F399059
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 307 | 213 | 302 | 217 |
Family's Representative Sequence
| Representative Sequence | 3300005458|Ga0070681_10017907|Ga0070681_100179077 |
| Length | 240 |
| Sequence | MPSIHSAARFWIVHECSEPKNFMTTFPNSPRVLKGGLVLIDPDSSAVQRIIVLQYNPDTLTRSLQPQTVKESGDRSEAMRLTGPPVETIKLDAEIDATDQLEFPDQNSTAVEFGIQPQLAALETIVYPTSSQLLSNNSLAQAGMLEILPMMAALPLFVWSKSRVVPVRVTDFSVTEEAFDPALNPIRAKVSLGMRVLSVTDLGFDNKGGSLFMAYQQQKEQLASKSLGGALSLLGIRGIP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 2 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 3 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 4 | 2904699407 | |||
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 66 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 67 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 68 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 69 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 74 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 75 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 76 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 77 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 80 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 142 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 143 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 144 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 145 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 146 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 147 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 148 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 149 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 150 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 151 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 152 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 153 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 154 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 155 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 156 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 157 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 158 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 159 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 160 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 161 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 162 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 163 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 164 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 165 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 166 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 167 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 168 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 169 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 170 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 171 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 172 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 186 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 187 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 188 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 189 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 190 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 191 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 192 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 193 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 194 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 197 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 198 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 200 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 201 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 202 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 203 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 204 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 205 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 206 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 207 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 208 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 209 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 210 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 211 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 212 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 213 | 8002775197 | Frankia nepalensis CN7 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.69 |
| Metatranscriptomes | 0 |
| Isolates | 1.31 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.58 |
| Nodule | 0.33 |
| Rhizoplane | 4.56 |
| Rhizosphere | 88.93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.61 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10021329 | 3300003203 | Bacteria | 2602 |
| 2 | rootL2_10222238 | 3300003322 | Unclassified | 2420 |
| 3 | Ga0065712_10110563 | 3300005290 | Bacteria | 1827 |
| 4 | Ga0065715_10015160 | 3300005293 | Bacteria | 2644 |
| 5 | Ga0065715_10092101 | 3300005293 | Bacteria | 5323 |
| 6 | Ga0065707_10089702 | 3300005295 | Bacteria | 4300 |
| 7 | Ga0065707_10099734 | 3300005295 | Bacteria | 2983 |
| 8 | Ga0070658_10263892 | 3300005327 | Bacteria | 1463 |
| 9 | Ga0070676_10011428 | 3300005328 | Bacteria | 4828 |
| 10 | Ga0070690_100001967 | 3300005330 | Bacteria | 10937 |
| 11 | Ga0070670_100018852 | 3300005331 | Bacteria | 5917 |
| 12 | Ga0070670_100024070 | 3300005331 | Bacteria | 5238 |
| 13 | Ga0070677_10106439 | 3300005333 | Bacteria | 1245 |
| 14 | Ga0068869_100040240 | 3300005334 | Bacteria | 3342 |
| 15 | Ga0070682_100026497 | 3300005337 | Bacteria | 3471 |
| 16 | Ga0068868_100032937 | 3300005338 | Bacteria | 3991 |
| 17 | Ga0070660_100106354 | 3300005339 | Bacteria | 2228 |
| 18 | Ga0070689_100054856 | 3300005340 | Bacteria | 3086 |
| 19 | Ga0070691_10094085 | 3300005341 | Bacteria | 1481 |
| 20 | Ga0070687_100055075 | 3300005343 | Bacteria | 2075 |
| 21 | Ga0070687_100191693 | 3300005343 | Bacteria | 1232 |
| 22 | Ga0070661_100078810 | 3300005344 | Bacteria | 2430 |
| 23 | Ga0070668_100010031 | 3300005347 | Bacteria | 7020 |
| 24 | Ga0070669_100097105 | 3300005353 | Bacteria | 2217 |
| 25 | Ga0070675_100018611 | 3300005354 | Bacteria | 5529 |
| 26 | Ga0070671_100014244 | 3300005355 | Bacteria | 6421 |
| 27 | Ga0070674_100019119 | 3300005356 | Bacteria | 4346 |
| 28 | Ga0070674_100118673 | 3300005356 | Bacteria | 1955 |
| 29 | Ga0070673_100141105 | 3300005364 | Bacteria | 2032 |
| 30 | Ga0070688_100227763 | 3300005365 | Bacteria | 1317 |
| 31 | Ga0070659_100087417 | 3300005366 | Bacteria | 2495 |
| 32 | Ga0070667_100011622 | 3300005367 | Bacteria | 7279 |
| 33 | Ga0070667_100019678 | 3300005367 | Bacteria | 5600 |
| 34 | Ga0070667_100421326 | 3300005367 | Bacteria | 1217 |
| 35 | Ga0070710_10420109 | 3300005437 | Bacteria | 900 |
| 36 | Ga0070705_100018482 | 3300005440 | Bacteria | 3655 |
| 37 | Ga0070700_100000193 | 3300005441 | Bacteria | 34477 |
| 38 | Ga0070700_100605091 | 3300005441 | Bacteria | 859 |
| 39 | Ga0070694_100028041 | 3300005444 | Bacteria | 3661 |
| 40 | Ga0070694_100582799 | 3300005444 | Bacteria | 899 |
| 41 | Ga0070708_100000237 | 3300005445 | Bacteria | 40825 |
| 42 | Ga0070708_100402873 | 3300005445 | Bacteria | 1290 |
| 43 | Ga0070678_100033616 | 3300005456 | Bacteria | 3562 |
| 44 | Ga0070662_100240652 | 3300005457 | Bacteria | 1451 |
| 45 | Ga0070681_10017907 | 3300005458 | Bacteria | 7081 |
| 46 | Ga0070681_10075853 | 3300005458 | Bacteria | 3322 |
| 47 | Ga0068867_100009576 | 3300005459 | Bacteria | 6830 |
| 48 | Ga0068867_100531765 | 3300005459 | Bacteria | 1015 |
| 49 | Ga0070685_10001425 | 3300005466 | Bacteria | 12551 |
| 50 | Ga0070706_100136247 | 3300005467 | Bacteria | 2292 |
| 51 | Ga0070706_100152962 | 3300005467 | Bacteria | 2154 |
| 52 | Ga0070707_100013888 | 3300005468 | Bacteria | 7543 |
| 53 | Ga0070707_100743648 | 3300005468 | Bacteria | 944 |
| 54 | Ga0070698_100015032 | 3300005471 | Bacteria | 8183 |
| 55 | Ga0070698_100229172 | 3300005471 | Unclassified | 1791 |
| 56 | Ga0070698_100355870 | 3300005471 | Bacteria | 1396 |
| 57 | Ga0070698_100593331 | 3300005471 | Bacteria | 1048 |
| 58 | Ga0070699_100132507 | 3300005518 | Bacteria | 2197 |
| 59 | Ga0070699_100155558 | 3300005518 | Unclassified | 2023 |
| 60 | Ga0070699_100228751 | 3300005518 | Bacteria | 1658 |
| 61 | Ga0070699_100267280 | 3300005518 | Bacteria | 1530 |
| 62 | Ga0070679_100062794 | 3300005530 | Bacteria | 3703 |
| 63 | Ga0070679_100183095 | 3300005530 | Bacteria | 2067 |
| 64 | Ga0070679_100727797 | 3300005530 | Bacteria | 935 |
| 65 | Ga0070697_100016236 | 3300005536 | Bacteria | 5854 |
| 66 | Ga0070697_100019531 | 3300005536 | Bacteria | 5354 |
| 67 | Ga0070697_101042943 | 3300005536 | Bacteria | 727 |
| 68 | Ga0068853_100068383 | 3300005539 | Bacteria | 3088 |
| 69 | Ga0070686_100023817 | 3300005544 | Bacteria | 3664 |
| 70 | Ga0070695_100066814 | 3300005545 | Bacteria | 2344 |
| 71 | Ga0070695_100141399 | 3300005545 | Bacteria | 1669 |
| 72 | Ga0070695_100383381 | 3300005545 | Bacteria | 1061 |
| 73 | Ga0070695_100388847 | 3300005545 | Bacteria | 1054 |
| 74 | Ga0070696_100148399 | 3300005546 | Bacteria | 1719 |
| 75 | Ga0070693_100032279 | 3300005547 | Bacteria | 2878 |
| 76 | Ga0070665_100000026 | 3300005548 | Bacteria | 365176 |
| 77 | Ga0070665_100294992 | 3300005548 | Bacteria | 1624 |
| 78 | Ga0070704_100332180 | 3300005549 | Unclassified | 1277 |
| 79 | Ga0068855_100162647 | 3300005563 | Bacteria | 2532 |
| 80 | Ga0070664_100021201 | 3300005564 | Bacteria | 5353 |
| 81 | Ga0070664_100243047 | 3300005564 | Bacteria | 1616 |
| 82 | Ga0068856_100002786 | 3300005614 | Bacteria | 17899 |
| 83 | Ga0068856_100047909 | 3300005614 | Bacteria | 4210 |
| 84 | Ga0068856_100143379 | 3300005614 | Bacteria | 2396 |
| 85 | Ga0070702_100717057 | 3300005615 | Bacteria | 764 |
| 86 | Ga0068852_100092481 | 3300005616 | Bacteria | 2709 |
| 87 | Ga0068859_100003211 | 3300005617 | Bacteria | 16645 |
| 88 | Ga0068859_100011283 | 3300005617 | Bacteria | 8991 |
| 89 | Ga0068859_100092542 | 3300005617 | Bacteria | 3075 |
| 90 | Ga0068859_100337578 | 3300005617 | Unclassified | 1601 |
| 91 | Ga0068859_100375011 | 3300005617 | Bacteria | 1518 |
| 92 | Ga0068859_100422529 | 3300005617 | Bacteria | 1429 |
| 93 | Ga0068864_100109626 | 3300005618 | Bacteria | 2458 |
| 94 | Ga0068864_100268943 | 3300005618 | Bacteria | 1588 |
| 95 | Ga0068861_100180307 | 3300005719 | Bacteria | 1758 |
| 96 | Ga0068858_100154203 | 3300005842 | Bacteria | 2161 |
| 97 | Ga0068858_100391893 | 3300005842 | Bacteria | 1334 |
| 98 | Ga0068860_100136201 | 3300005843 | Bacteria | 2358 |
| 99 | Ga0068860_100948305 | 3300005843 | Bacteria | 878 |
| 100 | Ga0081539_10000369 | 3300005985 | Bacteria | 98527 |
| 101 | Ga0075363_100065970 | 3300006048 | Bacteria | 1958 |
| 102 | Ga0075367_10052869 | 3300006178 | Bacteria | 2406 |
| 103 | Ga0075369_10045682 | 3300006186 | Bacteria | 1884 |
| 104 | Ga0075366_10015832 | 3300006195 | Bacteria | 4329 |
| 105 | Ga0097621_100113154 | 3300006237 | Bacteria | 2296 |
| 106 | Ga0097621_100202672 | 3300006237 | Bacteria | 1723 |
| 107 | Ga0075370_10009751 | 3300006353 | Bacteria | 5001 |
| 108 | Ga0068871_100734873 | 3300006358 | Bacteria | 906 |
| 109 | Ga0068871_100954215 | 3300006358 | Bacteria | 797 |
| 110 | Ga0075430_100229345 | 3300006846 | Bacteria | 1540 |
| 111 | Ga0075431_100206621 | 3300006847 | Bacteria | 2007 |
| 112 | Ga0075433_10088432 | 3300006852 | Bacteria | 2737 |
| 113 | Ga0075433_10553370 | 3300006852 | Bacteria | 1011 |
| 114 | Ga0075434_100043778 | 3300006871 | Bacteria | 4440 |
| 115 | Ga0075434_100076062 | 3300006871 | Unclassified | 3352 |
| 116 | Ga0075434_100550305 | 3300006871 | Bacteria | 1174 |
| 117 | Ga0075436_100051161 | 3300006914 | Viruses | 2851 |
| 118 | Ga0075436_100077583 | 3300006914 | Bacteria | 2301 |
| 119 | Ga0097620_100003211 | 3300006931 | Bacteria | 16645 |
| 120 | Ga0097620_100011281 | 3300006931 | Bacteria | 8991 |
| 121 | Ga0097620_100092542 | 3300006931 | Bacteria | 3075 |
| 122 | Ga0097620_100337584 | 3300006931 | Unclassified | 1601 |
| 123 | Ga0097620_100375006 | 3300006931 | Bacteria | 1518 |
| 124 | Ga0075435_100179359 | 3300007076 | Bacteria | 1790 |
| 125 | Ga0111539_10106649 | 3300009094 | Bacteria | 3287 |
| 126 | Ga0111539_10656941 | 3300009094 | Bacteria | 1221 |
| 127 | Ga0105245_10169148 | 3300009098 | Bacteria | 2080 |
| 128 | Ga0105247_10029100 | 3300009101 | Unclassified | 3346 |
| 129 | Ga0114129_10040282 | 3300009147 | Bacteria | 6586 |
| 130 | Ga0114129_10232542 | 3300009147 | Bacteria | 2482 |
| 131 | Ga0114129_10286053 | 3300009147 | Bacteria | 2201 |
| 132 | Ga0114129_10994261 | 3300009147 | Bacteria | 1057 |
| 133 | Ga0105243_10086069 | 3300009148 | Bacteria | 2577 |
| 134 | Ga0105243_11027828 | 3300009148 | Bacteria | 828 |
| 135 | Ga0105241_10161705 | 3300009174 | Bacteria | 1841 |
| 136 | Ga0105241_10167428 | 3300009174 | Bacteria | 1812 |
| 137 | Ga0105242_10009255 | 3300009176 | Bacteria | 7560 |
| 138 | Ga0105242_10068611 | 3300009176 | Bacteria | 2934 |
| 139 | Ga0105248_10003342 | 3300009177 | Bacteria | 17833 |
| 140 | Ga0105248_10068677 | 3300009177 | Bacteria | 3979 |
| 141 | Ga0105248_10492137 | 3300009177 | Bacteria | 1382 |
| 142 | Ga0105238_10306443 | 3300009551 | Bacteria | 1572 |
| 143 | Ga0105249_10082247 | 3300009553 | Bacteria | 2996 |
| 144 | Ga0105239_10005799 | 3300010375 | Bacteria | 14408 |
| 145 | Ga0105246_10020900 | 3300011119 | Bacteria | 4204 |
| 146 | Ga0157373_10503929 | 3300013100 | Bacteria | 875 |
| 147 | Ga0157371_10128808 | 3300013102 | Bacteria | 1800 |
| 148 | Ga0157374_10015332 | 3300013296 | Bacteria | 6722 |
| 149 | Ga0157378_10381522 | 3300013297 | Bacteria | 1384 |
| 150 | Ga0157378_10382353 | 3300013297 | Bacteria | 1383 |
| 151 | Ga0163162_10152017 | 3300013306 | Bacteria | 2433 |
| 152 | Ga0163162_10269127 | 3300013306 | Bacteria | 1835 |
| 153 | Ga0163162_10934275 | 3300013306 | Bacteria | 979 |
| 154 | Ga0157372_10133332 | 3300013307 | Bacteria | 2860 |
| 155 | Ga0157375_10435420 | 3300013308 | Bacteria | 1477 |
| 156 | Ga0163163_10292464 | 3300014325 | Unclassified | 1681 |
| 157 | Ga0157380_10089873 | 3300014326 | Unclassified | 2532 |
| 158 | Ga0157380_10164236 | 3300014326 | Bacteria | 1933 |
| 159 | Ga0157380_10202146 | 3300014326 | Bacteria | 1764 |
| 160 | Ga0157379_10430855 | 3300014968 | Bacteria | 1215 |
| 161 | Ga0207697_10001865 | 3300025315 | Bacteria | 11253 |
| 162 | Ga0207692_10358108 | 3300025898 | Bacteria | 901 |
| 163 | Ga0207688_10025519 | 3300025901 | Bacteria | 3245 |
| 164 | Ga0207645_10003342 | 3300025907 | Bacteria | 12230 |
| 165 | Ga0207705_10312884 | 3300025909 | Bacteria | 1206 |
| 166 | Ga0207684_10000047 | 3300025910 | Bacteria | 244386 |
| 167 | Ga0207684_10065798 | 3300025910 | Unclassified | 3078 |
| 168 | Ga0207684_10114425 | 3300025910 | Bacteria | 2310 |
| 169 | Ga0207654_10182991 | 3300025911 | Bacteria | 1368 |
| 170 | Ga0207707_10024166 | 3300025912 | Bacteria | 5316 |
| 171 | Ga0207707_10099375 | 3300025912 | Bacteria | 2543 |
| 172 | Ga0207660_10026080 | 3300025917 | Bacteria | 3976 |
| 173 | Ga0207660_10214179 | 3300025917 | Bacteria | 1510 |
| 174 | Ga0207662_10069376 | 3300025918 | Bacteria | 2130 |
| 175 | Ga0207662_10101118 | 3300025918 | Bacteria | 1786 |
| 176 | Ga0207657_10006391 | 3300025919 | Bacteria | 12237 |
| 177 | Ga0207649_10428751 | 3300025920 | Bacteria | 994 |
| 178 | Ga0207652_10137516 | 3300025921 | Bacteria | 2183 |
| 179 | Ga0207652_10161534 | 3300025921 | Bacteria | 2009 |
| 180 | Ga0207652_10880910 | 3300025921 | Bacteria | 792 |
| 181 | Ga0207681_10281934 | 3300025923 | Bacteria | 1308 |
| 182 | Ga0207650_10118126 | 3300025925 | Bacteria | 2061 |
| 183 | Ga0207650_10145519 | 3300025925 | Bacteria | 1866 |
| 184 | Ga0207650_10900898 | 3300025925 | Unclassified | 751 |
| 185 | Ga0207659_10016717 | 3300025926 | Bacteria | 4781 |
| 186 | Ga0207687_10285084 | 3300025927 | Bacteria | 1325 |
| 187 | Ga0207644_10289659 | 3300025931 | Bacteria | 1316 |
| 188 | Ga0207706_10000999 | 3300025933 | Bacteria | 28802 |
| 189 | Ga0207706_10013511 | 3300025933 | Bacteria | 7421 |
| 190 | Ga0207686_10006472 | 3300025934 | Bacteria | 6305 |
| 191 | Ga0207670_10061360 | 3300025936 | Bacteria | 2566 |
| 192 | Ga0207670_10168404 | 3300025936 | Bacteria | 1641 |
| 193 | Ga0207669_10039910 | 3300025937 | Bacteria | 2718 |
| 194 | Ga0207669_10085466 | 3300025937 | Bacteria | 2037 |
| 195 | Ga0207691_10026915 | 3300025940 | Bacteria | 5395 |
| 196 | Ga0207711_10006529 | 3300025941 | Bacteria | 9818 |
| 197 | Ga0207711_10024065 | 3300025941 | Bacteria | 5097 |
| 198 | Ga0207711_10387797 | 3300025941 | Bacteria | 1297 |
| 199 | Ga0207661_10285213 | 3300025944 | Unclassified | 1477 |
| 200 | Ga0207679_10159281 | 3300025945 | Bacteria | 1846 |
| 201 | Ga0207667_10090835 | 3300025949 | Bacteria | 3156 |
| 202 | Ga0207712_10065753 | 3300025961 | Bacteria | 2589 |
| 203 | Ga0207668_10149582 | 3300025972 | Bacteria | 1806 |
| 204 | Ga0207658_10029639 | 3300025986 | Bacteria | 3868 |
| 205 | Ga0207639_10054879 | 3300026041 | Bacteria | 3047 |
| 206 | Ga0207708_10001354 | 3300026075 | Bacteria | 18401 |
| 207 | Ga0207702_10015704 | 3300026078 | Bacteria | 6270 |
| 208 | Ga0207702_10250191 | 3300026078 | Bacteria | 1664 |
| 209 | Ga0207702_10271940 | 3300026078 | Bacteria | 1598 |
| 210 | Ga0207641_10026966 | 3300026088 | Bacteria | 4745 |
| 211 | Ga0207641_10285135 | 3300026088 | Bacteria | 1555 |
| 212 | Ga0207648_10013672 | 3300026089 | Bacteria | 7536 |
| 213 | Ga0207676_10049918 | 3300026095 | Bacteria | 3259 |
| 214 | Ga0207683_10001033 | 3300026121 | Bacteria | 25396 |
| 215 | Ga0268266_10000001 | 3300028379 | Bacteria | 4040580 |
| 216 | Ga0268266_10200070 | 3300028379 | Bacteria | 1828 |
| 217 | Ga0268264_10634311 | 3300028381 | Bacteria | 1056 |
| 218 | Ga0307408_100001408 | 3300031548 | Bacteria | 17895 |
| 219 | Ga0316578_10419148 | 3300031728 | Unclassified | 793 |
| 220 | Ga0307410_10031202 | 3300031852 | Bacteria | 3417 |
| 221 | Ga0307407_10044655 | 3300031903 | Bacteria | 2499 |
| 222 | Ga0307412_10014583 | 3300031911 | Bacteria | 4639 |
| 223 | Ga0307409_100169989 | 3300031995 | Bacteria | 1917 |
| 224 | Ga0307416_100007919 | 3300032002 | Bacteria | 6803 |
| 225 | Ga0307414_10054546 | 3300032004 | Bacteria | 2794 |
| 226 | Ga0307414_10353362 | 3300032004 | Unclassified | 1262 |
| 227 | Ga0307415_100024702 | 3300032126 | Bacteria | 3758 |
| 228 | Ga0307415_100881770 | 3300032126 | Bacteria | 823 |
| 229 | Ga0373943_0272119 | 3300035170 | Bacteria | 956 |
| 230 | Ga0373927_0199735 | 3300035695 | Bacteria | 1313 |
| 231 | Ga0316582_0407436 | 3300036647 | Bacteria | 937 |
| 232 | Ga0395899_0023366 | 3300037312 | Bacteria | 4683 |
| 233 | Ga0395900_0009078 | 3300037418 | Bacteria | 10191 |
| 234 | Ga0395900_0037872 | 3300037418 | Bacteria | 4972 |
| 235 | Ga0395898_0025330 | 3300037466 | Bacteria | 5979 |
| 236 | Ga0395898_0079967 | 3300037466 | Unclassified | 3153 |
| 237 | Ga0395905_0282507 | 3300037471 | Bacteria | 1546 |
| 238 | Ga0395901_0000661 | 3300038443 | Bacteria | 39682 |
| 239 | Ga0400490_01349 | 3300038726 | Bacteria | 82659 |
| 240 | Ga0400491_23637 | 3300038727 | Bacteria | 3282 |
| 241 | Ga0400485_13440 | 3300038735 | Bacteria | 14764 |
| 242 | Ga0400486_21167 | 3300038742 | Bacteria | 32156 |
| 243 | Ga0439431_0036991 | 3300041997 | Unclassified | 1231 |
| 244 | Ga0439445_0022484 | 3300042004 | Unclassified | 1590 |
| 245 | Ga0439455_0025081 | 3300042012 | Bacteria | 1447 |
| 246 | Ga0439456_001258 | 3300042013 | Bacteria | 5042 |
| 247 | Ga0450911_000004 | 3300042115 | Bacteria | 234537 |
| 248 | Ga0439459_0003978 | 3300042438 | Bacteria | 2367 |
| 249 | Ga0450893_0001057 | 3300042532 | Bacteria | 4146 |
| 250 | Ga0466982_0070688 | 3300044672 | Bacteria | 2155 |
| 251 | Ga0453684_0005526 | 3300044712 | Bacteria | 24950 |
| 252 | Ga0451576_0154077 | 3300045051 | Bacteria | 2397 |
| 253 | Ga0495580_0249769 | 3300046472 | Bacteria | 1215 |
| 254 | Ga0495664_0213771 | 3300046477 | Unclassified | 1168 |
| 255 | Ga0495584_0021451 | 3300046491 | Bacteria | 3281 |
| 256 | Ga0495610_0001388 | 3300046512 | Bacteria | 21515 |
| 257 | Ga0495632_0000570 | 3300046519 | Bacteria | 34221 |
| 258 | Ga0495645_0034067 | 3300046543 | Bacteria | 3716 |
| 259 | Ga0495633_0001385 | 3300046558 | Bacteria | 18920 |
| 260 | Ga0495635_0278354 | 3300046663 | Unclassified | 1124 |
| 261 | Ga0495599_0034710 | 3300046678 | Bacteria | 3168 |
| 262 | Ga0495670_0019872 | 3300046691 | Bacteria | 3310 |
| 263 | Ga0495600_0008252 | 3300046809 | Bacteria | 6394 |
| 264 | Ga0495680_0407299 | 3300047322 | Unclassified | 938 |
| 265 | Ga0495686_0001590 | 3300047472 | Bacteria | 23978 |
| 266 | Ga0496100_0048603 | 3300048903 | Bacteria | 2739 |
| 267 | Ga0496100_0058291 | 3300048903 | Bacteria | 2534 |
| 268 | Ga0496101_0029439 | 3300048904 | Bacteria | 3841 |
| 269 | Ga0496102_0144902 | 3300048905 | Bacteria | 2229 |
| 270 | Ga0496102_0343273 | 3300048905 | Bacteria | 1406 |
| 271 | Ga0496102_0795960 | 3300048905 | Bacteria | 868 |
| 272 | Ga0496104_0250654 | 3300048907 | Bacteria | 1683 |
| 273 | Ga0496106_0060327 | 3300048909 | Bacteria | 2875 |
| 274 | Ga0496106_0065427 | 3300048909 | Bacteria | 2768 |
| 275 | Ga0496109_0236952 | 3300048912 | Bacteria | 1717 |
| 276 | Ga0496112_0230108 | 3300048915 | Bacteria | 1808 |
| 277 | Ga0496112_0842238 | 3300048915 | Bacteria | 841 |
| 278 | Ga0496114_0228252 | 3300048917 | Bacteria | 1635 |
| 279 | Ga0496115_0012582 | 3300048918 | Bacteria | 6375 |
| 280 | Ga0501031_0485018 | 3300049568 | Bacteria | 798 |
| 281 | Ga0501038_0267785 | 3300049574 | Bacteria | 1348 |
| 282 | Ga0501252_016728 | 3300049682 | Unclassified | 926 |
| 283 | Ga0501221_090669 | 3300049704 | Unclassified | 747 |
| 284 | Ga0501079_0373797 | 3300049741 | Bacteria | 1117 |
| 285 | Ga0501226_000003 | 3300049853 | Bacteria | 358977 |
| 286 | nmdc:mga0k408_16234_c1 | 3300050493 | Bacteria | 4129 |
| 287 | nmdc:mga06z11_38808_c1 | 3300050494 | Unclassified | 2366 |
| 288 | nmdc:mga07m45_58073_c1 | 3300050496 | Bacteria | 2189 |
| 289 | nmdc:mga05p37_57615_c1 | 3300050507 | Bacteria | 4785 |
| 290 | nmdc:mga0qj67_283269_c1 | 3300050509 | Unclassified | 1343 |
| 291 | nmdc:mga06r32_120822_c1 | 3300050510 | Bacteria | 2584 |
| 292 | nmdc:mga0n895_261771_c1 | 3300050512 | Bacteria | 1755 |
| 293 | nmdc:mga0n895_419704_c1 | 3300050512 | Unclassified | 1352 |
| 294 | nmdc:mga0rr50_328873_c1 | 3300050513 | Bacteria | 1283 |
| 295 | nmdc:mga08x19_10974_c1 | 3300050514 | Bacteria | 5450 |
| 296 | nmdc:mga08x19_154564_c1 | 3300050514 | Bacteria | 1555 |
| 297 | nmdc:mga0a205_115998_c1 | 3300050515 | Bacteria | 2577 |
| 298 | nmdc:mga0a205_664806_c1 | 3300050515 | Bacteria | 893 |
| 299 | nmdc:mga0a205_675956_c1 | 3300050515 | Bacteria | 883 |
| 300 | nmdc:mga0sz30_40046_c1 | 3300050516 | Bacteria | 1968 |
| 301 | Ga0500651_0026145 | 3300053093 | Bacteria | 3666 |
| 302 | Ga0500586_000060 | 3300053145 | Bacteria | 19508 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047472 | Ga0495686_0001590 | Ga0495686_0001590_961_1620 | 193 |
| 2 | 3300050515 | nmdc:mga0a205_675956_c1 | nmdc:mga0a205_675956_c1_26_610 | 194 |
| 3 | 3300005293 | Ga0065715_10092101 | Ga0065715_100921013 | 197 |
| 4 | 3300006048 | Ga0075363_100065970 | Ga0075363_1000659702 | 197 |
| 5 | 3300006178 | Ga0075367_10052869 | Ga0075367_100528692 | 197 |
| 6 | 3300006195 | Ga0075366_10015832 | Ga0075366_100158324 | 197 |
| 7 | 3300050493 | nmdc:mga0k408_16234_c1 | nmdc:mga0k408_16234_c1_3237_3896 | 197 |
| 8 | iso_pu_bacteria | 2904699407 | 2904700856 | 199 |
| 9 | 3300005545 | Ga0070695_100141399 | Ga0070695_1001413993 | 201 |
| 10 | 3300031903 | Ga0307407_10044655 | Ga0307407_100446551 | 202 |
| 11 | 3300031911 | Ga0307412_10014583 | Ga0307412_100145835 | 202 |
| 12 | 3300032004 | Ga0307414_10353362 | Ga0307414_103533622 | 202 |
| 13 | 3300032126 | Ga0307415_100024702 | Ga0307415_1000247023 | 202 |
| 14 | 3300037471 | Ga0395905_0282507 | Ga0395905_0282507_705_1367 | 202 |
| 15 | 3300005441 | Ga0070700_100000193 | Ga0070700_10000019326 | 203 |
| 16 | 3300005468 | Ga0070707_100743648 | Ga0070707_1007436481 | 203 |
| 17 | 3300005518 | Ga0070699_100132507 | Ga0070699_1001325072 | 203 |
| 18 | 3300005530 | Ga0070679_100062794 | Ga0070679_1000627944 | 203 |
| 19 | 3300005536 | Ga0070697_100019531 | Ga0070697_1000195313 | 203 |
| 20 | 3300025921 | Ga0207652_10161534 | Ga0207652_101615342 | 203 |
| 21 | 3300046558 | Ga0495633_0001385 | Ga0495633_0001385_13951_14568 | 203 |
| 22 | 3300053145 | Ga0500586_000060 | Ga0500586_000060_5854_6471 | 203 |
| 23 | 3300005293 | Ga0065715_10015160 | Ga0065715_100151602 | 209 |
| 24 | 3300009098 | Ga0105245_10169148 | Ga0105245_101691483 | 209 |
| 25 | 3300009174 | Ga0105241_10167428 | Ga0105241_101674283 | 209 |
| 26 | 3300009553 | Ga0105249_10082247 | Ga0105249_100822472 | 209 |
| 27 | 3300011119 | Ga0105246_10020900 | Ga0105246_100209002 | 209 |
| 28 | 3300013307 | Ga0157372_10133332 | Ga0157372_101333323 | 209 |
| 29 | 3300050496 | nmdc:mga07m45_58073_c1 | nmdc:mga07m45_58073_c1_258_893 | 209 |
| 30 | 3300050516 | nmdc:mga0sz30_40046_c1 | nmdc:mga0sz30_40046_c1_366_1001 | 209 |
| 31 | 3300053093 | Ga0500651_0026145 | Ga0500651_0026145_2719_3360 | 212 |
| 32 | 3300031728 | Ga0316578_10419148 | Ga0316578_104191482 | 213 |
| 33 | 3300038742 | Ga0400486_21167 | Ga0400486_21167_4372_5013 | 213 |
| 34 | iso_pu_bacteria | 2808606373 | 2808903843 | 213 |
| 35 | iso_pu_bacteria | 8002775197 | 8002782846 | 213 |
| 36 | 3300005549 | Ga0070704_100332180 | Ga0070704_1003321801 | 214 |
| 37 | 3300014326 | Ga0157380_10089873 | Ga0157380_100898732 | 214 |
| 38 | iso_pu_bacteria | 2582581280 | 2585151741 | 214 |
| 39 | iso_pu_bacteria | 2582581293 | 2585195376 | 214 |
| 40 | 3300005343 | Ga0070687_100191693 | Ga0070687_1001916931 | 215 |
| 41 | 3300006846 | Ga0075430_100229345 | Ga0075430_1002293452 | 215 |
| 42 | 3300009148 | Ga0105243_11027828 | Ga0105243_110278281 | 215 |
| 43 | 3300038735 | Ga0400485_13440 | Ga0400485_13440_13221_13868 | 215 |
| 44 | 3300046477 | Ga0495664_0213771 | Ga0495664_0213771_158_805 | 215 |
| 45 | 3300046663 | Ga0495635_0278354 | Ga0495635_0278354_361_1008 | 215 |
| 46 | 3300047322 | Ga0495680_0407299 | Ga0495680_0407299_212_859 | 215 |
| 47 | 3300050509 | nmdc:mga0qj67_283269_c1 | nmdc:mga0qj67_283269_c1_437_1084 | 215 |
| 48 | 3300005367 | Ga0070667_100421326 | Ga0070667_1004213261 | 216 |
| 49 | 3300005467 | Ga0070706_100152962 | Ga0070706_1001529622 | 216 |
| 50 | 3300005518 | Ga0070699_100267280 | Ga0070699_1002672801 | 216 |
| 51 | 3300005564 | Ga0070664_100243047 | Ga0070664_1002430472 | 216 |
| 52 | 3300005617 | Ga0068859_100422529 | Ga0068859_1004225292 | 216 |
| 53 | 3300006186 | Ga0075369_10045682 | Ga0075369_100456823 | 216 |
| 54 | 3300006353 | Ga0075370_10009751 | Ga0075370_100097515 | 216 |
| 55 | 3300013306 | Ga0163162_10934275 | Ga0163162_109342752 | 216 |
| 56 | 3300025944 | Ga0207661_10285213 | Ga0207661_102852132 | 216 |
| 57 | 3300032126 | Ga0307415_100881770 | Ga0307415_1008817701 | 216 |
| 58 | 3300044712 | Ga0453684_0005526 | Ga0453684_0005526_2085_2741 | 216 |
| 59 | 3300049568 | Ga0501031_0485018 | Ga0501031_0485018_50_700 | 216 |
| 60 | 3300049574 | Ga0501038_0267785 | Ga0501038_0267785_631_1281 | 216 |
| 61 | 3300005295 | Ga0065707_10099734 | Ga0065707_100997343 | 217 |
| 62 | 3300005340 | Ga0070689_100054856 | Ga0070689_1000548564 | 217 |
| 63 | 3300005356 | Ga0070674_100118673 | Ga0070674_1001186733 | 217 |
| 64 | 3300005457 | Ga0070662_100240652 | Ga0070662_1002406522 | 217 |
| 65 | 3300005459 | Ga0068867_100009576 | Ga0068867_1000095764 | 217 |
| 66 | 3300005459 | Ga0068867_100531765 | Ga0068867_1005317651 | 217 |
| 67 | 3300005471 | Ga0070698_100355870 | Ga0070698_1003558703 | 217 |
| 68 | 3300005547 | Ga0070693_100032279 | Ga0070693_1000322792 | 217 |
| 69 | 3300005617 | Ga0068859_100092542 | Ga0068859_1000925422 | 217 |
| 70 | 3300006847 | Ga0075431_100206621 | Ga0075431_1002066212 | 217 |
| 71 | 3300006931 | Ga0097620_100092542 | Ga0097620_1000925422 | 217 |
| 72 | 3300009094 | Ga0111539_10106649 | Ga0111539_101066492 | 217 |
| 73 | 3300009176 | Ga0105242_10009255 | Ga0105242_100092555 | 217 |
| 74 | 3300013297 | Ga0157378_10381522 | Ga0157378_103815222 | 217 |
| 75 | 3300013306 | Ga0163162_10269127 | Ga0163162_102691272 | 217 |
| 76 | 3300025933 | Ga0207706_10013511 | Ga0207706_100135114 | 217 |
| 77 | 3300025934 | Ga0207686_10006472 | Ga0207686_100064725 | 217 |
| 78 | 3300025936 | Ga0207670_10061360 | Ga0207670_100613603 | 217 |
| 79 | 3300025937 | Ga0207669_10085466 | Ga0207669_100854663 | 217 |
| 80 | 3300026089 | Ga0207648_10013672 | Ga0207648_100136724 | 217 |
| 81 | 3300026095 | Ga0207676_10049918 | Ga0207676_100499182 | 217 |
| 82 | 3300031548 | Ga0307408_100001408 | Ga0307408_10000140816 | 217 |
| 83 | 3300031852 | Ga0307410_10031202 | Ga0307410_100312022 | 217 |
| 84 | 3300031995 | Ga0307409_100169989 | Ga0307409_1001699893 | 217 |
| 85 | 3300032002 | Ga0307416_100007919 | Ga0307416_1000079194 | 217 |
| 86 | 3300042115 | Ga0450911_000004 | Ga0450911_000004_80049_80702 | 217 |
| 87 | 3300042438 | Ga0439459_0003978 | Ga0439459_0003978_1264_1917 | 217 |
| 88 | 3300046519 | Ga0495632_0000570 | Ga0495632_0000570_18474_19127 | 217 |
| 89 | 3300048907 | Ga0496104_0250654 | Ga0496104_0250654_13_675 | 217 |
| 90 | 3300048917 | Ga0496114_0228252 | Ga0496114_0228252_734_1396 | 217 |
| 91 | 3300048918 | Ga0496115_0012582 | Ga0496115_0012582_1207_1869 | 217 |
| 92 | 3300049682 | Ga0501252_016728 | Ga0501252_016728_52_705 | 217 |
| 93 | 3300049704 | Ga0501221_090669 | Ga0501221_090669_57_710 | 217 |
| 94 | 3300049853 | Ga0501226_000003 | Ga0501226_000003_109165_109818 | 217 |
| 95 | 3300050510 | nmdc:mga06r32_120822_c1 | nmdc:mga06r32_120822_c1_1499_2152 | 217 |
| 96 | 3300003322 | rootL2_10222238 | rootL2_102222382 | 218 |
| 97 | 3300005290 | Ga0065712_10110563 | Ga0065712_101105632 | 218 |
| 98 | 3300005295 | Ga0065707_10089702 | Ga0065707_100897025 | 218 |
| 99 | 3300005327 | Ga0070658_10263892 | Ga0070658_102638922 | 218 |
| 100 | 3300005328 | Ga0070676_10011428 | Ga0070676_100114286 | 218 |
| 101 | 3300005330 | Ga0070690_100001967 | Ga0070690_1000019674 | 218 |
| 102 | 3300005331 | Ga0070670_100018852 | Ga0070670_1000188523 | 218 |
| 103 | 3300005331 | Ga0070670_100024070 | Ga0070670_1000240703 | 218 |
| 104 | 3300005333 | Ga0070677_10106439 | Ga0070677_101064391 | 218 |
| 105 | 3300005334 | Ga0068869_100040240 | Ga0068869_1000402402 | 218 |
| 106 | 3300005337 | Ga0070682_100026497 | Ga0070682_1000264974 | 218 |
| 107 | 3300005338 | Ga0068868_100032937 | Ga0068868_1000329372 | 218 |
| 108 | 3300005339 | Ga0070660_100106354 | Ga0070660_1001063543 | 218 |
| 109 | 3300005341 | Ga0070691_10094085 | Ga0070691_100940851 | 218 |
| 110 | 3300005343 | Ga0070687_100055075 | Ga0070687_1000550753 | 218 |
| 111 | 3300005344 | Ga0070661_100078810 | Ga0070661_1000788102 | 218 |
| 112 | 3300005347 | