F399125
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 307 | 224 | 288 | 143 |
Family's Representative Sequence
| Representative Sequence | 3300006028|Ga0070717_10618857|Ga0070717_106188572 |
| Length | 164 |
| Sequence | MSSRGRPSVAPGRTRLYGGPMTSVKQFQVAFDCAEPERVARFWCEVLGYVVPPPPEGFVTWDDYSRSLPPEDRDSWFACVDPSGVGPRLYFQRVPEGKAVKNRVHLDVRVGTGLVGAERLAVLEAECTRLVALGAVRVRLLTADEDNESCIVMQDIEGNEFDLD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 2 | 2643221613 | Oerskovia sp. Root22 | Isolate | Unclassified |
| 3 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 4 | 2643221721 | Oerskovia sp. Root918 | Isolate | Unclassified |
| 5 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 6 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 7 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 8 | 2839986021 | Cellulosimicrobium cellulans JZ5 | Isolate | Unclassified |
| 9 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 10 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 11 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 12 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 13 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 14 | 2919042368 | Curtobacterium sp. 320 | Isolate | Rhizosphere |
| 15 | 2932431166 | Cellulosimicrobium sp. 4261 | Isolate | Rhizosphere |
| 16 | 2935890801 | Oerskovia enterophila 3230 | Isolate | Rhizosphere |
| 17 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 18 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 33 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 34 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 35 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 36 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 38 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 41 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 43 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 54 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 79 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 80 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 81 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 82 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 83 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 84 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 85 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 86 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 87 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 88 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 89 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 90 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 91 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 92 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 93 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 94 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 95 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 96 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 97 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 98 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 99 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 100 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 101 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 102 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 103 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 104 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 105 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 106 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 107 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 108 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 109 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 110 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 111 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 112 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 113 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 114 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 115 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 116 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 117 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 118 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 119 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 120 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 121 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 122 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 123 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 124 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 125 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 126 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 127 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 128 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 129 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 130 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 131 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 132 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 133 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 134 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 181 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 182 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 183 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 184 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 185 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 186 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 187 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 188 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 189 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 190 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 191 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 192 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 193 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 194 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 195 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 196 