300031456 Ga0307513_10028172 Ga0307513_100281726 142
75 3300033179 Ga0307507_10072548 Ga0307507_100725483 142
76 3300033180 Ga0307510_10419173 Ga0307510_104191732 142
77 3300041512 Ga0451853_0162272 Ga0451853_0162272_1763_2191 142
78 3300044683 Ga0466965_0038748 Ga0466965_0038748_749_1195 142
79 3300044683 Ga0466965_0641806 Ga0466965_0641806_157_585 142
80 3300044693 Ga0466961_0107037 Ga0466961_0107037_1274_1720 142
81 3300044901 Ga0466960_0008740 Ga0466960_0008740_3559_4005 142
82 3300046454 Ga0495592_0059020 Ga0495592_0059020_2194_2622 142
83 3300046459 Ga0495629_0027664 Ga0495629_0027664_3176_3604 142
84 3300046459 Ga0495629_0293983 Ga0495629_0293983_245_673 142
85 3300046459 Ga0495629_0457844 Ga0495629_0457844_113_541 142
86 3300046462 Ga0495651_0003137 Ga0495651_0003137_10771_11199 142
87 3300046475 Ga0495639_0303411 Ga0495639_0303411_286_714 142
88 3300046476 Ga0495662_0004776 Ga0495662_0004776_5358_5786 142
89 3300046477 Ga0495664_0005174 Ga0495664_0005174_4465_4893 142
90 3300046514 Ga0495618_0208563 Ga0495618_0208563_121_549 142
91 3300046516 Ga0495628_0083498 Ga0495628_0083498_1878_2306 142
92 3300046517 Ga0495630_0238869 Ga0495630_0238869_538_966 142
93 3300046529 Ga0495652_0086406 Ga0495652_0086406_1983_2411 142
94 3300046535 Ga0495586_0111071 Ga0495586_0111071_73_501 142
95 3300046536 Ga0495587_0001841 Ga0495587_0001841_2239_2667 142
96 3300046543 Ga0495645_0009117 Ga0495645_0009117_265_693 142
97 3300046557 Ga0495622_0137158 Ga0495622_0137158_302_730 142
98 3300046663 Ga0495635_0004287 Ga0495635_0004287_1206_1634 142
99 3300046674 Ga0495588_0194789 Ga0495588_0194789_111_539 142
100 3300046675 Ga0495657_0001614 Ga0495657_0001614_17502_17930 142
101 3300046689 Ga0495613_0097927 Ga0495613_0097927_379_807 142
102 3300046689 Ga0495613_0458419 Ga0495613_0458419_148_576 142
103 3300046690 Ga0495624_0400617 Ga0495624_0400617_239_667 142
104 3300046809 Ga0495600_0025229 Ga0495600_0025229_1206_1634 142
105 3300047315 Ga0495581_0004708 Ga0495581_0004708_3424_3852 142
106 3300047317 Ga0495604_0027003 Ga0495604_0027003_3617_4045 142
107 3300047319 Ga0495674_0297390 Ga0495674_0297390_772_1200 142
108 3300047321 Ga0495676_0028621 Ga0495676_0028621_2339_2767 142
109 3300047444 Ga0495675_0113135 Ga0495675_0113135_817_1245 142
110 3300047673 Ga0495593_0000736 Ga0495593_0000736_9034_9462 142
111 3300048089 Ga0495614_0007337 Ga0495614_0007337_374_802 142
112 3300049569 Ga0501032_0250842 Ga0501032_0250842_561_989 142
113 3300049571 Ga0501034_0658121 Ga0501034_0658121_452_880 142
114 3300049573 Ga0501037_0856548 Ga0501037_0856548_137_565 142
115 3300049581 Ga0501047_0098988 Ga0501047_0098988_1475_1903 142
116 3300049822 Ga0501035_0643227 Ga0501035_0643227_247_675 142
117 3300050512 nmdc:mga0n895_1758350_c1 nmdc:mga0n895_1758350_c1_88_522 142
118 3300053085 Ga0495619_0126103 Ga0495619_0126103_1174_1602 142
119 3300053086 Ga0500578_0443872 Ga0500578_0443872_231_659 142
120 3300053095 Ga0500640_043845 Ga0500640_043845_316_744 142
121 3300053101 Ga0500553_073946 Ga0500553_073946_198_626 142
122 3300053136 Ga0500559_0392831 Ga0500559_0392831_21_449 142
123 3300053145 Ga0500586_213913 Ga0500586_213913_20_448 142
124 3300005435 Ga0070714_100104637 Ga0070714_1001046373 143
125 3300006186 Ga0075369_10140750 Ga0075369_101407503 143
126 3300028800 Ga0265338_10000772 Ga0265338_1000077229 143
127 3300041411 Ga0439466_0046343 Ga0439466_0046343_953_1384 143
128 3300041413 Ga0439465_0001193 Ga0439465_0001193_5318_5749 143
129 3300048918 Ga0496115_0280574 Ga0496115_0280574_265_696 143
130 3300048929 Ga0496126_0168403 Ga0496126_0168403_32_463 143
131 3300050516 nmdc:mga0sz30_22854_c1 nmdc:mga0sz30_22854_c1_648_1079 143
132 3300005329 Ga0070683_100774130 Ga0070683_1007741302 144
133 3300005337 Ga0070682_100374232 Ga0070682_1003742322 144
134 3300005347 Ga0070668_100938856 Ga0070668_1009388561 144
135 3300005434 Ga0070709_10055807 Ga0070709_100558073 144
136 3300005435 Ga0070714_100062988 Ga0070714_1000629882 144
137 3300005435 Ga0070714_100253647 Ga0070714_1002536472 144
138 3300005435 Ga0070714_100348511 Ga0070714_1003485112 144
139 3300005436 Ga0070713_100070109 Ga0070713_1000701095 144
140 3300005436 Ga0070713_100106109 Ga0070713_1001061093 144
141 3300005436 Ga0070713_100569961 Ga0070713_1005699612 144
142 3300005437 Ga0070710_10085204 Ga0070710_100852042 144
143 3300005439 Ga0070711_100660243 Ga0070711_1006602432 144
144 3300005444 Ga0070694_100598718 Ga0070694_1005987181 144
145 3300005466 Ga0070685_10082660 Ga0070685_100826603 144
146 3300005530 Ga0070679_100402596 Ga0070679_1004025963 144
147 3300005564 Ga0070664_100836030 Ga0070664_1008360302 144
148 3300005718 Ga0068866_10343026 Ga0068866_103430262 144
149 3300005841 Ga0068863_100313532 Ga0068863_1003135321 144
150 3300005842 Ga0068858_101261901 Ga0068858_1012619011 144
151 3300006028 Ga0070717_10439027 Ga0070717_104390272 144
152 3300006028 Ga0070717_10618857 Ga0070717_106188572 144
153 3300006028 Ga0070717_10748440 Ga0070717_107484401 144
154 3300006048 Ga0075363_100470497 Ga0075363_1004704972 144
155 3300006163 Ga0070715_10105199 Ga0070715_101051991 144
156 3300006173 Ga0070716_100111550 Ga0070716_1001115502 144
157 3300006237 Ga0097621_101035324 Ga0097621_1010353242 144
158 3300009101 Ga0105247_10133406 Ga0105247_101334061 144
159 3300009148 Ga0105243_10514389 Ga0105243_105143892 144
160 3300009174 Ga0105241_10262772 Ga0105241_102627721 144
161 3300009177 Ga0105248_10501820 Ga0105248_105018202 144
162 3300009545 Ga0105237_10006117 Ga0105237_100061178 144
163 3300010375 Ga0105239_10355614 Ga0105239_103556143 144
164 3300011119 Ga0105246_10801790 Ga0105246_108017901 144
165 3300013105 Ga0157369_10002584 Ga0157369_1000258416 144
166 3300013105 Ga0157369_10049026 Ga0157369_100490268 144
167 3300013308 Ga0157375_10390063 Ga0157375_103900632 144
168 3300014325 Ga0163163_11004731 Ga0163163_110047311 144
169 3300021388 Ga0213875_10000800 Ga0213875_100008001 144
170 3300025711 Ga0207696_1112231 Ga0207696_11122311 144
171 3300025899 Ga0207642_10370644 Ga0207642_103706441 144
172 3300025904 Ga0207647_10013682 Ga0207647_100136824 144
173 3300025905 Ga0207685_10080873 Ga0207685_100808731 144
174 3300025908 Ga0207643_10069453 Ga0207643_100694532 144
175 3300025912 Ga0207707_10312424 Ga0207707_103124243 144
176 3300025914 Ga0207671_10028034 Ga0207671_100280344 144
177 3300025915 Ga0207693_10010380 Ga0207693_100103804 144
178 3300025916 Ga0207663_11019444 Ga0207663_110194442 144
179 3300025917 Ga0207660_10316824 Ga0207660_103168243 144
180 3300025921 Ga0207652_10530545 Ga0207652_105305452 144
181 3300025928 Ga0207700_10177187 Ga0207700_101771871 144
182 3300025928 Ga0207700_10305786 Ga0207700_103057863 144
183 3300025928 Ga0207700_10352816 Ga0207700_103528163 144
184 3300025929 Ga0207664_10044893 Ga0207664_100448938 144
185 3300025929 Ga0207664_10878888 Ga0207664_108788881 144
186 3300025935 Ga0207709_10839032 Ga0207709_108390321 144
187 3300025937 Ga0207669_10088318 Ga0207669_100883181 144
188 3300025941 Ga0207711_10337072 Ga0207711_103370722 144
189 3300025944 Ga0207661_10226272 Ga0207661_102262723 144
190 3300025972 Ga0207668_11472250 Ga0207668_114722501 144
191 3300026035 Ga0207703_10966216 Ga0207703_109662161 144
192 3300026041 Ga0207639_10903573 Ga0207639_109035732 144
193 3300026078 Ga0207702_10764530 Ga0207702_107645301 144
194 3300026121 Ga0207683_10532177 Ga0207683_105321772 144
195 3300026142 Ga0207698_12031555 Ga0207698_120315551 144
196 3300030521 Ga0307511_10032519 Ga0307511_100325193 144
197 3300031730 Ga0307516_10393350 Ga0307516_103933501 144
198 3300031731 Ga0307405_10675100 Ga0307405_106751002 144
199 3300031731 Ga0307405_11036447 Ga0307405_110364471 144
200 3300031824 Ga0307413_10753038 Ga0307413_107530382 144
201 3300031838 Ga0307518_10117623 Ga0307518_101176231 144
202 3300031838 Ga0307518_10135672 Ga0307518_101356723 144
203 3300031838 Ga0307518_10347580 Ga0307518_103475801 144
204 3300031911 Ga0307412_10279646 Ga0307412_102796462 144
205 3300031995 Ga0307409_101602780 Ga0307409_1016027801 144
206 3300032002 Ga0307416_101902371 Ga0307416_1019023711 144
207 3300032126 Ga0307415_100826245 Ga0307415_1008262451 144
208 3300033180 Ga0307510_10017239 Ga0307510_100172395 144
209 3300035083 Ga0373926_0002307 Ga0373926_0002307_5184_5618 144
210 3300035086 Ga0373934_0035474 Ga0373934_0035474_301_735 144
211 3300035113 Ga0373936_0000602 Ga0373936_0000602_6524_6958 144
212 3300035116 Ga0373945_0000122 Ga0373945_0000122_3638_4072 144
213 3300035119 Ga0373956_0281502 Ga0373956_0281502_266_700 144
214 3300035170 Ga0373943_0000154 Ga0373943_0000154_5714_6148 144
215 3300035171 Ga0373946_0000320 Ga0373946_0000320_9658_10092 144
216 3300035172 Ga0373955_0698486 Ga0373955_0698486_123_557 144
217 3300035695 Ga0373927_0000295 Ga0373927_0000295_7780_8214 144
218 3300035724 Ga0373933_0038580 Ga0373933_0038580_1434_1868 144
219 3300035724 Ga0373933_0057154 Ga0373933_0057154_1786_2220 144
220 3300035725 Ga0373947_0000143 Ga0373947_0000143_19429_19863 144
221 3300036401 Ga0373937_0054456 Ga0373937_0054456_1672_2106 144
222 3300037068 Ga0373925_0001994 Ga0373925_0001994_5670_6104 144
223 3300037312 Ga0395899_0384744 Ga0395899_0384744_391_825 144
224 3300037418 Ga0395900_0843197 Ga0395900_0843197_112_546 144
225 3300037466 Ga0395898_0000804 Ga0395898_0000804_9471_9905 144
226 3300037466 Ga0395898_0167715 Ga0395898_0167715_1398_1832 144
227 3300037853 Ga0436364_1195389 Ga0436364_1195389_3292_3726 144
228 3300038443 Ga0395901_0175197 Ga0395901_0175197_1692_2126 144
229 3300038443 Ga0395901_0362659 Ga0395901_0362659_573_1007 144
230 3300042005 Ga0439448_0057399 Ga0439448_0057399_13_447 144
231 3300044684 Ga0466966_0014422 Ga0466966_0014422_4121_4555 144
232 3300044693 Ga0466961_0023856 Ga0466961_0023856_2469_2903 144
233 3300045976 Ga0466967_0008307 Ga0466967_0008307_5723_6157 144
234 3300045976 Ga0466967_0222070 Ga0466967_0222070_1206_1640 144
235 3300046454 Ga0495592_0335508 Ga0495592_0335508_446_880 144
236 3300046461 Ga0495641_0007538 Ga0495641_0007538_6245_6679 144
237 3300046462 Ga0495651_0079183 Ga0495651_0079183_1102_1536 144
238 3300046462 Ga0495651_0244385 Ga0495651_0244385_747_1181 144
239 3300046463 Ga0495653_0028837 Ga0495653_0028837_3348_3782 144
240 3300046473 Ga0495582_0032310 Ga0495582_0032310_49_483 144
241 3300046476 Ga0495662_0228095 Ga0495662_0228095_14_448 144
242 3300046477 Ga0495664_0003056 Ga0495664_0003056_5104_5538 144
243 3300046514 Ga0495618_0009275 Ga0495618_0009275_1723_2157 144
244 3300046516 Ga0495628_0057029 Ga0495628_0057029_1945_2379 144
245 3300046524 Ga0495648_0005460 Ga0495648_0005460_4324_4758 144
246 3300046529 Ga0495652_0037752 Ga0495652_0037752_470_904 144
247 3300046530 Ga0495654_0033666 Ga0495654_0033666_583_1017 144
248 3300046531 Ga0495665_0055853 Ga0495665_0055853_1493_1927 144
249 3300046533 Ga0495640_0171025 Ga0495640_0171025_746_1180 144
250 3300046535 Ga0495586_0737626 Ga0495586_0737626_51_485 144
251 3300046536 Ga0495587_0363712 Ga0495587_0363712_14_448 144
252 3300046536 Ga0495587_0389050 Ga0495587_0389050_40_474 144
253 3300046543 Ga0495645_0051163 Ga0495645_0051163_2330_2764 144
254 3300046543 Ga0495645_0059242 Ga0495645_0059242_2024_2458 144
255 3300046559 Ga0495667_0005468 Ga0495667_0005468_3967_4401 144
256 3300046642 Ga0495634_0014934 Ga0495634_0014934_1528_1962 144
257 3300046648 Ga0495611_0033918 Ga0495611_0033918_1394_1828 144
258 3300046660 Ga0495625_0536613 Ga0495625_0536613_145_579 144
259 3300046663 Ga0495635_0014284 Ga0495635_0014284_3515_3949 144
260 3300046675 Ga0495657_0020017 Ga0495657_0020017_3657_4091 144
261 3300046678 Ga0495599_0021108 Ga0495599_0021108_401_835 144
262 3300046681 Ga0495647_0206771 Ga0495647_0206771_412_846 144
263 3300046690 Ga0495624_0011510 Ga0495624_0011510_2049_2483 144
264 3300046809 Ga0495600_0008444 Ga0495600_0008444_467_901 144
265 3300047315 Ga0495581_0014168 Ga0495581_0014168_1316_1750 144
266 3300047317 Ga0495604_0087578 Ga0495604_0087578_543_977 144
267 3300047319 Ga0495674_0000541 Ga0495674_0000541_5198_5632 144
268 3300047320 Ga0495672_0001138 Ga0495672_0001138_20666_21100 144
269 3300047321 Ga0495676_0029110 Ga0495676_0029110_678_1112 144
270 3300047322 Ga0495680_0010708 Ga0495680_0010708_2687_3121 144
271 3300047469 Ga0495673_0000696 Ga0495673_0000696_30053_30487 144
272 3300047471 Ga0495684_0015990 Ga0495684_0015990_1608_2042 144
273 3300047673 Ga0495593_0116104 Ga0495593_0116104_504_938 144
274 3300048903 Ga0496100_0029492 Ga0496100_0029492_1198_1632 144
275 3300048904 Ga0496101_0076264 Ga0496101_0076264_1736_2170 144
276 3300048905 Ga0496102_0000006 Ga0496102_0000006_124820_125254 144
277 3300048906 Ga0496103_0000006 Ga0496103_0000006_124618_125052 144
278 3300048907 Ga0496104_0126037 Ga0496104_0126037_202_636 144
279 3300048908 Ga0496105_0035719 Ga0496105_0035719_3533_3967 144
280 3300048909 Ga0496106_0023994 Ga0496106_0023994_2967_3401 144
281 3300048910 Ga0496107_0028956 Ga0496107_0028956_1260_1694 144
282 3300048911 Ga0496108_0000280 Ga0496108_0000280_11615_12049 144
283 3300048912 Ga0496109_2002131 Ga0496109_2002131_32_466 144
284 3300048918 Ga0496115_0069927 Ga0496115_0069927_159_593 144
285 3300048919 Ga0496116_0000025 Ga0496116_0000025_345488_345922 144
286 3300048920 Ga0496117_0000006 Ga0496117_0000006_345488_345922 144
287 3300048921 Ga0496118_0000004 Ga0496118_0000004_345488_345922 144
288 3300048923 Ga0496120_0282916 Ga0496120_0282916_61_495 144
289 3300048924 Ga0496121_0119442 Ga0496121_0119442_144_578 144
290 3300048925 Ga0496122_0246060 Ga0496122_0246060_451_888 144
291 3300048929 Ga0496126_0000985 Ga0496126_0000985_40835_41269 144
292 3300048929 Ga0496126_0076888 Ga0496126_0076888_1914_2348 144
293 3300049569 Ga0501032_0023140 Ga0501032_0023140_813_1247 144
294 3300049570 Ga0501033_0228659 Ga0501033_0228659_60_494 144
295 3300049571 Ga0501034_0143868 Ga0501034_0143868_898_1335 144
296 3300049574 Ga0501038_0040039 Ga0501038_0040039_1811_2245 144
297 3300049575 Ga0501039_0093540 Ga0501039_0093540_1063_1497 144
298 3300049580 Ga0501046_0114651 Ga0501046_0114651_629_1063 144
299 3300049581 Ga0501047_0005935 Ga0501047_0005935_9200_9634 144
300 3300049582 Ga0501048_0002212 Ga0501048_0002212_14284_14718 144
301 3300049586 Ga0501070_0002178 Ga0501070_0002178_12169_12603 144
302 3300050490 nmdc:mga03n38_413965_c1 nmdc:mga03n38_413965_c1_163_597 144
303 3300050514 nmdc:mga08x19_996821_c1 nmdc:mga08x19_996821_c1_72_506 144
304 3300050516 nmdc:mga0sz30_120308_c1 nmdc:mga0sz30_120308_c1_534_968 144
305 3300053084 Ga0495595_0420430 Ga0495595_0420430_191_625 144
306 3300053160 Ga0500633_0340860 Ga0500633_0340860_89_523 144
307 3300061719 Ga0466962_0416398 Ga0466962_0416398_51_485 144

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18029

Glyoxalase_6

Glyoxalase-like domain

28

163

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fge-assembly2.cif.gz_B crystal structure of presequence protease prep from arabidopsis thaliana 0.7426 111 142
6tmf-assembly1.cif.gz_F structure of an archaeal abce1-bound ribosomal post-splitting complex 0.7356 117 142
7d4i-assembly1.cif.gz_RE cryo-em structure of 90s small ribosomal precursors complex with the deah-box rna helicase dhr1 (state f) 0.7313 98 143
6th6-assembly1.cif.gz_Af cryo-em structure of t. kodakarensis 70s ribosome 0.7302 117 142
7zai-assembly1.cif.gz_E cryo-em structure of a pyrococcus abyssi 30s bound to met-initiator trna, mrna and aif1a. 0.7241 117 142
ID Description Score Start End Superfamily
af_L7N686_1_158_3.30.460.40 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2; 0.7865 101 143 3.30.460.40
af_O06633_2_115_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.782 3 143 3.10.180.10
af_Q8VY06_87_348_3.30.830.10 Alpha Beta;2-Layer Sandwich;Cytochrome Bc1 Complex; Chain A, domain 1;Metalloenzyme, LuxS/M16 peptidase-like 0.7655 108 142 3.30.830.10
af_O06633_2_115_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.757 3 143 3.10.180.10
6fz6B02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7246 115 142 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A6A8RF46-F1-model_v4 deleted 0.9283 90 144
AF-A0A1S1K427-F1-model_v4 Glyoxalase-like domain-containing protein 0.926 22 135
AF-A0A4V2EXV8-F1-model_v4 Glyoxalase-like domain-containing protein 0.9125 1 144
AF-A0A2G7C126-F1-model_v4 deleted 0.9116 1 144
AF-A0A1C5EIB2-F1-model_v4 Glyoxalase-like domain-containing protein 0.9102 1 144

Feature Viewer

pLDDT pTM Quality
92.29 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map