F399059

General Info

Members Datasets Scaffolds Average Seq Length
307 213 302 217

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10017907|Ga0070681_100179077
Length 240
Sequence MPSIHSAARFWIVHECSEPKNFMTTFPNSPRVLKGGLVLIDPDSSAVQRIIVLQYNPDTLTRSLQPQTVKESGDRSEAMRLTGPPVETIKLDAEIDATDQLEFPDQNSTAVEFGIQPQLAALETIVYPTSSQLLSNNSLAQAGMLEILPMMAALPLFVWSKSRVVPVRVTDFSVTEEAFDPALNPIRAKVSLGMRVLSVTDLGFDNKGGSLFMAYQQQKEQLASKSLGGALSLLGIRGIP

Samples

Sample ID Description Type Environment
1 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
2 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
3 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
4 2904699407
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
143 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
144 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
145 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
146 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
151 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
152 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
153 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
157 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
158 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
159 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
160 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
161 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
162 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
163 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
164 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
165 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
166 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
167 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
168 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
169 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
170 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
171 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
172 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
173 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
174 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
175 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
176 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
177 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
178 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
179 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
180 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
181 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
182 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
183 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
184 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
185 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
186 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
193 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
194 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
197 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
198 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
199 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
200 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
201 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
202 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
203 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
204 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
205 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
206 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
207 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
208 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
209 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
210 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
211 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
212 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
213 8002775197 Frankia nepalensis CN7 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.69
Metatranscriptomes 0
Isolates 1.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.58
Nodule 0.33
Rhizoplane 4.56
Rhizosphere 88.93
Stem 0
Stem Tuber 0
Unclassified 2.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10021329 3300003203 Bacteria 2602
2 rootL2_10222238 3300003322 Unclassified 2420
3 Ga0065712_10110563 3300005290 Bacteria 1827
4 Ga0065715_10015160 3300005293 Bacteria 2644
5 Ga0065715_10092101 3300005293 Bacteria 5323
6 Ga0065707_10089702 3300005295 Bacteria 4300
7 Ga0065707_10099734 3300005295 Bacteria 2983
8 Ga0070658_10263892 3300005327 Bacteria 1463
9 Ga0070676_10011428 3300005328 Bacteria 4828
10 Ga0070690_100001967 3300005330 Bacteria 10937
11 Ga0070670_100018852 3300005331 Bacteria 5917
12 Ga0070670_100024070 3300005331 Bacteria 5238
13 Ga0070677_10106439 3300005333 Bacteria 1245
14 Ga0068869_100040240 3300005334 Bacteria 3342
15 Ga0070682_100026497 3300005337 Bacteria 3471
16 Ga0068868_100032937 3300005338 Bacteria 3991
17 Ga0070660_100106354 3300005339 Bacteria 2228
18 Ga0070689_100054856 3300005340 Bacteria 3086
19 Ga0070691_10094085 3300005341 Bacteria 1481
20 Ga0070687_100055075 3300005343 Bacteria 2075
21 Ga0070687_100191693 3300005343 Bacteria 1232
22 Ga0070661_100078810 3300005344 Bacteria 2430
23 Ga0070668_100010031 3300005347 Bacteria 7020
24 Ga0070669_100097105 3300005353 Bacteria 2217
25 Ga0070675_100018611 3300005354 Bacteria 5529
26 Ga0070671_100014244 3300005355 Bacteria 6421
27 Ga0070674_100019119 3300005356 Bacteria 4346
28 Ga0070674_100118673 3300005356 Bacteria 1955
29 Ga0070673_100141105 3300005364 Bacteria 2032
30 Ga0070688_100227763 3300005365 Bacteria 1317
31 Ga0070659_100087417 3300005366 Bacteria 2495
32 Ga0070667_100011622 3300005367 Bacteria 7279
33 Ga0070667_100019678 3300005367 Bacteria 5600
34 Ga0070667_100421326 3300005367 Bacteria 1217
35 Ga0070710_10420109 3300005437 Bacteria 900
36 Ga0070705_100018482 3300005440 Bacteria 3655
37 Ga0070700_100000193 3300005441 Bacteria 34477
38 Ga0070700_100605091 3300005441 Bacteria 859
39 Ga0070694_100028041 3300005444 Bacteria 3661
40 Ga0070694_100582799 3300005444 Bacteria 899
41 Ga0070708_100000237 3300005445 Bacteria 40825
42 Ga0070708_100402873 3300005445 Bacteria 1290
43 Ga0070678_100033616 3300005456 Bacteria 3562
44 Ga0070662_100240652 3300005457 Bacteria 1451
45 Ga0070681_10017907 3300005458 Bacteria 7081
46 Ga0070681_10075853 3300005458 Bacteria 3322
47 Ga0068867_100009576 3300005459 Bacteria 6830
48 Ga0068867_100531765 3300005459 Bacteria 1015
49 Ga0070685_10001425 3300005466 Bacteria 12551
50 Ga0070706_100136247 3300005467 Bacteria 2292
51 Ga0070706_100152962 3300005467 Bacteria 2154
52 Ga0070707_100013888 3300005468 Bacteria 7543
53 Ga0070707_100743648 3300005468 Bacteria 944
54 Ga0070698_100015032 3300005471 Bacteria 8183
55 Ga0070698_100229172 3300005471 Unclassified 1791
56 Ga0070698_100355870 3300005471 Bacteria 1396
57 Ga0070698_100593331 3300005471 Bacteria 1048
58 Ga0070699_100132507 3300005518 Bacteria 2197
59 Ga0070699_100155558 3300005518 Unclassified 2023
60 Ga0070699_100228751 3300005518 Bacteria 1658
61 Ga0070699_100267280 3300005518 Bacteria 1530
62 Ga0070679_100062794 3300005530 Bacteria 3703
63 Ga0070679_100183095 3300005530 Bacteria 2067
64 Ga0070679_100727797 3300005530 Bacteria 935
65 Ga0070697_100016236 3300005536 Bacteria 5854
66 Ga0070697_100019531 3300005536 Bacteria 5354
67 Ga0070697_101042943 3300005536 Bacteria 727
68 Ga0068853_100068383 3300005539 Bacteria 3088
69 Ga0070686_100023817 3300005544 Bacteria 3664
70 Ga0070695_100066814 3300005545 Bacteria 2344
71 Ga0070695_100141399 3300005545 Bacteria 1669
72 Ga0070695_100383381 3300005545 Bacteria 1061
73 Ga0070695_100388847 3300005545 Bacteria 1054
74 Ga0070696_100148399 3300005546 Bacteria 1719
75 Ga0070693_100032279 3300005547 Bacteria 2878
76 Ga0070665_100000026 3300005548 Bacteria 365176
77 Ga0070665_100294992 3300005548 Bacteria 1624
78 Ga0070704_100332180 3300005549 Unclassified 1277
79 Ga0068855_100162647 3300005563 Bacteria 2532
80 Ga0070664_100021201 3300005564 Bacteria 5353
81 Ga0070664_100243047 3300005564 Bacteria 1616
82 Ga0068856_100002786 3300005614 Bacteria 17899
83 Ga0068856_100047909 3300005614 Bacteria 4210
84 Ga0068856_100143379 3300005614 Bacteria 2396
85 Ga0070702_100717057 3300005615 Bacteria 764
86 Ga0068852_100092481 3300005616 Bacteria 2709
87 Ga0068859_100003211 3300005617 Bacteria 16645
88 Ga0068859_100011283 3300005617 Bacteria 8991
89 Ga0068859_100092542 3300005617 Bacteria 3075
90 Ga0068859_100337578 3300005617 Unclassified 1601
91 Ga0068859_100375011 3300005617 Bacteria 1518
92 Ga0068859_100422529 3300005617 Bacteria 1429
93 Ga0068864_100109626 3300005618 Bacteria 2458
94 Ga0068864_100268943 3300005618 Bacteria 1588
95 Ga0068861_100180307 3300005719 Bacteria 1758
96 Ga0068858_100154203 3300005842 Bacteria 2161
97 Ga0068858_100391893 3300005842 Bacteria 1334
98 Ga0068860_100136201 3300005843 Bacteria 2358
99 Ga0068860_100948305 3300005843 Bacteria 878
100 Ga0081539_10000369 3300005985 Bacteria 98527
101 Ga0075363_100065970 3300006048 Bacteria 1958
102 Ga0075367_10052869 3300006178 Bacteria 2406
103 Ga0075369_10045682 3300006186 Bacteria 1884
104 Ga0075366_10015832 3300006195 Bacteria 4329
105 Ga0097621_100113154 3300006237 Bacteria 2296
106 Ga0097621_100202672 3300006237 Bacteria 1723
107 Ga0075370_10009751 3300006353 Bacteria 5001
108 Ga0068871_100734873 3300006358 Bacteria 906
109 Ga0068871_100954215 3300006358 Bacteria 797
110 Ga0075430_100229345 3300006846 Bacteria 1540
111 Ga0075431_100206621 3300006847 Bacteria 2007
112 Ga0075433_10088432 3300006852 Bacteria 2737
113 Ga0075433_10553370 3300006852 Bacteria 1011
114 Ga0075434_100043778 3300006871 Bacteria 4440
115 Ga0075434_100076062 3300006871 Unclassified 3352
116 Ga0075434_100550305 3300006871 Bacteria 1174
117 Ga0075436_100051161 3300006914 Viruses 2851
118 Ga0075436_100077583 3300006914 Bacteria 2301
119 Ga0097620_100003211 3300006931 Bacteria 16645
120 Ga0097620_100011281 3300006931 Bacteria 8991
121 Ga0097620_100092542 3300006931 Bacteria 3075
122 Ga0097620_100337584 3300006931 Unclassified 1601
123 Ga0097620_100375006 3300006931 Bacteria 1518
124 Ga0075435_100179359 3300007076 Bacteria 1790
125 Ga0111539_10106649 3300009094 Bacteria 3287
126 Ga0111539_10656941 3300009094 Bacteria 1221
127 Ga0105245_10169148 3300009098 Bacteria 2080
128 Ga0105247_10029100 3300009101 Unclassified 3346
129 Ga0114129_10040282 3300009147 Bacteria 6586
130 Ga0114129_10232542 3300009147 Bacteria 2482
131 Ga0114129_10286053 3300009147 Bacteria 2201
132 Ga0114129_10994261 3300009147 Bacteria 1057
133 Ga0105243_10086069 3300009148 Bacteria 2577
134 Ga0105243_11027828 3300009148 Bacteria 828
135 Ga0105241_10161705 3300009174 Bacteria 1841
136 Ga0105241_10167428 3300009174 Bacteria 1812
137 Ga0105242_10009255 3300009176 Bacteria 7560
138 Ga0105242_10068611 3300009176 Bacteria 2934
139 Ga0105248_10003342 3300009177 Bacteria 17833
140 Ga0105248_10068677 3300009177 Bacteria 3979
141 Ga0105248_10492137 3300009177 Bacteria 1382
142 Ga0105238_10306443 3300009551 Bacteria 1572
143 Ga0105249_10082247 3300009553 Bacteria 2996
144 Ga0105239_10005799 3300010375 Bacteria 14408
145 Ga0105246_10020900 3300011119 Bacteria 4204
146 Ga0157373_10503929 3300013100 Bacteria 875
147 Ga0157371_10128808 3300013102 Bacteria 1800
148 Ga0157374_10015332 3300013296 Bacteria 6722
149 Ga0157378_10381522 3300013297 Bacteria 1384
150 Ga0157378_10382353 3300013297 Bacteria 1383
151 Ga0163162_10152017 3300013306 Bacteria 2433
152 Ga0163162_10269127 3300013306 Bacteria 1835
153 Ga0163162_10934275 3300013306 Bacteria 979
154 Ga0157372_10133332 3300013307 Bacteria 2860
155 Ga0157375_10435420 3300013308 Bacteria 1477
156 Ga0163163_10292464 3300014325 Unclassified 1681
157 Ga0157380_10089873 3300014326 Unclassified 2532
158 Ga0157380_10164236 3300014326 Bacteria 1933
159 Ga0157380_10202146 3300014326 Bacteria 1764
160 Ga0157379_10430855 3300014968 Bacteria 1215
161 Ga0207697_10001865 3300025315 Bacteria 11253
162 Ga0207692_10358108 3300025898 Bacteria 901
163 Ga0207688_10025519 3300025901 Bacteria 3245
164 Ga0207645_10003342 3300025907 Bacteria 12230
165 Ga0207705_10312884 3300025909 Bacteria 1206
166 Ga0207684_10000047 3300025910 Bacteria 244386
167 Ga0207684_10065798 3300025910 Unclassified 3078
168 Ga0207684_10114425 3300025910 Bacteria 2310
169 Ga0207654_10182991 3300025911 Bacteria 1368
170 Ga0207707_10024166 3300025912 Bacteria 5316
171 Ga0207707_10099375 3300025912 Bacteria 2543
172 Ga0207660_10026080 3300025917 Bacteria 3976
173 Ga0207660_10214179 3300025917 Bacteria 1510
174 Ga0207662_10069376 3300025918 Bacteria 2130
175 Ga0207662_10101118 3300025918 Bacteria 1786
176 Ga0207657_10006391 3300025919 Bacteria 12237
177 Ga0207649_10428751 3300025920 Bacteria 994
178 Ga0207652_10137516 3300025921 Bacteria 2183
179 Ga0207652_10161534 3300025921 Bacteria 2009
180 Ga0207652_10880910 3300025921 Bacteria 792
181 Ga0207681_10281934 3300025923 Bacteria 1308
182 Ga0207650_10118126 3300025925 Bacteria 2061
183 Ga0207650_10145519 3300025925 Bacteria 1866
184 Ga0207650_10900898 3300025925 Unclassified 751
185 Ga0207659_10016717 3300025926 Bacteria 4781
186 Ga0207687_10285084 3300025927 Bacteria 1325
187 Ga0207644_10289659 3300025931 Bacteria 1316
188 Ga0207706_10000999 3300025933 Bacteria 28802
189 Ga0207706_10013511 3300025933 Bacteria 7421
190 Ga0207686_10006472 3300025934 Bacteria 6305
191 Ga0207670_10061360 3300025936 Bacteria 2566
192 Ga0207670_10168404 3300025936 Bacteria 1641
193 Ga0207669_10039910 3300025937 Bacteria 2718
194 Ga0207669_10085466 3300025937 Bacteria 2037
195 Ga0207691_10026915 3300025940 Bacteria 5395
196 Ga0207711_10006529 3300025941 Bacteria 9818
197 Ga0207711_10024065 3300025941 Bacteria 5097
198 Ga0207711_10387797 3300025941 Bacteria 1297
199 Ga0207661_10285213 3300025944 Unclassified 1477
200 Ga0207679_10159281 3300025945 Bacteria 1846
201 Ga0207667_10090835 3300025949 Bacteria 3156
202 Ga0207712_10065753 3300025961 Bacteria 2589
203 Ga0207668_10149582 3300025972 Bacteria 1806
204 Ga0207658_10029639 3300025986 Bacteria 3868
205 Ga0207639_10054879 3300026041 Bacteria 3047
206 Ga0207708_10001354 3300026075 Bacteria 18401
207 Ga0207702_10015704 3300026078 Bacteria 6270
208 Ga0207702_10250191 3300026078 Bacteria 1664
209 Ga0207702_10271940 3300026078 Bacteria 1598
210 Ga0207641_10026966 3300026088 Bacteria 4745
211 Ga0207641_10285135 3300026088 Bacteria 1555
212 Ga0207648_10013672 3300026089 Bacteria 7536
213 Ga0207676_10049918 3300026095 Bacteria 3259
214 Ga0207683_10001033 3300026121 Bacteria 25396
215 Ga0268266_10000001 3300028379 Bacteria 4040580
216 Ga0268266_10200070 3300028379 Bacteria 1828
217 Ga0268264_10634311 3300028381 Bacteria 1056
218 Ga0307408_100001408 3300031548 Bacteria 17895
219 Ga0316578_10419148 3300031728 Unclassified 793
220 Ga0307410_10031202 3300031852 Bacteria 3417
221 Ga0307407_10044655 3300031903 Bacteria 2499
222 Ga0307412_10014583 3300031911 Bacteria 4639
223 Ga0307409_100169989 3300031995 Bacteria 1917
224 Ga0307416_100007919 3300032002 Bacteria 6803
225 Ga0307414_10054546 3300032004 Bacteria 2794
226 Ga0307414_10353362 3300032004 Unclassified 1262
227 Ga0307415_100024702 3300032126 Bacteria 3758
228 Ga0307415_100881770 3300032126 Bacteria 823
229 Ga0373943_0272119 3300035170 Bacteria 956
230 Ga0373927_0199735 3300035695 Bacteria 1313
231 Ga0316582_0407436 3300036647 Bacteria 937
232 Ga0395899_0023366 3300037312 Bacteria 4683
233 Ga0395900_0009078 3300037418 Bacteria 10191
234 Ga0395900_0037872 3300037418 Bacteria 4972
235 Ga0395898_0025330 3300037466 Bacteria 5979
236 Ga0395898_0079967 3300037466 Unclassified 3153
237 Ga0395905_0282507 3300037471 Bacteria 1546
238 Ga0395901_0000661 3300038443 Bacteria 39682
239 Ga0400490_01349 3300038726 Bacteria 82659
240 Ga0400491_23637 3300038727 Bacteria 3282
241 Ga0400485_13440 3300038735 Bacteria 14764
242 Ga0400486_21167 3300038742 Bacteria 32156
243 Ga0439431_0036991 3300041997 Unclassified 1231
244 Ga0439445_0022484 3300042004 Unclassified 1590
245 Ga0439455_0025081 3300042012 Bacteria 1447
246 Ga0439456_001258 3300042013 Bacteria 5042
247 Ga0450911_000004 3300042115 Bacteria 234537
248 Ga0439459_0003978 3300042438 Bacteria 2367
249 Ga0450893_0001057 3300042532 Bacteria 4146
250 Ga0466982_0070688 3300044672 Bacteria 2155
251 Ga0453684_0005526 3300044712 Bacteria 24950
252 Ga0451576_0154077 3300045051 Bacteria 2397
253 Ga0495580_0249769 3300046472 Bacteria 1215
254 Ga0495664_0213771 3300046477 Unclassified 1168
255 Ga0495584_0021451 3300046491 Bacteria 3281
256 Ga0495610_0001388 3300046512 Bacteria 21515
257 Ga0495632_0000570 3300046519 Bacteria 34221
258 Ga0495645_0034067 3300046543 Bacteria 3716
259 Ga0495633_0001385 3300046558 Bacteria 18920
260 Ga0495635_0278354 3300046663 Unclassified 1124
261 Ga0495599_0034710 3300046678 Bacteria 3168
262 Ga0495670_0019872 3300046691 Bacteria 3310
263 Ga0495600_0008252 3300046809 Bacteria 6394
264 Ga0495680_0407299 3300047322 Unclassified 938
265 Ga0495686_0001590 3300047472 Bacteria 23978
266 Ga0496100_0048603 3300048903 Bacteria 2739
267 Ga0496100_0058291 3300048903 Bacteria 2534
268 Ga0496101_0029439 3300048904 Bacteria 3841
269 Ga0496102_0144902 3300048905 Bacteria 2229
270 Ga0496102_0343273 3300048905 Bacteria 1406
271 Ga0496102_0795960 3300048905 Bacteria 868
272 Ga0496104_0250654 3300048907 Bacteria 1683
273 Ga0496106_0060327 3300048909 Bacteria 2875
274 Ga0496106_0065427 3300048909 Bacteria 2768
275 Ga0496109_0236952 3300048912 Bacteria 1717
276 Ga0496112_0230108 3300048915 Bacteria 1808
277 Ga0496112_0842238 3300048915 Bacteria 841
278 Ga0496114_0228252 3300048917 Bacteria 1635
279 Ga0496115_0012582 3300048918 Bacteria 6375
280 Ga0501031_0485018 3300049568 Bacteria 798
281 Ga0501038_0267785 3300049574 Bacteria 1348
282 Ga0501252_016728 3300049682 Unclassified 926
283 Ga0501221_090669 3300049704 Unclassified 747
284 Ga0501079_0373797 3300049741 Bacteria 1117
285 Ga0501226_000003 3300049853 Bacteria 358977
286 nmdc:mga0k408_16234_c1 3300050493 Bacteria 4129
287 nmdc:mga06z11_38808_c1 3300050494 Unclassified 2366
288 nmdc:mga07m45_58073_c1 3300050496 Bacteria 2189
289 nmdc:mga05p37_57615_c1 3300050507 Bacteria 4785
290 nmdc:mga0qj67_283269_c1 3300050509 Unclassified 1343
291 nmdc:mga06r32_120822_c1 3300050510 Bacteria 2584
292 nmdc:mga0n895_261771_c1 3300050512 Bacteria 1755
293 nmdc:mga0n895_419704_c1 3300050512 Unclassified 1352
294 nmdc:mga0rr50_328873_c1 3300050513 Bacteria 1283
295 nmdc:mga08x19_10974_c1 3300050514 Bacteria 5450
296 nmdc:mga08x19_154564_c1 3300050514 Bacteria 1555
297 nmdc:mga0a205_115998_c1 3300050515 Bacteria 2577
298 nmdc:mga0a205_664806_c1 3300050515 Bacteria 893
299 nmdc:mga0a205_675956_c1 3300050515 Bacteria 883
300 nmdc:mga0sz30_40046_c1 3300050516 Bacteria 1968
301 Ga0500651_0026145 3300053093 Bacteria 3666
302 Ga0500586_000060 3300053145 Bacteria 19508

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047472 Ga0495686_0001590 Ga0495686_0001590_961_1620 193
2 3300050515 nmdc:mga0a205_675956_c1 nmdc:mga0a205_675956_c1_26_610 194
3 3300005293 Ga0065715_10092101 Ga0065715_100921013 197
4 3300006048 Ga0075363_100065970 Ga0075363_1000659702 197
5 3300006178 Ga0075367_10052869 Ga0075367_100528692 197
6 3300006195 Ga0075366_10015832 Ga0075366_100158324 197
7 3300050493 nmdc:mga0k408_16234_c1 nmdc:mga0k408_16234_c1_3237_3896 197
8 iso_pu_bacteria 2904699407 2904700856 199
9 3300005545 Ga0070695_100141399 Ga0070695_1001413993 201
10 3300031903 Ga0307407_10044655 Ga0307407_100446551 202
11 3300031911 Ga0307412_10014583 Ga0307412_100145835 202
12 3300032004 Ga0307414_10353362 Ga0307414_103533622 202
13 3300032126 Ga0307415_100024702 Ga0307415_1000247023 202
14 3300037471 Ga0395905_0282507 Ga0395905_0282507_705_1367 202
15 3300005441 Ga0070700_100000193 Ga0070700_10000019326 203
16 3300005468 Ga0070707_100743648 Ga0070707_1007436481 203
17 3300005518 Ga0070699_100132507 Ga0070699_1001325072 203
18 3300005530 Ga0070679_100062794 Ga0070679_1000627944 203
19 3300005536 Ga0070697_100019531 Ga0070697_1000195313 203
20 3300025921 Ga0207652_10161534 Ga0207652_101615342 203
21 3300046558 Ga0495633_0001385 Ga0495633_0001385_13951_14568 203
22 3300053145 Ga0500586_000060 Ga0500586_000060_5854_6471 203
23 3300005293 Ga0065715_10015160 Ga0065715_100151602 209
24 3300009098 Ga0105245_10169148 Ga0105245_101691483 209
25 3300009174 Ga0105241_10167428 Ga0105241_101674283 209
26 3300009553 Ga0105249_10082247 Ga0105249_100822472 209
27 3300011119 Ga0105246_10020900 Ga0105246_100209002 209
28 3300013307 Ga0157372_10133332 Ga0157372_101333323 209
29 3300050496 nmdc:mga07m45_58073_c1 nmdc:mga07m45_58073_c1_258_893 209
30 3300050516 nmdc:mga0sz30_40046_c1 nmdc:mga0sz30_40046_c1_366_1001 209
31 3300053093 Ga0500651_0026145 Ga0500651_0026145_2719_3360 212
32 3300031728 Ga0316578_10419148 Ga0316578_104191482 213
33 3300038742 Ga0400486_21167 Ga0400486_21167_4372_5013 213
34 iso_pu_bacteria 2808606373 2808903843 213
35 iso_pu_bacteria 8002775197 8002782846 213
36 3300005549 Ga0070704_100332180 Ga0070704_1003321801 214
37 3300014326 Ga0157380_10089873 Ga0157380_100898732 214
38 iso_pu_bacteria 2582581280 2585151741 214
39 iso_pu_bacteria 2582581293 2585195376 214
40 3300005343 Ga0070687_100191693 Ga0070687_1001916931 215
41 3300006846 Ga0075430_100229345 Ga0075430_1002293452 215
42 3300009148 Ga0105243_11027828 Ga0105243_110278281 215
43 3300038735 Ga0400485_13440 Ga0400485_13440_13221_13868 215
44 3300046477 Ga0495664_0213771 Ga0495664_0213771_158_805 215
45 3300046663 Ga0495635_0278354 Ga0495635_0278354_361_1008 215
46 3300047322 Ga0495680_0407299 Ga0495680_0407299_212_859 215
47 3300050509 nmdc:mga0qj67_283269_c1 nmdc:mga0qj67_283269_c1_437_1084 215
48 3300005367 Ga0070667_100421326 Ga0070667_1004213261 216
49 3300005467 Ga0070706_100152962 Ga0070706_1001529622 216
50 3300005518 Ga0070699_100267280 Ga0070699_1002672801 216
51 3300005564 Ga0070664_100243047 Ga0070664_1002430472 216
52 3300005617 Ga0068859_100422529 Ga0068859_1004225292 216
53 3300006186 Ga0075369_10045682 Ga0075369_100456823 216
54 3300006353 Ga0075370_10009751 Ga0075370_100097515 216
55 3300013306 Ga0163162_10934275 Ga0163162_109342752 216
56 3300025944 Ga0207661_10285213 Ga0207661_102852132 216
57 3300032126 Ga0307415_100881770 Ga0307415_1008817701 216
58 3300044712 Ga0453684_0005526 Ga0453684_0005526_2085_2741 216
59 3300049568 Ga0501031_0485018 Ga0501031_0485018_50_700 216
60 3300049574 Ga0501038_0267785 Ga0501038_0267785_631_1281 216
61 3300005295 Ga0065707_10099734 Ga0065707_100997343 217
62 3300005340 Ga0070689_100054856 Ga0070689_1000548564 217
63 3300005356 Ga0070674_100118673 Ga0070674_1001186733 217
64 3300005457 Ga0070662_100240652 Ga0070662_1002406522 217
65 3300005459 Ga0068867_100009576 Ga0068867_1000095764 217
66 3300005459 Ga0068867_100531765 Ga0068867_1005317651 217
67 3300005471 Ga0070698_100355870 Ga0070698_1003558703 217
68 3300005547 Ga0070693_100032279 Ga0070693_1000322792 217
69 3300005617 Ga0068859_100092542 Ga0068859_1000925422 217
70 3300006847 Ga0075431_100206621 Ga0075431_1002066212 217
71 3300006931 Ga0097620_100092542 Ga0097620_1000925422 217
72 3300009094 Ga0111539_10106649 Ga0111539_101066492 217
73 3300009176 Ga0105242_10009255 Ga0105242_100092555 217
74 3300013297 Ga0157378_10381522 Ga0157378_103815222 217
75 3300013306 Ga0163162_10269127 Ga0163162_102691272 217
76 3300025933 Ga0207706_10013511 Ga0207706_100135114 217
77 3300025934 Ga0207686_10006472 Ga0207686_100064725 217
78 3300025936 Ga0207670_10061360 Ga0207670_100613603 217
79 3300025937 Ga0207669_10085466 Ga0207669_100854663 217
80 3300026089 Ga0207648_10013672 Ga0207648_100136724 217
81 3300026095 Ga0207676_10049918 Ga0207676_100499182 217
82 3300031548 Ga0307408_100001408 Ga0307408_10000140816 217
83 3300031852 Ga0307410_10031202 Ga0307410_100312022 217
84 3300031995 Ga0307409_100169989 Ga0307409_1001699893 217
85 3300032002 Ga0307416_100007919 Ga0307416_1000079194 217
86 3300042115 Ga0450911_000004 Ga0450911_000004_80049_80702 217
87 3300042438 Ga0439459_0003978 Ga0439459_0003978_1264_1917 217
88 3300046519 Ga0495632_0000570 Ga0495632_0000570_18474_19127 217
89 3300048907 Ga0496104_0250654 Ga0496104_0250654_13_675 217
90 3300048917 Ga0496114_0228252 Ga0496114_0228252_734_1396 217
91 3300048918 Ga0496115_0012582 Ga0496115_0012582_1207_1869 217
92 3300049682 Ga0501252_016728 Ga0501252_016728_52_705 217
93 3300049704 Ga0501221_090669 Ga0501221_090669_57_710 217
94 3300049853 Ga0501226_000003 Ga0501226_000003_109165_109818 217
95 3300050510 nmdc:mga06r32_120822_c1 nmdc:mga06r32_120822_c1_1499_2152 217
96 3300003322 rootL2_10222238 rootL2_102222382 218
97 3300005290 Ga0065712_10110563 Ga0065712_101105632 218
98 3300005295 Ga0065707_10089702 Ga0065707_100897025 218
99 3300005327 Ga0070658_10263892 Ga0070658_102638922 218
100 3300005328 Ga0070676_10011428 Ga0070676_100114286 218
101 3300005330 Ga0070690_100001967 Ga0070690_1000019674 218
102 3300005331 Ga0070670_100018852 Ga0070670_1000188523 218
103 3300005331 Ga0070670_100024070 Ga0070670_1000240703 218
104 3300005333 Ga0070677_10106439 Ga0070677_101064391 218
105 3300005334 Ga0068869_100040240 Ga0068869_1000402402 218
106 3300005337 Ga0070682_100026497 Ga0070682_1000264974 218
107 3300005338 Ga0068868_100032937 Ga0068868_1000329372 218
108 3300005339 Ga0070660_100106354 Ga0070660_1001063543 218
109 3300005341 Ga0070691_10094085 Ga0070691_100940851 218
110 3300005343 Ga0070687_100055075 Ga0070687_1000550753 218
111 3300005344 Ga0070661_100078810 Ga0070661_1000788102 218
112 3300005347 Ga0070668_100010031 Ga0070668_1000100315 218
113 3300005353 Ga0070669_100097105 Ga0070669_1000971052 218
114 3300005354 Ga0070675_100018611 Ga0070675_1000186113 218
115 3300005355 Ga0070671_100014244 Ga0070671_1000142443 218
116 3300005356 Ga0070674_100019119 Ga0070674_1000191193 218
117 3300005364 Ga0070673_100141105 Ga0070673_1001411052 218
118 3300005365 Ga0070688_100227763 Ga0070688_1002277631 218
119 3300005366 Ga0070659_100087417 Ga0070659_1000874172 218
120 3300005367 Ga0070667_100011622 Ga0070667_1000116223 218
121 3300005367 Ga0070667_100019678 Ga0070667_1000196787 218
122 3300005437 Ga0070710_10420109 Ga0070710_104201091 218
123 3300005440 Ga0070705_100018482 Ga0070705_1000184824 218
124 3300005441 Ga0070700_100605091 Ga0070700_1006050911 218
125 3300005444 Ga0070694_100028041 Ga0070694_1000280413 218
126 3300005444 Ga0070694_100582799 Ga0070694_1005827991 218
127 3300005445 Ga0070708_100000237 Ga0070708_10000023719 218
128 3300005445 Ga0070708_100402873 Ga0070708_1004028732 218
129 3300005456 Ga0070678_100033616 Ga0070678_1000336163 218
130 3300005458 Ga0070681_10017907 Ga0070681_100179077 218
131 3300005458 Ga0070681_10075853 Ga0070681_100758532 218
132 3300005466 Ga0070685_10001425 Ga0070685_100014254 218
133 3300005467 Ga0070706_100136247 Ga0070706_1001362472 218
134 3300005468 Ga0070707_100013888 Ga0070707_1000138884 218
135 3300005471 Ga0070698_100015032 Ga0070698_1000150323 218
136 3300005471 Ga0070698_100229172 Ga0070698_1002291722 218
137 3300005471 Ga0070698_100593331 Ga0070698_1005933311 218
138 3300005518 Ga0070699_100155558 Ga0070699_1001555582 218
139 3300005518 Ga0070699_100228751 Ga0070699_1002287513 218
140 3300005530 Ga0070679_100183095 Ga0070679_1001830953 218
141 3300005530 Ga0070679_100727797 Ga0070679_1007277972 218
142 3300005536 Ga0070697_100016236 Ga0070697_1000162365 218
143 3300005536 Ga0070697_101042943 Ga0070697_1010429431 218
144 3300005539 Ga0068853_100068383 Ga0068853_1000683832 218
145 3300005544 Ga0070686_100023817 Ga0070686_1000238174 218
146 3300005545 Ga0070695_100066814 Ga0070695_1000668143 218
147 3300005545 Ga0070695_100383381 Ga0070695_1003833811 218
148 3300005545 Ga0070695_100388847 Ga0070695_1003888472 218
149 3300005546 Ga0070696_100148399 Ga0070696_1001483993 218
150 3300005548 Ga0070665_100000026 Ga0070665_10000002635 218
151 3300005548 Ga0070665_100294992 Ga0070665_1002949922 218
152 3300005563 Ga0068855_100162647 Ga0068855_1001626472 218
153 3300005564 Ga0070664_100021201 Ga0070664_1000212012 218
154 3300005614 Ga0068856_100002786 Ga0068856_1000027869 218
155 3300005614 Ga0068856_100047909 Ga0068856_1000479092 218
156 3300005614 Ga0068856_100143379 Ga0068856_1001433793 218
157 3300005615 Ga0070702_100717057 Ga0070702_1007170571 218
158 3300005616 Ga0068852_100092481 Ga0068852_1000924812 218
159 3300005617 Ga0068859_100003211 Ga0068859_1000032117 218
160 3300005617 Ga0068859_100011283 Ga0068859_1000112834 218
161 3300005617 Ga0068859_100337578 Ga0068859_1003375782 218
162 3300005617 Ga0068859_100375011 Ga0068859_1003750112 218
163 3300005618 Ga0068864_100109626 Ga0068864_1001096262 218
164 3300005618 Ga0068864_100268943 Ga0068864_1002689432 218
165 3300005719 Ga0068861_100180307 Ga0068861_1001803072 218
166 3300005842 Ga0068858_100154203 Ga0068858_1001542032 218
167 3300005842 Ga0068858_100391893 Ga0068858_1003918932 218
168 3300005843 Ga0068860_100136201 Ga0068860_1001362012 218
169 3300005843 Ga0068860_100948305 Ga0068860_1009483051 218
170 3300006237 Ga0097621_100113154 Ga0097621_1001131542 218
171 3300006237 Ga0097621_100202672 Ga0097621_1002026723 218
172 3300006358 Ga0068871_100734873 Ga0068871_1007348731 218
173 3300006358 Ga0068871_100954215 Ga0068871_1009542152 218
174 3300006852 Ga0075433_10088432 Ga0075433_100884324 218
175 3300006852 Ga0075433_10553370 Ga0075433_105533701 218
176 3300006871 Ga0075434_100043778 Ga0075434_1000437783 218
177 3300006871 Ga0075434_100076062 Ga0075434_1000760623 218
178 3300006871 Ga0075434_100550305 Ga0075434_1005503052 218
179 3300006914 Ga0075436_100051161 Ga0075436_1000511612 218
180 3300006914 Ga0075436_100077583 Ga0075436_1000775832 218
181 3300006931 Ga0097620_100003211 Ga0097620_10000321110 218
182 3300006931 Ga0097620_100011281 Ga0097620_1000112818 218
183 3300006931 Ga0097620_100337584 Ga0097620_1003375842 218
184 3300006931 Ga0097620_100375006 Ga0097620_1003750062 218
185 3300007076 Ga0075435_100179359 Ga0075435_1001793592 218
186 3300009094 Ga0111539_10656941 Ga0111539_106569412 218
187 3300009101 Ga0105247_10029100 Ga0105247_100291002 218
188 3300009147 Ga0114129_10040282 Ga0114129_100402826 218
189 3300009147 Ga0114129_10232542 Ga0114129_102325424 218
190 3300009147 Ga0114129_10286053 Ga0114129_102860532 218
191 3300009147 Ga0114129_10994261 Ga0114129_109942612 218
192 3300009148 Ga0105243_10086069 Ga0105243_100860692 218
193 3300009174 Ga0105241_10161705 Ga0105241_101617052 218
194 3300009176 Ga0105242_10068611 Ga0105242_100686114 218
195 3300009177 Ga0105248_10003342 Ga0105248_100033425 218
196 3300009177 Ga0105248_10068677 Ga0105248_100686775 218
197 3300009177 Ga0105248_10492137 Ga0105248_104921372 218
198 3300009551 Ga0105238_10306443 Ga0105238_103064432 218
199 3300010375 Ga0105239_10005799 Ga0105239_100057995 218
200 3300013100 Ga0157373_10503929 Ga0157373_105039292 218
201 3300013102 Ga0157371_10128808 Ga0157371_101288082 218
202 3300013296 Ga0157374_10015332 Ga0157374_100153322 218
203 3300013297 Ga0157378_10382353 Ga0157378_103823531 218
204 3300013306 Ga0163162_10152017 Ga0163162_101520173 218
205 3300013308 Ga0157375_10435420 Ga0157375_104354203 218
206 3300014325 Ga0163163_10292464 Ga0163163_102924642 218
207 3300014326 Ga0157380_10164236 Ga0157380_101642363 218
208 3300014326 Ga0157380_10202146 Ga0157380_102021463 218
209 3300014968 Ga0157379_10430855 Ga0157379_104308552 218
210 3300025315 Ga0207697_10001865 Ga0207697_100018656 218
211 3300025898 Ga0207692_10358108 Ga0207692_103581082 218
212 3300025901 Ga0207688_10025519 Ga0207688_100255193 218
213 3300025907 Ga0207645_10003342 Ga0207645_100033428 218
214 3300025909 Ga0207705_10312884 Ga0207705_103128841 218
215 3300025910 Ga0207684_10000047 Ga0207684_1000004728 218
216 3300025910 Ga0207684_10065798 Ga0207684_100657982 218
217 3300025910 Ga0207684_10114425 Ga0207684_101144252 218
218 3300025911 Ga0207654_10182991 Ga0207654_101829912 218
219 3300025912 Ga0207707_10024166 Ga0207707_100241667 218
220 3300025912 Ga0207707_10099375 Ga0207707_100993753 218
221 3300025917 Ga0207660_10026080 Ga0207660_100260805 218
222 3300025918 Ga0207662_10069376 Ga0207662_100693763 218
223 3300025918 Ga0207662_10101118 Ga0207662_101011183 218
224 3300025919 Ga0207657_10006391 Ga0207657_100063915 218
225 3300025920 Ga0207649_10428751 Ga0207649_104287512 218
226 3300025921 Ga0207652_10137516 Ga0207652_101375163 218
227 3300025921 Ga0207652_10880910 Ga0207652_108809102 218
228 3300025923 Ga0207681_10281934 Ga0207681_102819343 218
229 3300025925 Ga0207650_10118126 Ga0207650_101181262 218
230 3300025925 Ga0207650_10145519 Ga0207650_101455193 218
231 3300025925 Ga0207650_10900898 Ga0207650_109008981 218
232 3300025926 Ga0207659_10016717 Ga0207659_100167174 218
233 3300025927 Ga0207687_10285084 Ga0207687_102850842 218
234 3300025931 Ga0207644_10289659 Ga0207644_102896592 218
235 3300025933 Ga0207706_10000999 Ga0207706_1000099910 218
236 3300025936 Ga0207670_10168404 Ga0207670_101684043 218
237 3300025937 Ga0207669_10039910 Ga0207669_100399104 218
238 3300025940 Ga0207691_10026915 Ga0207691_100269156 218
239 3300025941 Ga0207711_10006529 Ga0207711_100065296 218
240 3300025941 Ga0207711_10024065 Ga0207711_100240655 218
241 3300025941 Ga0207711_10387797 Ga0207711_103877972 218
242 3300025945 Ga0207679_10159281 Ga0207679_101592813 218
243 3300025949 Ga0207667_10090835 Ga0207667_100908354 218
244 3300025961 Ga0207712_10065753 Ga0207712_100657532 218
245 3300025972 Ga0207668_10149582 Ga0207668_101495822 218
246 3300025986 Ga0207658_10029639 Ga0207658_100296392 218
247 3300026041 Ga0207639_10054879 Ga0207639_100548793 218
248 3300026075 Ga0207708_10001354 Ga0207708_1000135410 218
249 3300026078 Ga0207702_10015704 Ga0207702_100157046 218
250 3300026078 Ga0207702_10250191 Ga0207702_102501912 218
251 3300026078 Ga0207702_10271940 Ga0207702_102719402 218
252 3300026088 Ga0207641_10026966 Ga0207641_100269662 218
253 3300026088 Ga0207641_10285135 Ga0207641_102851352 218
254 3300026121 Ga0207683_10001033 Ga0207683_1000103319 218
255 3300028379 Ga0268266_10000001 Ga0268266_100000011234 218
256 3300028379 Ga0268266_10200070 Ga0268266_102000702 218
257 3300028381 Ga0268264_10634311 Ga0268264_106343112 218
258 3300032004 Ga0307414_10054546 Ga0307414_100545462 218
259 3300035170 Ga0373943_0272119 Ga0373943_0272119_161_820 218
260 3300035695 Ga0373927_0199735 Ga0373927_0199735_441_1100 218
261 3300036647 Ga0316582_0407436 Ga0316582_0407436_93_749 218
262 3300037312 Ga0395899_0023366 Ga0395899_0023366_1283_1939 218
263 3300037418 Ga0395900_0009078 Ga0395900_0009078_4132_4788 218
264 3300037418 Ga0395900_0037872 Ga0395900_0037872_462_1118 218
265 3300037466 Ga0395898_0025330 Ga0395898_0025330_3042_3698 218
266 3300037466 Ga0395898_0079967 Ga0395898_0079967_620_1276 218
267 3300038443 Ga0395901_0000661 Ga0395901_0000661_5972_6628 218
268 3300038726 Ga0400490_01349 Ga0400490_01349_20346_21002 218
269 3300038727 Ga0400491_23637 Ga0400491_23637_761_1417 218
270 3300041997 Ga0439431_0036991 Ga0439431_0036991_34_690 218
271 3300042004 Ga0439445_0022484 Ga0439445_0022484_153_809 218
272 3300042012 Ga0439455_0025081 Ga0439455_0025081_24_680 218
273 3300042013 Ga0439456_001258 Ga0439456_001258_3876_4532 218
274 3300042532 Ga0450893_0001057 Ga0450893_0001057_912_1568 218
275 3300044672 Ga0466982_0070688 Ga0466982_0070688_459_1121 218
276 3300045051 Ga0451576_0154077 Ga0451576_0154077_225_881 218
277 3300046472 Ga0495580_0249769 Ga0495580_0249769_536_1195 218
278 3300046491 Ga0495584_0021451 Ga0495584_0021451_140_799 218
279 3300046512 Ga0495610_0001388 Ga0495610_0001388_5642_6304 218
280 3300046543 Ga0495645_0034067 Ga0495645_0034067_1331_2005 218
281 3300046678 Ga0495599_0034710 Ga0495599_0034710_1198_1872 218
282 3300046691 Ga0495670_0019872 Ga0495670_0019872_974_1636 218
283 3300046809 Ga0495600_0008252 Ga0495600_0008252_1097_1771 218
284 3300048903 Ga0496100_0048603 Ga0496100_0048603_1314_1979 218
285 3300048903 Ga0496100_0058291 Ga0496100_0058291_907_1563 218
286 3300048904 Ga0496101_0029439 Ga0496101_0029439_455_1129 218
287 3300048905 Ga0496102_0144902 Ga0496102_0144902_45_701 218
288 3300048905 Ga0496102_0343273 Ga0496102_0343273_51_707 218
289 3300048905 Ga0496102_0795960 Ga0496102_0795960_178_834 218
290 3300048909 Ga0496106_0060327 Ga0496106_0060327_615_1271 218
291 3300048909 Ga0496106_0065427 Ga0496106_0065427_1551_2207 218
292 3300048912 Ga0496109_0236952 Ga0496109_0236952_22_678 218
293 3300048915 Ga0496112_0230108 Ga0496112_0230108_630_1286 218
294 3300048915 Ga0496112_0842238 Ga0496112_0842238_67_723 218
295 3300049741 Ga0501079_0373797 Ga0501079_0373797_385_1041 218
296 3300050494 nmdc:mga06z11_38808_c1 nmdc:mga06z11_38808_c1_888_1550 218
297 3300050507 nmdc:mga05p37_57615_c1 nmdc:mga05p37_57615_c1_3372_4028 218
298 3300050512 nmdc:mga0n895_261771_c1 nmdc:mga0n895_261771_c1_804_1460 218
299 3300050512 nmdc:mga0n895_419704_c1 nmdc:mga0n895_419704_c1_274_930 218
300 3300050513 nmdc:mga0rr50_328873_c1 nmdc:mga0rr50_328873_c1_467_1123 218
301 3300050514 nmdc:mga08x19_10974_c1 nmdc:mga08x19_10974_c1_169_825 218
302 3300050514 nmdc:mga08x19_154564_c1 nmdc:mga08x19_154564_c1_654_1310 218
303 3300050515 nmdc:mga0a205_115998_c1 nmdc:mga0a205_115998_c1_1826_2482 218
304 3300050515 nmdc:mga0a205_664806_c1 nmdc:mga0a205_664806_c1_127_783 218
305 3300003203 JGI25406J46586_10021329 JGI25406J46586_100213292 219
306 3300005985 Ga0081539_10000369 Ga0081539_1000036923 219
307 3300025917 Ga0207660_10214179 Ga0207660_102141793 219

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xvq-assembly2.cif.gz_B crystal structure of monkey nicotinamide n-methyltransferase (nnmt) bound with end product, 1-methyl nicotinamide (mna) 0.6978 146 176
7ble-assembly1.cif.gz_A co-crystal structure of human nicotinamide n-methyltransferase (nnmt) with the tricyclic inhibitor (3) 0.6793 146 176
6chh-assembly1.cif.gz_D structure of human nnmt in complex with bisubstrate inhibitor ms2756 0.6754 146 176
7nbj-assembly3.cif.gz_C co-crystal structure of human nicotinamide n-methyltransferase (nnmt) with the bisubstrate-like inhibitor (1) 0.675 146 176
6chh-assembly1.cif.gz_C structure of human nnmt in complex with bisubstrate inhibitor ms2756 0.6743 146 176
ID Description Score Start End Superfamily
af_Q9SZY5_29_117_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.814 11 36 2.60.40.1120
af_Q58952_4_249_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7333 146 176 3.40.50.150
af_I1JPT8_30_125_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.72 11 36 2.60.40.1120
af_Q9AV31_37_132_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.7129 12 36 2.60.40.1120
3a27A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7049 146 176 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A0M2H6K7-F1-model_v4 Contractile injection system tube protein N-terminal domain-containing protein 0.9479 7 218
AF-A0A419A4L8-F1-model_v4 Uncharacterized protein 0.9473 12 210
AF-A0A3D9U6F7-F1-model_v4 deleted 0.9464 7 218
AF-A0A7W7XGP1-F1-model_v4 Uncharacterized protein 0.9456 7 218
AF-A0A023XMJ8-F1-model_v4 deleted 0.9438 18 219

Feature Viewer

pLDDT pTM Quality
86.16 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map