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 197 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 198 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 205 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 211 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 212 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 213 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 214 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 215 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 218 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 219 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 220 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 221 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 222 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 223 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 224 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.81 |
| Metatranscriptomes | 0 |
| Isolates | 6.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.58 |
| Nodule | 0 |
| Rhizoplane | 3.91 |
| Rhizosphere | 80.46 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.05 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070683_100774130 | 3300005329 | Bacteria | 920 |
| 2 | Ga0070682_100374232 | 3300005337 | Bacteria | 1069 |
| 3 | Ga0070668_100938856 | 3300005347 | Bacteria | 775 |
| 4 | Ga0070659_100848843 | 3300005366 | Bacteria | 796 |
| 5 | Ga0070709_10055807 | 3300005434 | Bacteria | 2495 |
| 6 | Ga0070714_100062988 | 3300005435 | Bacteria | 3188 |
| 7 | Ga0070714_100104637 | 3300005435 | Bacteria | 2498 |
| 8 | Ga0070714_100253647 | 3300005435 | Bacteria | 1627 |
| 9 | Ga0070714_100348511 | 3300005435 | Bacteria | 1390 |
| 10 | Ga0070713_100070109 | 3300005436 | Bacteria | 2958 |
| 11 | Ga0070713_100106109 | 3300005436 | Bacteria | 2442 |
| 12 | Ga0070713_100569961 | 3300005436 | Bacteria | 1073 |
| 13 | Ga0070710_10085204 | 3300005437 | Bacteria | 1853 |
| 14 | Ga0070711_100660243 | 3300005439 | Bacteria | 877 |
| 15 | Ga0070694_100598718 | 3300005444 | Bacteria | 887 |
| 16 | Ga0070685_10082660 | 3300005466 | Bacteria | 1928 |
| 17 | Ga0070679_100402596 | 3300005530 | Bacteria | 1314 |
| 18 | Ga0070664_100836030 | 3300005564 | Bacteria | 862 |
| 19 | Ga0068866_10343026 | 3300005718 | Bacteria | 947 |
| 20 | Ga0068863_100313532 | 3300005841 | Bacteria | 1523 |
| 21 | Ga0068858_101261901 | 3300005842 | Bacteria | 727 |
| 22 | Ga0081455_10652653 | 3300005937 | Bacteria | 677 |
| 23 | Ga0070717_10439027 | 3300006028 | Bacteria | 1175 |
| 24 | Ga0070717_10618857 | 3300006028 | Bacteria | 982 |
| 25 | Ga0070717_10748440 | 3300006028 | Bacteria | 888 |
| 26 | Ga0070717_11920274 | 3300006028 | Bacteria | 534 |
| 27 | Ga0075363_100470497 | 3300006048 | Bacteria | 744 |
| 28 | Ga0070715_10105199 | 3300006163 | Bacteria | 1323 |
| 29 | Ga0070716_100111550 | 3300006173 | Bacteria | 1696 |
| 30 | Ga0075369_10140750 | 3300006186 | Bacteria | 1100 |
| 31 | Ga0097621_101035324 | 3300006237 | Bacteria | 769 |
| 32 | Ga0099794_10487591 | 3300007265 | Bacteria | 648 |
| 33 | Ga0105247_10133406 | 3300009101 | Bacteria | 1620 |
| 34 | Ga0105243_10514389 | 3300009148 | Bacteria | 1137 |
| 35 | Ga0105241_10262772 | 3300009174 | Bacteria | 1467 |
| 36 | Ga0105248_10501820 | 3300009177 | Bacteria | 1368 |
| 37 | Ga0105237_10006117 | 3300009545 | Bacteria | 13454 |
| 38 | Ga0105239_10355614 | 3300010375 | Bacteria | 1654 |
| 39 | Ga0105246_10801790 | 3300011119 | Bacteria | 836 |
| 40 | Ga0157369_10002584 | 3300013105 | Bacteria | 21674 |
| 41 | Ga0157369_10049026 | 3300013105 | Bacteria | 4580 |
| 42 | Ga0157375_10390063 | 3300013308 | Bacteria | 1559 |
| 43 | Ga0163163_11004731 | 3300014325 | Bacteria | 897 |
| 44 | Ga0213875_10000800 | 3300021388 | Bacteria | 23523 |
| 45 | Ga0213875_10136263 | 3300021388 | Bacteria | 1148 |
| 46 | Ga0207696_1112231 | 3300025711 | Bacteria | 738 |
| 47 | Ga0207642_10370644 | 3300025899 | Bacteria | 850 |
| 48 | Ga0207647_10013682 | 3300025904 | Bacteria | 5619 |
| 49 | Ga0207685_10080873 | 3300025905 | Bacteria | 1344 |
| 50 | Ga0207643_10069453 | 3300025908 | Bacteria | 2025 |
| 51 | Ga0207707_10312424 | 3300025912 | Bacteria | 1358 |
| 52 | Ga0207671_10028034 | 3300025914 | Bacteria | 4209 |
| 53 | Ga0207693_10010380 | 3300025915 | Bacteria | 7561 |
| 54 | Ga0207663_11019444 | 3300025916 | Bacteria | 664 |
| 55 | Ga0207660_10316824 | 3300025917 | Bacteria | 1245 |
| 56 | Ga0207652_10530545 | 3300025921 | Bacteria | 1059 |
| 57 | Ga0207700_10177187 | 3300025928 | Bacteria | 1782 |
| 58 | Ga0207700_10305786 | 3300025928 | Bacteria | 1374 |
| 59 | Ga0207700_10352816 | 3300025928 | Bacteria | 1281 |
| 60 | Ga0207664_10044893 | 3300025929 | Bacteria | 3463 |
| 61 | Ga0207664_10878888 | 3300025929 | Bacteria | 805 |
| 62 | Ga0207644_10821114 | 3300025931 | Bacteria | 778 |
| 63 | Ga0207709_10839032 | 3300025935 | Bacteria | 744 |
| 64 | Ga0207669_10088318 | 3300025937 | Bacteria | 2010 |
| 65 | Ga0207711_10337072 | 3300025941 | Bacteria | 1395 |
| 66 | Ga0207661_10226272 | 3300025944 | Bacteria | 1655 |
| 67 | Ga0207668_11472250 | 3300025972 | Bacteria | 614 |
| 68 | Ga0207703_10966216 | 3300026035 | Bacteria | 817 |
| 69 | Ga0207639_10903573 | 3300026041 | Bacteria | 825 |
| 70 | Ga0207702_10764530 | 3300026078 | Bacteria | 954 |
| 71 | Ga0207683_10532177 | 3300026121 | Bacteria | 1086 |
| 72 | Ga0207698_12031555 | 3300026142 | Bacteria | 589 |
| 73 | Ga0307517_10235627 | 3300028786 | Bacteria | 1092 |
| 74 | Ga0265338_10000772 | 3300028800 | Bacteria | 54559 |
| 75 | Ga0307511_10032519 | 3300030521 | Bacteria | 4632 |
| 76 | Ga0307512_10020724 | 3300030522 | Bacteria | 5941 |
| 77 | Ga0307513_10028172 | 3300031456 | Bacteria | 6427 |
| 78 | Ga0307516_10393350 | 3300031730 | Bacteria | 1046 |
| 79 | Ga0307405_10675100 | 3300031731 | Bacteria | 853 |
| 80 | Ga0307405_11036447 | 3300031731 | Bacteria | 702 |
| 81 | Ga0307413_10753038 | 3300031824 | Bacteria | 814 |
| 82 | Ga0307518_10117623 | 3300031838 | Bacteria | 1886 |
| 83 | Ga0307518_10135672 | 3300031838 | Bacteria | 1723 |
| 84 | Ga0307518_10347580 | 3300031838 | Bacteria | 866 |
| 85 | Ga0307412_10279646 | 3300031911 | Bacteria | 1310 |
| 86 | Ga0307409_101602780 | 3300031995 | Bacteria | 679 |
| 87 | Ga0307416_101902371 | 3300032002 | Bacteria | 698 |
| 88 | Ga0307415_100826245 | 3300032126 | Bacteria | 848 |
| 89 | Ga0307507_10072548 | 3300033179 | Bacteria | 3102 |
| 90 | Ga0307510_10017239 | 3300033180 | Bacteria | 8523 |
| 91 | Ga0307510_10419173 | 3300033180 | Bacteria | 781 |
| 92 | Ga0373926_0002307 | 3300035083 | Bacteria | 6029 |
| 93 | Ga0373934_0035474 | 3300035086 | Bacteria | 1962 |
| 94 | Ga0373934_0119396 | 3300035086 | Bacteria | 1072 |
| 95 | Ga0373936_0000602 | 3300035113 | Bacteria | 12454 |
| 96 | Ga0373936_0088284 | 3300035113 | Bacteria | 1297 |
| 97 | Ga0373945_0000122 | 3300035116 | Bacteria | 19157 |
| 98 | Ga0373953_0122705 | 3300035117 | Bacteria | 1104 |
| 99 | Ga0373956_0281502 | 3300035119 | Bacteria | 791 |
| 100 | Ga0373957_0020778 | 3300035120 | Bacteria | 2324 |
| 101 | Ga0373943_0000154 | 3300035170 | Bacteria | 26850 |
| 102 | Ga0373946_0000320 | 3300035171 | Bacteria | 15539 |
| 103 | Ga0373955_0168010 | 3300035172 | Bacteria | 1297 |
| 104 | Ga0373955_0698486 | 3300035172 | Bacteria | 623 |
| 105 | Ga0373924_0452806 | 3300035410 | Bacteria | 575 |
| 106 | Ga0373935_0916695 | 3300035692 | Bacteria | 649 |
| 107 | Ga0373927_0000295 | 3300035695 | Bacteria | 39423 |
| 108 | Ga0373933_0035217 | 3300035724 | Bacteria | 2922 |
| 109 | Ga0373933_0038580 | 3300035724 | Bacteria | 2807 |
| 110 | Ga0373933_0057154 | 3300035724 | Bacteria | 2344 |
| 111 | Ga0373947_0000143 | 3300035725 | Bacteria | 37108 |
| 112 | Ga0373937_0029864 | 3300036401 | Bacteria | 4937 |
| 113 | Ga0373937_0054456 | 3300036401 | Bacteria | 3671 |
| 114 | Ga0373925_0001994 | 3300037068 | Bacteria | 16911 |
| 115 | Ga0373925_0475952 | 3300037068 | Bacteria | 1024 |
| 116 | Ga0395899_0384744 | 3300037312 | Bacteria | 932 |
| 117 | Ga0395900_0843197 | 3300037418 | Bacteria | 842 |
| 118 | Ga0395898_0000804 | 3300037466 | Bacteria | 52956 |
| 119 | Ga0395898_0167715 | 3300037466 | Bacteria | 2099 |
| 120 | Ga0436364_0761177 | 3300037853 | Bacteria | 2227 |
| 121 | Ga0436364_1195389 | 3300037853 | Bacteria | 9815 |
| 122 | Ga0395901_0175197 | 3300038443 | Bacteria | 2250 |
| 123 | Ga0395901_0362659 | 3300038443 | Bacteria | 1494 |
| 124 | Ga0439461_0000964 | 3300041410 | Bacteria | 4315 |
| 125 | Ga0439466_0003556 | 3300041411 | Bacteria | 6021 |
| 126 | Ga0439466_0046343 | 3300041411 | Bacteria | 1436 |
| 127 | Ga0439465_0001193 | 3300041413 | Bacteria | 8357 |
| 128 | Ga0451853_0162272 | 3300041512 | Bacteria | 3383 |
| 129 | Ga0439431_0000660 | 3300041997 | Bacteria | 7338 |
| 130 | Ga0439445_0005627 | 3300042004 | Bacteria | 2861 |
| 131 | Ga0439448_0057399 | 3300042005 | Bacteria | 1283 |
| 132 | Ga0439434_0045813 | 3300042435 | Bacteria | 1349 |
| 133 | Ga0466969_0153470 | 3300044656 | Bacteria | 1060 |
| 134 | Ga0466965_0038748 | 3300044683 | Bacteria | 2342 |
| 135 | Ga0466965_0169585 | 3300044683 | Bacteria | 1148 |
| 136 | Ga0466965_0641806 | 3300044683 | Bacteria | 606 |
| 137 | Ga0466966_0014422 | 3300044684 | Bacteria | 5233 |
| 138 | Ga0466961_0023856 | 3300044693 | Bacteria | 3936 |
| 139 | Ga0466961_0107037 | 3300044693 | Bacteria | 1760 |
| 140 | Ga0466963_0329095 | 3300044694 | Bacteria | 1075 |
| 141 | Ga0466971_0212756 | 3300044719 | Bacteria | 914 |
| 142 | Ga0466970_0256662 | 3300044765 | Bacteria | 980 |
| 143 | Ga0466957_0768961 | 3300044842 | Bacteria | 683 |
| 144 | Ga0466960_0008740 | 3300044901 | Bacteria | 4157 |
| 145 | Ga0466958_0167113 | 3300045836 | Bacteria | 1392 |
| 146 | Ga0466967_0008307 | 3300045976 | Bacteria | 7591 |
| 147 | Ga0466967_0021641 | 3300045976 | Bacteria | 5229 |
| 148 | Ga0466967_0222070 | 3300045976 | Bacteria | 1796 |
| 149 | Ga0495592_0059020 | 3300046454 | Bacteria | 2827 |
| 150 | Ga0495592_0138568 | 3300046454 | Bacteria | 1695 |
| 151 | Ga0495592_0335508 | 3300046454 | Bacteria | 973 |
| 152 | Ga0495629_0027664 | 3300046459 | Bacteria | 4025 |
| 153 | Ga0495629_0293983 | 3300046459 | Bacteria | 1113 |
| 154 | Ga0495629_0457844 | 3300046459 | Bacteria | 863 |
| 155 | Ga0495641_0007538 | 3300046461 | Bacteria | 6777 |
| 156 | Ga0495651_0003137 | 3300046462 | Bacteria | 12748 |
| 157 | Ga0495651_0079183 | 3300046462 | Bacteria | 2484 |
| 158 | Ga0495651_0244385 | 3300046462 | Bacteria | 1229 |
| 159 | Ga0495653_0028837 | 3300046463 | Bacteria | 4437 |
| 160 | Ga0495653_0047695 | 3300046463 | Bacteria | 3312 |
| 161 | Ga0495582_0032310 | 3300046473 | Bacteria | 2879 |
| 162 | Ga0495639_0303411 | 3300046475 | Bacteria | 796 |
| 163 | Ga0495662_0004776 | 3300046476 | Bacteria | 6792 |
| 164 | Ga0495662_0228095 | 3300046476 | Bacteria | 918 |
| 165 | Ga0495664_0003056 | 3300046477 | Bacteria | 9066 |
| 166 | Ga0495664_0005174 | 3300046477 | Bacteria | 7157 |
| 167 | Ga0495608_0039443 | 3300046511 | Bacteria | 3165 |
| 168 | Ga0495618_0009275 | 3300046514 | Bacteria | 5938 |
| 169 | Ga0495618_0208563 | 3300046514 | Bacteria | 1235 |
| 170 | Ga0495618_0263465 | 3300046514 | Bacteria | 1079 |
| 171 | Ga0495628_0057029 | 3300046516 | Bacteria | 3073 |
| 172 | Ga0495628_0083498 | 3300046516 | Bacteria | 2480 |
| 173 | Ga0495630_0238869 | 3300046517 | Bacteria | 1388 |
| 174 | Ga0495630_0259888 | 3300046517 | Bacteria | 1326 |
| 175 | Ga0495648_0005460 | 3300046524 | Bacteria | 10553 |
| 176 | Ga0495652_0037752 | 3300046529 | Bacteria | 4188 |
| 177 | Ga0495652_0086406 | 3300046529 | Bacteria | 2575 |
| 178 | Ga0495652_0514294 | 3300046529 | Bacteria | 828 |
| 179 | Ga0495654_0033666 | 3300046530 | Bacteria | 2592 |
| 180 | Ga0495665_0055853 | 3300046531 | Bacteria | 2085 |
| 181 | Ga0495640_0171025 | 3300046533 | Bacteria | 1388 |
| 182 | Ga0495640_0201491 | 3300046533 | Bacteria | 1261 |
| 183 | Ga0495586_0111071 | 3300046535 | Bacteria | 1526 |
| 184 | Ga0495586_0737626 | 3300046535 | Bacteria | 568 |
| 185 | Ga0495587_0001841 | 3300046536 | Bacteria | 14139 |
| 186 | Ga0495587_0363712 | 3300046536 | Bacteria | 805 |
| 187 | Ga0495587_0389050 | 3300046536 | Bacteria | 775 |
| 188 | Ga0495645_0009117 | 3300046543 | Bacteria | 6933 |
| 189 | Ga0495645_0051163 | 3300046543 | Bacteria | 3006 |
| 190 | Ga0495645_0059242 | 3300046543 | Bacteria | 2777 |
| 191 | Ga0495622_0137158 | 3300046557 | Bacteria | 1112 |
| 192 | Ga0495667_0005468 | 3300046559 | Bacteria | 8584 |
| 193 | Ga0495667_0007456 | 3300046559 | Bacteria | 7416 |
| 194 | Ga0495634_0014934 | 3300046642 | Bacteria | 5584 |
| 195 | Ga0495611_0033918 | 3300046648 | Bacteria | 2254 |
| 196 | Ga0495625_0536613 | 3300046660 | Bacteria | 710 |
| 197 | Ga0495635_0004287 | 3300046663 | Bacteria | 9874 |
| 198 | Ga0495635_0014284 | 3300046663 | Bacteria | 5556 |
| 199 | Ga0495635_0018192 | 3300046663 | Bacteria | 4905 |
| 200 | Ga0495588_0194789 | 3300046674 | Bacteria | 1070 |
| 201 | Ga0495657_0001614 | 3300046675 | Bacteria | 19370 |
| 202 | Ga0495657_0020017 | 3300046675 | Bacteria | 4818 |
| 203 | Ga0495657_0021598 | 3300046675 | Bacteria | 4618 |
| 204 | Ga0495599_0021108 | 3300046678 | Bacteria | 4061 |
| 205 | Ga0495599_0179671 | 3300046678 | Bacteria | 1305 |
| 206 | Ga0495646_0091202 | 3300046680 | Bacteria | 1759 |
| 207 | Ga0495647_0206771 | 3300046681 | Bacteria | 862 |
| 208 | Ga0495613_0097927 | 3300046689 | Bacteria | 2119 |
| 209 | Ga0495613_0458419 | 3300046689 | Bacteria | 863 |
| 210 | Ga0495624_0011510 | 3300046690 | Bacteria | 6081 |
| 211 | Ga0495624_0400617 | 3300046690 | Bacteria | 824 |
| 212 | Ga0495600_0008444 | 3300046809 | Bacteria | 6327 |
| 213 | Ga0495600_0025229 | 3300046809 | Bacteria | 3830 |
| 214 | Ga0495600_0248092 | 3300046809 | Bacteria | 1133 |
| 215 | Ga0495581_0004708 | 3300047315 | Bacteria | 7878 |
| 216 | Ga0495581_0014168 | 3300047315 | Bacteria | 4621 |
| 217 | Ga0495581_0565578 | 3300047315 | Bacteria | 659 |
| 218 | Ga0495604_0027003 | 3300047317 | Bacteria | 4568 |
| 219 | Ga0495604_0087578 | 3300047317 | Bacteria | 2319 |
| 220 | Ga0495674_0000541 | 3300047319 | Bacteria | 34957 |
| 221 | Ga0495674_0265879 | 3300047319 | Bacteria | 1408 |
| 222 | Ga0495674_0297390 | 3300047319 | Bacteria | 1319 |
| 223 | Ga0495672_0001138 | 3300047320 | Bacteria | 26870 |
| 224 | Ga0495676_0028621 | 3300047321 | Bacteria | 4754 |
| 225 | Ga0495676_0029110 | 3300047321 | Bacteria | 4705 |
| 226 | Ga0495680_0010708 | 3300047322 | Bacteria | 8178 |
| 227 | Ga0495680_0031405 | 3300047322 | Bacteria | 4324 |
| 228 | Ga0495675_0113135 | 3300047444 | Bacteria | 1693 |
| 229 | Ga0495673_0000696 | 3300047469 | Bacteria | 32803 |
| 230 | Ga0495684_0015990 | 3300047471 | Bacteria | 5778 |
| 231 | Ga0495684_0065676 | 3300047471 | Bacteria | 2758 |
| 232 | Ga0495593_0000736 | 3300047673 | Bacteria | 18999 |
| 233 | Ga0495593_0116104 | 3300047673 | Bacteria | 1364 |
| 234 | Ga0495593_0124753 | 3300047673 | Bacteria | 1309 |
| 235 | Ga0495614_0007337 | 3300048089 | Bacteria | 4909 |
| 236 | Ga0496100_0029492 | 3300048903 | Bacteria | 3394 |
| 237 | Ga0496101_0076264 | 3300048904 | Bacteria | 2469 |
| 238 | Ga0496102_0000006 | 3300048905 | Bacteria | 471494 |
| 239 | Ga0496103_0000006 | 3300048906 | Bacteria | 470539 |
| 240 | Ga0496104_0126037 | 3300048907 | Bacteria | 2459 |
| 241 | Ga0496105_0035719 | 3300048908 | Bacteria | 4092 |
| 242 | Ga0496106_0023994 | 3300048909 | Bacteria | 4532 |
| 243 | Ga0496107_0028956 | 3300048910 | Bacteria | 3938 |
| 244 | Ga0496108_0000280 | 3300048911 | Bacteria | 43780 |
| 245 | Ga0496109_2002131 | 3300048912 | Bacteria | 511 |
| 246 | Ga0496115_0069927 | 3300048918 | Bacteria | 2844 |
| 247 | Ga0496115_0280574 | 3300048918 | Bacteria | 1368 |
| 248 | Ga0496116_0000025 | 3300048919 | Bacteria | 470539 |
| 249 | Ga0496117_0000006 | 3300048920 | Bacteria | 758420 |
| 250 | Ga0496118_0000004 | 3300048921 | Bacteria | 758420 |
| 251 | Ga0496120_0282916 | 3300048923 | Bacteria | 766 |
| 252 | Ga0496121_0119442 | 3300048924 | Bacteria | 1993 |
| 253 | Ga0496122_0246060 | 3300048925 | Bacteria | 1004 |
| 254 | Ga0496126_0000985 | 3300048929 | Bacteria | 48830 |
| 255 | Ga0496126_0076888 | 3300048929 | Bacteria | 2960 |
| 256 | Ga0496126_0168403 | 3300048929 | Bacteria | 1868 |
| 257 | Ga0501032_0023140 | 3300049569 | Bacteria | 4301 |
| 258 | Ga0501032_0250842 | 3300049569 | Bacteria | 1149 |
| 259 | Ga0501033_0001558 | 3300049570 | Bacteria | 20229 |
| 260 | Ga0501033_0228659 | 3300049570 | Bacteria | 1322 |
| 261 | Ga0501034_0143868 | 3300049571 | Bacteria | 2363 |
| 262 | Ga0501034_0658121 | 3300049571 | Bacteria | 949 |
| 263 | Ga0501037_0856548 | 3300049573 | Bacteria | 598 |
| 264 | Ga0501038_0040039 | 3300049574 | Bacteria | 4096 |
| 265 | Ga0501039_0093540 | 3300049575 | Bacteria | 2343 |
| 266 | Ga0501042_0619380 | 3300049578 | Bacteria | 787 |
| 267 | Ga0501046_0114651 | 3300049580 | Bacteria | 2055 |
| 268 | Ga0501047_0005935 | 3300049581 | Bacteria | 11486 |
| 269 | Ga0501047_0098988 | 3300049581 | Bacteria | 2795 |
| 270 | Ga0501048_0002212 | 3300049582 | Bacteria | 14809 |
| 271 | Ga0501070_0002178 | 3300049586 | Bacteria | 17230 |
| 272 | Ga0501035_0643227 | 3300049822 | Bacteria | 860 |
| 273 | nmdc:mga03n38_413965_c1 | 3300050490 | Bacteria | 744 |
| 274 | nmdc:mga09592_98710_c1 | 3300050508 | Bacteria | 2500 |
| 275 | nmdc:mga0n895_1758350_c1 | 3300050512 | Bacteria | 581 |
| 276 | nmdc:mga08x19_996821_c1 | 3300050514 | Bacteria | 595 |
| 277 | nmdc:mga0sz30_120308_c1 | 3300050516 | Bacteria | 1153 |
| 278 | nmdc:mga0sz30_22854_c1 | 3300050516 | Bacteria | 2540 |
| 279 | Ga0495595_0420430 | 3300053084 | Bacteria | 678 |
| 280 | Ga0495619_0126103 | 3300053085 | Bacteria | 1757 |
| 281 | Ga0500578_0443872 | 3300053086 | Bacteria | 740 |
| 282 | Ga0500640_043845 | 3300053095 | Bacteria | 1963 |
| 283 | Ga0500553_073946 | 3300053101 | Bacteria | 1557 |
| 284 | Ga0500559_0392831 | 3300053136 | Bacteria | 646 |
| 285 | Ga0500586_213913 | 3300053145 | Bacteria | 625 |
| 286 | Ga0500633_0340860 | 3300053160 | Bacteria | 547 |
| 287 | Ga0466962_0040675 | 3300061719 | Bacteria | 2224 |
| 288 | Ga0466962_0416398 | 3300061719 | Bacteria | 674 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005366 | Ga0070659_100848843 | Ga0070659_1008488431 | 133 |
| 2 | 3300050508 | nmdc:mga09592_98710_c1 | nmdc:mga09592_98710_c1_138_560 | 135 |
| 3 | 3300044683 | Ga0466965_0169585 | Ga0466965_0169585_369_791 | 137 |
| 4 | 3300044694 | Ga0466963_0329095 | Ga0466963_0329095_590_1012 | 137 |
| 5 | 3300044842 | Ga0466957_0768961 | Ga0466957_0768961_60_482 | 137 |
| 6 | 3300045976 | Ga0466967_0021641 | Ga0466967_0021641_1281_1703 | 137 |
| 7 | 3300041410 | Ga0439461_0000964 | Ga0439461_0000964_3334_3768 | 138 |
| 8 | 3300041411 | Ga0439466_0003556 | Ga0439466_0003556_2932_3366 | 138 |
| 9 | 3300041997 | Ga0439431_0000660 | Ga0439431_0000660_2441_2875 | 138 |
| 10 | 3300042004 | Ga0439445_0005627 | Ga0439445_0005627_1700_2134 | 138 |
| 11 | 3300042435 | Ga0439434_0045813 | Ga0439434_0045813_525_959 | 138 |
| 12 | iso_pu_bacteria | 2643221647 | 2644267526 | 138 |
| 13 | iso_pu_bacteria | 2862507626 | 2862515061 | 138 |
| 14 | iso_pu_bacteria | 3006486233 | 3006487156 | 138 |
| 15 | iso_pu_bacteria | 8023623736 | 8023629326 | 138 |
| 16 | 3300006028 | Ga0070717_11920274 | Ga0070717_119202741 | 140 |
| 17 | 3300007265 | Ga0099794_10487591 | Ga0099794_104875911 | 140 |
| 18 | 3300021388 | Ga0213875_10136263 | Ga0213875_101362631 | 140 |
| 19 | 3300035086 | Ga0373934_0119396 | Ga0373934_0119396_182_613 | 140 |
| 20 | 3300035113 | Ga0373936_0088284 | Ga0373936_0088284_337_768 | 140 |
| 21 | 3300035117 | Ga0373953_0122705 | Ga0373953_0122705_377_808 | 140 |
| 22 | 3300035120 | Ga0373957_0020778 | Ga0373957_0020778_1703_2134 | 140 |
| 23 | 3300035172 | Ga0373955_0168010 | Ga0373955_0168010_344_775 | 140 |
| 24 | 3300035410 | Ga0373924_0452806 | Ga0373924_0452806_32_463 | 140 |
| 25 | 3300035692 | Ga0373935_0916695 | Ga0373935_0916695_48_479 | 140 |
| 26 | 3300035724 | Ga0373933_0035217 | Ga0373933_0035217_2304_2735 | 140 |
| 27 | 3300036401 | Ga0373937_0029864 | Ga0373937_0029864_830_1261 | 140 |
| 28 | 3300037068 | Ga0373925_0475952 | Ga0373925_0475952_322_753 | 140 |
| 29 | 3300037853 | Ga0436364_0761177 | Ga0436364_0761177_745_1176 | 140 |
| 30 | 3300046454 | Ga0495592_0138568 | Ga0495592_0138568_1026_1457 | 140 |
| 31 | 3300046463 | Ga0495653_0047695 | Ga0495653_0047695_2512_2943 | 140 |
| 32 | 3300046511 | Ga0495608_0039443 | Ga0495608_0039443_656_1087 | 140 |
| 33 | 3300046514 | Ga0495618_0263465 | Ga0495618_0263465_192_623 | 140 |
| 34 | 3300046517 | Ga0495630_0259888 | Ga0495630_0259888_841_1272 | 140 |
| 35 | 3300046529 | Ga0495652_0514294 | Ga0495652_0514294_198_629 | 140 |
| 36 | 3300046533 | Ga0495640_0201491 | Ga0495640_0201491_390_821 | 140 |
| 37 | 3300046559 | Ga0495667_0007456 | Ga0495667_0007456_3990_4421 | 140 |
| 38 | 3300046663 | Ga0495635_0018192 | Ga0495635_0018192_1759_2190 | 140 |
| 39 | 3300046675 | Ga0495657_0021598 | Ga0495657_0021598_1042_1473 | 140 |
| 40 | 3300046678 | Ga0495599_0179671 | Ga0495599_0179671_201_632 | 140 |
| 41 | 3300046680 | Ga0495646_0091202 | Ga0495646_0091202_427_858 | 140 |
| 42 | 3300046809 | Ga0495600_0248092 | Ga0495600_0248092_189_620 | 140 |
| 43 | 3300047315 | Ga0495581_0565578 | Ga0495581_0565578_217_648 | 140 |
| 44 | 3300047319 | Ga0495674_0265879 | Ga0495674_0265879_279_710 | 140 |
| 45 | 3300047322 | Ga0495680_0031405 | Ga0495680_0031405_3695_4126 | 140 |
| 46 | 3300047471 | Ga0495684_0065676 | Ga0495684_0065676_1909_2340 | 140 |
| 47 | 3300047673 | Ga0495593_0124753 | Ga0495593_0124753_701_1132 | 140 |
| 48 | 3300049578 | Ga0501042_0619380 | Ga0501042_0619380_235_669 | 140 |
| 49 | iso_pu_bacteria | 2616644941 | 2616904088 | 140 |
| 50 | iso_pu_bacteria | 2643221613 | 2644084352 | 140 |
| 51 | iso_pu_bacteria | 2643221721 | 2644664400 | 140 |
| 52 | iso_pu_bacteria | 2808606359 | 2808848880 | 140 |
| 53 | iso_pu_bacteria | 2808606522 | 2809592872 | 140 |
| 54 | iso_pu_bacteria | 2811994879 | 2812353591 | 140 |
| 55 | iso_pu_bacteria | 2839986021 | 2839986278 | 140 |
| 56 | iso_pu_bacteria | 2852635781 | 2852638876 | 140 |
| 57 | iso_pu_bacteria | 2884693830 | 2884698757 | 140 |
| 58 | iso_pu_bacteria | 2895442618 | 2895450126 | 140 |
| 59 | iso_pu_bacteria | 2902792274 | 2902798899 | 140 |
| 60 | iso_pu_bacteria | 2932431166 | 2932431312 | 140 |
| 61 | iso_pu_bacteria | 2935890801 | 2935891871 | 140 |
| 62 | iso_pu_bacteria | 2946064051 | 2946072113 | 140 |
| 63 | 3300044656 | Ga0466969_0153470 | Ga0466969_0153470_64_489 | 141 |
| 64 | 3300044719 | Ga0466971_0212756 | Ga0466971_0212756_284_709 | 141 |
| 65 | 3300044765 | Ga0466970_0256662 | Ga0466970_0256662_286_711 | 141 |
| 66 | 3300045836 | Ga0466958_0167113 | Ga0466958_0167113_218_643 | 141 |
| 67 | 3300049570 | Ga0501033_0001558 | Ga0501033_0001558_10206_10631 | 141 |
| 68 | 3300061719 | Ga0466962_0040675 | Ga0466962_0040675_895_1320 | 141 |
| 69 | iso_pu_bacteria | 2919042368 | 2919044757 | 141 |
| 70 | 3300005937 | Ga0081455_10652653 | Ga0081455_106526531 | 142 |
| 71 | 3300025931 | Ga0207644_10821114 | Ga0207644_108211141 | 142 |
| 72 | 3300028786 | Ga0307517_10235627 | Ga0307517_102356272 | 142 |
| 73 | 3300030522 | Ga0307512_10020724 | Ga0307512_100207246 | 142 |
| 74 | 3300031456 | Ga0307513_10028172 | Ga0307513_100281726 | 142 |
| 75 | 3300033179 | Ga0307507_10072548 | Ga0307507_100725483 | 142 |
| 76 | 3300033180 | Ga0307510_10419173 | Ga0307510_104191732 | 142 |
| 77 | 3300041512 | Ga0451853_0162272 | Ga0451853_0162272_1763_2191 | 142 |
| 78 | 3300044683 | Ga0466965_0038748 | Ga0466965_0038748_749_1195 | 142 |
| 79 | 3300044683 | Ga0466965_0641806 | Ga0466965_0641806_157_585 | 142 |
| 80 | 3300044693 | Ga0466961_0107037 | Ga0466961_0107037_1274_1720 | 142 |
| 81 | 3300044901 | Ga0466960_0008740 | Ga0466960_0008740_3559_4005 | 142 |
| 82 | 3300046454 | Ga0495592_0059020 | Ga0495592_0059020_2194_2622 | 142 |
| 83 | 3300046459 | Ga0495629_0027664 | Ga0495629_0027664_3176_3604 | 142 |
| 84 | 3300046459 | Ga0495629_0293983 | Ga0495629_0293983_245_673 | 142 |
| 85 | 3300046459 | Ga0495629_0457844 | Ga0495629_0457844_113_541 | 142 |
| 86 | 3300046462 | Ga0495651_0003137 | Ga0495651_0003137_10771_11199 | 142 |
| 87 | 3300046475 | Ga0495639_0303411 | Ga0495639_0303411_286_714 | 142 |
| 88 | 3300046476 | Ga0495662_0004776 | Ga0495662_0004776_5358_5786 | 142 |
| 89 | 3300046477 | Ga0495664_0005174 | Ga0495664_0005174_4465_4893 | 142 |
| 90 | 3300046514 | Ga0495618_0208563 | Ga0495618_0208563_121_549 | 142 |
| 91 | 3300046516 | Ga0495628_0083498 | Ga0495628_0083498_1878_2306 | 142 |
| 92 | 3300046517 | Ga0495630_0238869 | Ga0495630_0238869_538_966 | 142 |
| 93 | 3300046529 | Ga0495652_0086406 | Ga0495652_0086406_1983_2411 | 142 |
| 94 | 3300046535 | Ga0495586_0111071 | Ga0495586_0111071_73_501 | 142 |
| 95 | 3300046536 | Ga0495587_0001841 | Ga0495587_0001841_2239_2667 | 142 |
| 96 | 3300046543 | Ga0495645_0009117 | Ga0495645_0009117_265_693 | 142 |
| 97 | 3300046557 | Ga0495622_0137158 | Ga0495622_0137158_302_730 | 142 |
| 98 | 3300046663 | Ga0495635_0004287 | Ga0495635_0004287_1206_1634 | 142 |
| 99 | 3300046674 | Ga0495588_0194789 | Ga0495588_0194789_111_539 | 142 |
| 100 | 3300046675 | Ga0495657_0001614 | Ga0495657_0001614_17502_17930 | 142 |
| 101 | 3300046689 | Ga0495613_0097927 | Ga0495613_0097927_379_807 | 142 |
| 102 | 3300046689 | Ga0495613_0458419 | Ga0495613_0458419_148_576 | 142 |
| 103 | 3300046690 | Ga0495624_0400617 | Ga0495624_0400617_239_667 | 142 |
| 104 | 3300046809 | Ga0495600_0025229 | Ga0495600_0025229_1206_1634 | 142 |
| 105 | 3300047315 | Ga0495581_0004708 | Ga0495581_0004708_3424_3852 | 142 |
| 106 | 3300047317 | Ga0495604_0027003 | Ga0495604_0027003_3617_4045 | 142 |
| 107 | 3300047319 | Ga0495674_0297390 | Ga0495674_0297390_772_1200 | 142 |
| 108 | 3300047321 | Ga0495676_0028621 | Ga0495676_0028621_2339_2767 | 142 |
| 109 | 3300047444 | Ga0495675_0113135 | Ga0495675_0113135_817_1245 | 142 |
| 110 | 3300047673 | Ga0495593_0000736 | Ga0495593_0000736_9034_9462 | 142 |
| 111 | 3300048089 | Ga0495614_0007337 | Ga0495614_0007337_374_802 | 142 |
| 112 | 3300049569 | Ga0501032_0250842 | Ga0501032_0250842_561_989 | 142 |
| 113 | 3300049571 | Ga0501034_0658121 | Ga0501034_0658121_452_880 | 142 |
| 114 | 3300049573 | Ga0501037_0856548 | Ga0501037_0856548_137_565 | 142 |
| 115 | 3300049581 | Ga0501047_0098988 | Ga0501047_0098988_1475_1903 | 142 |
| 116 | 3300049822 | Ga0501035_0643227 | Ga0501035_0643227_247_675 | 142 |
| 117 | 3300050512 | nmdc:mga0n895_1758350_c1 | nmdc:mga0n895_1758350_c1_88_522 | 142 |
| 118 | 3300053085 | Ga0495619_0126103 | Ga0495619_0126103_1174_1602 | 142 |
| 119 | 3300053086 | Ga0500578_0443872 | Ga0500578_0443872_231_659 | 142 |
| 120 | 3300053095 | Ga0500640_043845 | Ga0500640_043845_316_744 | 142 |
| 121 | 3300053101 | Ga0500553_073946 | Ga0500553_073946_198_626 | 142 |
| 122 | 3300053136 | Ga0500559_0392831 | Ga0500559_0392831_21_449 | 142 |
| 123 | 3300053145 | Ga0500586_213913 | Ga0500586_213913_20_448 | 142 |
| 124 | 3300005435 | Ga0070714_100104637 | Ga0070714_1001046373 | 143 |
| 125 | 3300006186 | Ga0075369_10140750 | Ga0075369_101407503 | 143 |
| 126 | 3300028800 | Ga0265338_10000772 | Ga0265338_1000077229 | 143 |
| 127 | 3300041411 | Ga0439466_0046343 | Ga0439466_0046343_953_1384 | 143 |
| 128 | 3300041413 | Ga0439465_0001193 | Ga0439465_0001193_5318_5749 | 143 |
| 129 | 3300048918 | Ga0496115_0280574 | Ga0496115_0280574_265_696 | 143 |
| 130 | 3300048929 | Ga0496126_0168403 | Ga0496126_0168403_32_463 | 143 |
| 131 | 3300050516 | nmdc:mga0sz30_22854_c1 | nmdc:mga0sz30_22854_c1_648_1079 | 143 |
| 132 | 3300005329 | Ga0070683_100774130 | Ga0070683_1007741302 | 144 |
| 133 | 3300005337 | Ga0070682_100374232 | Ga0070682_1003742322 | 144 |
| 134 | 3300005347 | Ga0070668_100938856 | Ga0070668_1009388561 | 144 |
| 135 | 3300005434 | Ga0070709_10055807 | Ga0070709_100558073 | 144 |
| 136 | 3300005435 | Ga0070714_100062988 | Ga0070714_1000629882 | 144 |
| 137 | 3300005435 | Ga0070714_100253647 | Ga0070714_1002536472 | 144 |
| 138 | 3300005435 | Ga0070714_100348511 | Ga0070714_1003485112 | 144 |
| 139 | 3300005436 | Ga0070713_100070109 | Ga0070713_1000701095 | 144 |
| 140 | 3300005436 | Ga0070713_100106109 | Ga0070713_1001061093 | 144 |
| 141 | 3300005436 | Ga0070713_100569961 | Ga0070713_1005699612 | 144 |
| 142 | 3300005437 | Ga0070710_10085204 | Ga0070710_100852042 | 144 |
| 143 | 3300005439 | Ga0070711_100660243 | Ga0070711_1006602432 | 144 |
| 144 | 3300005444 | Ga0070694_100598718 | Ga0070694_1005987181 | 144 |
| 145 | 3300005466 | Ga0070685_10082660 | Ga0070685_100826603 | 144 |
| 146 | 3300005530 | Ga0070679_100402596 | Ga0070679_1004025963 | 144 |
| 147 | 3300005564 | Ga0070664_100836030 | Ga0070664_1008360302 | 144 |
| 148 | 3300005718 | Ga0068866_10343026 | Ga0068866_103430262 | 144 |
| 149 | 3300005841 | Ga0068863_100313532 | Ga0068863_1003135321 | 144 |
| 150 | 3300005842 | Ga0068858_101261901 | Ga0068858_1012619011 | 144 |
| 151 | 3300006028 | Ga0070717_10439027 | Ga0070717_104390272 | 144 |
| 152 | 3300006028 | Ga0070717_10618857 | Ga0070717_106188572 | 144 |
| 153 | 3300006028 | Ga0070717_10748440 | Ga0070717_107484401 | 144 |
| 154 | 3300006048 | Ga0075363_100470497 | Ga0075363_1004704972 | 144 |
| 155 | 3300006163 | Ga0070715_10105199 | Ga0070715_101051991 | 144 |
| 156 | 3300006173 | Ga0070716_100111550 | Ga0070716_1001115502 | 144 |
| 157 | 3300006237 | Ga0097621_101035324 | Ga0097621_1010353242 | 144 |
| 158 | 3300009101 | Ga0105247_10133406 | Ga0105247_101334061 | 144 |
| 159 | 3300009148 | Ga0105243_10514389 | Ga0105243_105143892 | 144 |
| 160 | 3300009174 | Ga0105241_10262772 | Ga0105241_102627721 | 144 |
| 161 | 3300009177 | Ga0105248_10501820 | Ga0105248_105018202 | 144 |
| 162 | 3300009545 | Ga0105237_10006117 | Ga0105237_100061178 | 144 |
| 163 | 3300010375 | Ga0105239_10355614 | Ga0105239_103556143 | 144 |
| 164 | 3300011119 | Ga0105246_10801790 | Ga0105246_108017901 | 144 |
| 165 | 3300013105 | Ga0157369_10002584 | Ga0157369_1000258416 | 144 |
| 166 | 3300013105 | Ga0157369_10049026 | Ga0157369_100490268 | 144 |
| 167 | 3300013308 | Ga0157375_10390063 | Ga0157375_103900632 | 144 |
| 168 | 3300014325 | Ga0163163_11004731 | Ga0163163_110047311 | 144 |
| 169 | 3300021388 | Ga0213875_10000800 | Ga0213875_100008001 | 144 |
| 170 | 3300025711 | Ga0207696_1112231 | Ga0207696_11122311 | 144 |
| 171 | 3300025899 | Ga0207642_10370644 | Ga0207642_103706441 | 144 |
| 172 | 3300025904 | Ga0207647_10013682 | Ga0207647_100136824 | 144 |
| 173 | 3300025905 | Ga0207685_10080873 | Ga0207685_100808731 | 144 |
| 174 | 3300025908 | Ga0207643_10069453 | Ga0207643_100694532 | 144 |
| 175 | 3300025912 | Ga0207707_10312424 | Ga0207707_103124243 | 144 |
| 176 | 3300025914 | Ga0207671_10028034 | Ga0207671_100280344 | 144 |
| 177 | 3300025915 | Ga0207693_10010380 | Ga0207693_100103804 | 144 |
| 178 | 3300025916 | Ga0207663_11019444 | Ga0207663_110194442 | 144 |
| 179 | 3300025917 | Ga0207660_10316824 | Ga0207660_103168243 | 144 |
| 180 | 3300025921 | Ga0207652_10530545 | Ga0207652_105305452 | 144 |
| 181 | 3300025928 | Ga0207700_10177187 | Ga0207700_101771871 | 144 |
| 182 | 3300025928 | Ga0207700_10305786 | Ga0207700_103057863 | 144 |
| 183 | 3300025928 | Ga0207700_10352816 | Ga0207700_103528163 | 144 |
| 184 | 3300025929 | Ga0207664_10044893 | Ga0207664_100448938 | 144 |
| 185 | 3300025929 | Ga0207664_10878888 | Ga0207664_108788881 | 144 |
| 186 | 3300025935 | Ga0207709_10839032 | Ga0207709_108390321 | 144 |
| 187 | 3300025937 | Ga0207669_10088318 | Ga0207669_100883181 | 144 |
| 188 | 3300025941 | Ga0207711_10337072 | Ga0207711_103370722 | 144 |
| 189 | 3300025944 | Ga0207661_10226272 | Ga0207661_102262723 | 144 |
| 190 | 3300025972 | Ga0207668_11472250 | Ga0207668_114722501 | 144 |
| 191 | 3300026035 | Ga0207703_10966216 | Ga0207703_109662161 | 144 |
| 192 | 3300026041 | Ga0207639_10903573 | Ga0207639_109035732 | 144 |
| 193 | 3300026078 | Ga0207702_10764530 | Ga0207702_107645301 | 144 |
| 194 | 3300026121 | Ga0207683_10532177 | Ga0207683_105321772 | 144 |
| 195 | 3300026142 | Ga0207698_12031555 | Ga0207698_120315551 | 144 |
| 196 | 3300030521 | Ga0307511_10032519 | Ga0307511_100325193 | 144 |
| 197 | 3300031730 | Ga0307516_10393350 | Ga0307516_103933501 | 144 |
| 198 | 3300031731 | Ga0307405_10675100 | Ga0307405_106751002 | 144 |
| 199 | 3300031731 | Ga0307405_11036447 | Ga0307405_110364471 | 144 |
| 200 | 3300031824 | Ga0307413_10753038 | Ga0307413_107530382 | 144 |
| 201 | 3300031838 | Ga0307518_10117623 | Ga0307518_101176231 | 144 |
| 202 | 3300031838 | Ga0307518_10135672 | Ga0307518_101356723 | 144 |
| 203 | 3300031838 | Ga0307518_10347580 | Ga0307518_103475801 | 144 |
| 204 | 3300031911 | Ga0307412_10279646 | Ga0307412_102796462 | 144 |
| 205 | 3300031995 | Ga0307409_101602780 | Ga0307409_1016027801 | 144 |
| 206 | 3300032002 | Ga0307416_101902371 | Ga0307416_1019023711 | 144 |
| 207 | 3300032126 | Ga0307415_100826245 | Ga0307415_1008262451 | 144 |
| 208 | 3300033180 | Ga0307510_10017239 | Ga0307510_100172395 | 144 |
| 209 | 3300035083 | Ga0373926_0002307 | Ga0373926_0002307_5184_5618 | 144 |
| 210 | 3300035086 | Ga0373934_0035474 | Ga0373934_0035474_301_735 | 144 |
| 211 | 3300035113 | Ga0373936_0000602 | Ga0373936_0000602_6524_6958 | 144 |
| 212 | 3300035116 | Ga0373945_0000122 | Ga0373945_0000122_3638_4072 | 144 |
| 213 | 3300035119 | Ga0373956_0281502 | Ga0373956_0281502_266_700 | 144 |
| 214 | 3300035170 | Ga0373943_0000154 | Ga0373943_0000154_5714_6148 | 144 |
| 215 | 3300035171 | Ga0373946_0000320 | Ga0373946_0000320_9658_10092 | 144 |
| 216 | 3300035172 | Ga0373955_0698486 | Ga0373955_0698486_123_557 | 144 |
| 217 | 3300035695 | Ga0373927_0000295 | Ga0373927_0000295_7780_8214 | 144 |
| 218 | 3300035724 | Ga0373933_0038580 | Ga0373933_0038580_1434_1868 | 144 |
| 219 | 3300035724 | Ga0373933_0057154 | Ga0373933_0057154_1786_2220 | 144 |
| 220 | 3300035725 | Ga0373947_0000143 | Ga0373947_0000143_19429_19863 | 144 |
| 221 | 3300036401 | Ga0373937_0054456 | Ga0373937_0054456_1672_2106 | 144 |
| 222 | 3300037068 | Ga0373925_0001994 | Ga0373925_0001994_5670_6104 | 144 |
| 223 | 3300037312 | Ga0395899_0384744 | Ga0395899_0384744_391_825 | 144 |
| 224 | 3300037418 | Ga0395900_0843197 | Ga0395900_0843197_112_546 | 144 |
| 225 | 3300037466 | Ga0395898_0000804 | Ga0395898_0000804_9471_9905 | 144 |
| 226 | 3300037466 | Ga0395898_0167715 | Ga0395898_0167715_1398_1832 | 144 |
| 227 | 3300037853 | Ga0436364_1195389 | Ga0436364_1195389_3292_3726 | 144 |
| 228 | 3300038443 | Ga0395901_0175197 | Ga0395901_0175197_1692_2126 | 144 |
| 229 | 3300038443 | Ga0395901_0362659 | Ga0395901_0362659_573_1007 | 144 |
| 230 | 3300042005 | Ga0439448_0057399 | Ga0439448_0057399_13_447 | 144 |
| 231 | 3300044684 | Ga0466966_0014422 | Ga0466966_0014422_4121_4555 | 144 |
| 232 | 3300044693 | Ga0466961_0023856 | Ga0466961_0023856_2469_2903 | 144 |
| 233 | 3300045976 | Ga0466967_0008307 | Ga0466967_0008307_5723_6157 | 144 |
| 234 | 3300045976 | Ga0466967_0222070 | Ga0466967_0222070_1206_1640 | 144 |
| 235 | 3300046454 | Ga0495592_0335508 | Ga0495592_0335508_446_880 | 144 |
| 236 | 3300046461 | Ga0495641_0007538 | Ga0495641_0007538_6245_6679 | 144 |
| 237 | 3300046462 | Ga0495651_0079183 | Ga0495651_0079183_1102_1536 | 144 |
| 238 | 3300046462 | Ga0495651_0244385 | Ga0495651_0244385_747_1181 | 144 |
| 239 | 3300046463 | Ga0495653_0028837 | Ga0495653_0028837_3348_3782 | 144 |
| 240 | 3300046473 | Ga0495582_0032310 | Ga0495582_0032310_49_483 | 144 |
| 241 | 3300046476 | Ga0495662_0228095 | Ga0495662_0228095_14_448 | 144 |
| 242 | 3300046477 | Ga0495664_0003056 | Ga0495664_0003056_5104_5538 | 144 |
| 243 | 3300046514 | Ga0495618_0009275 | Ga0495618_0009275_1723_2157 | 144 |
| 244 | 3300046516 | Ga0495628_0057029 | Ga0495628_0057029_1945_2379 | 144 |
| 245 | 3300046524 | Ga0495648_0005460 | Ga0495648_0005460_4324_4758 | 144 |
| 246 | 3300046529 | Ga0495652_0037752 | Ga0495652_0037752_470_904 | 144 |
| 247 | 3300046530 | Ga0495654_0033666 | Ga0495654_0033666_583_1017 | 144 |
| 248 | 3300046531 | Ga0495665_0055853 | Ga0495665_0055853_1493_1927 | 144 |
| 249 | 3300046533 | Ga0495640_0171025 | Ga0495640_0171025_746_1180 | 144 |
| 250 | 3300046535 | Ga0495586_0737626 | Ga0495586_0737626_51_485 | 144 |
| 251 | 3300046536 | Ga0495587_0363712 | Ga0495587_0363712_14_448 | 144 |
| 252 | 3300046536 | Ga0495587_0389050 | Ga0495587_0389050_40_474 | 144 |
| 253 | 3300046543 | Ga0495645_0051163 | Ga0495645_0051163_2330_2764 | 144 |
| 254 | 3300046543 | Ga0495645_0059242 | Ga0495645_0059242_2024_2458 | 144 |
| 255 | 3300046559 | Ga0495667_0005468 | Ga0495667_0005468_3967_4401 | 144 |
| 256 | 3300046642 | Ga0495634_0014934 | Ga0495634_0014934_1528_1962 | 144 |
| 257 | 3300046648 | Ga0495611_0033918 | Ga0495611_0033918_1394_1828 | 144 |
| 258 | 3300046660 | Ga0495625_0536613 | Ga0495625_0536613_145_579 | 144 |
| 259 | 3300046663 | Ga0495635_0014284 | Ga0495635_0014284_3515_3949 | 144 |
| 260 | 3300046675 | Ga0495657_0020017 | Ga0495657_0020017_3657_4091 | 144 |
| 261 | 3300046678 | Ga0495599_0021108 | Ga0495599_0021108_401_835 | 144 |
| 262 | 3300046681 | Ga0495647_0206771 | Ga0495647_0206771_412_846 | 144 |
| 263 | 3300046690 | Ga0495624_0011510 | Ga0495624_0011510_2049_2483 | 144 |
| 264 | 3300046809 | Ga0495600_0008444 | Ga0495600_0008444_467_901 | 144 |
| 265 | 3300047315 | Ga0495581_0014168 | Ga0495581_0014168_1316_1750 | 144 |
| 266 | 3300047317 | Ga0495604_0087578 | Ga0495604_0087578_543_977 | 144 |
| 267 | 3300047319 | Ga0495674_0000541 | Ga0495674_0000541_5198_5632 | 144 |
| 268 | 3300047320 | Ga0495672_0001138 | Ga0495672_0001138_20666_21100 | 144 |
| 269 | 3300047321 | Ga0495676_0029110 | Ga0495676_0029110_678_1112 | 144 |
| 270 | 3300047322 | Ga0495680_0010708 | Ga0495680_0010708_2687_3121 | 144 |
| 271 | 3300047469 | Ga0495673_0000696 | Ga0495673_0000696_30053_30487 | 144 |
| 272 | 3300047471 | Ga0495684_0015990 | Ga0495684_0015990_1608_2042 | 144 |
| 273 | 3300047673 | Ga0495593_0116104 | Ga0495593_0116104_504_938 | 144 |
| 274 | 3300048903 | Ga0496100_0029492 | Ga0496100_0029492_1198_1632 | 144 |
| 275 | 3300048904 | Ga0496101_0076264 | Ga0496101_0076264_1736_2170 | 144 |
| 276 | 3300048905 | Ga0496102_0000006 | Ga0496102_0000006_124820_125254 | 144 |
| 277 | 3300048906 | Ga0496103_0000006 | Ga0496103_0000006_124618_125052 | 144 |
| 278 | 3300048907 | Ga0496104_0126037 | Ga0496104_0126037_202_636 | 144 |
| 279 | 3300048908 | Ga0496105_0035719 | Ga0496105_0035719_3533_3967 | 144 |
| 280 | 3300048909 | Ga0496106_0023994 | Ga0496106_0023994_2967_3401 | 144 |
| 281 | 3300048910 | Ga0496107_0028956 | Ga0496107_0028956_1260_1694 | 144 |
| 282 | 3300048911 | Ga0496108_0000280 | Ga0496108_0000280_11615_12049 | 144 |
| 283 | 3300048912 | Ga0496109_2002131 | Ga0496109_2002131_32_466 | 144 |
| 284 | 3300048918 | Ga0496115_0069927 | Ga0496115_0069927_159_593 | 144 |
| 285 | 3300048919 | Ga0496116_0000025 | Ga0496116_0000025_345488_345922 | 144 |
| 286 | 3300048920 | Ga0496117_0000006 | Ga0496117_0000006_345488_345922 | 144 |
| 287 | 3300048921 | Ga0496118_0000004 | Ga0496118_0000004_345488_345922 | 144 |
| 288 | 3300048923 | Ga0496120_0282916 | Ga0496120_0282916_61_495 | 144 |
| 289 | 3300048924 | Ga0496121_0119442 | Ga0496121_0119442_144_578 | 144 |
| 290 | 3300048925 | Ga0496122_0246060 | Ga0496122_0246060_451_888 | 144 |
| 291 | 3300048929 | Ga0496126_0000985 | Ga0496126_0000985_40835_41269 | 144 |
| 292 | 3300048929 | Ga0496126_0076888 | Ga0496126_0076888_1914_2348 | 144 |
| 293 | 3300049569 | Ga0501032_0023140 | Ga0501032_0023140_813_1247 | 144 |
| 294 | 3300049570 | Ga0501033_0228659 | Ga0501033_0228659_60_494 | 144 |
| 295 | 3300049571 | Ga0501034_0143868 | Ga0501034_0143868_898_1335 | 144 |
| 296 | 3300049574 | Ga0501038_0040039 | Ga0501038_0040039_1811_2245 | 144 |
| 297 | 3300049575 | Ga0501039_0093540 | Ga0501039_0093540_1063_1497 | 144 |
| 298 | 3300049580 | Ga0501046_0114651 | Ga0501046_0114651_629_1063 | 144 |
| 299 | 3300049581 | Ga0501047_0005935 | Ga0501047_0005935_9200_9634 | 144 |
| 300 | 3300049582 | Ga0501048_0002212 | Ga0501048_0002212_14284_14718 | 144 |
| 301 | 3300049586 | Ga0501070_0002178 | Ga0501070_0002178_12169_12603 | 144 |
| 302 | 3300050490 | nmdc:mga03n38_413965_c1 | nmdc:mga03n38_413965_c1_163_597 | 144 |
| 303 | 3300050514 | nmdc:mga08x19_996821_c1 | nmdc:mga08x19_996821_c1_72_506 | 144 |
| 304 | 3300050516 | nmdc:mga0sz30_120308_c1 | nmdc:mga0sz30_120308_c1_534_968 | 144 |
| 305 | 3300053084 | Ga0495595_0420430 | Ga0495595_0420430_191_625 | 144 |
| 306 | 3300053160 | Ga0500633_0340860 | Ga0500633_0340860_89_523 | 144 |
| 307 | 3300061719 | Ga0466962_0416398 | Ga0466962_0416398_51_485 | 144 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2fge-assembly2.cif.gz_B | crystal structure of presequence protease prep from arabidopsis thaliana | 0.7426 | 111 | 142 |
| 6tmf-assembly1.cif.gz_F | structure of an archaeal abce1-bound ribosomal post-splitting complex | 0.7356 | 117 | 142 |
| 7d4i-assembly1.cif.gz_RE | cryo-em structure of 90s small ribosomal precursors complex with the deah-box rna helicase dhr1 (state f) | 0.7313 | 98 | 143 |
| 6th6-assembly1.cif.gz_Af | cryo-em structure of t. kodakarensis 70s ribosome | 0.7302 | 117 | 142 |
| 7zai-assembly1.cif.gz_E | cryo-em structure of a pyrococcus abyssi 30s bound to met-initiator trna, mrna and aif1a. | 0.7241 | 117 | 142 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_L7N686_1_158_3.30.460.40 | Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2; | 0.7865 | 101 | 143 | 3.30.460.40 |
| af_O06633_2_115_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.782 | 3 | 143 | 3.10.180.10 |
| af_Q8VY06_87_348_3.30.830.10 | Alpha Beta;2-Layer Sandwich;Cytochrome Bc1 Complex; Chain A, domain 1;Metalloenzyme, LuxS/M16 peptidase-like | 0.7655 | 108 | 142 | 3.30.830.10 |
| af_O06633_2_115_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.757 | 3 | 143 | 3.10.180.10 |
| 6fz6B02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.7246 | 115 | 142 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6A8RF46-F1-model_v4 | deleted | 0.9283 | 90 | 144 |
|
| AF-A0A1S1K427-F1-model_v4 | Glyoxalase-like domain-containing protein | 0.926 | 22 | 135 |
|
| AF-A0A4V2EXV8-F1-model_v4 | Glyoxalase-like domain-containing protein | 0.9125 | 1 | 144 |
|
| AF-A0A2G7C126-F1-model_v4 | deleted | 0.9116 | 1 | 144 |
|
| AF-A0A1C5EIB2-F1-model_v4 | Glyoxalase-like domain-containing protein | 0.9102 | 1 | 144 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar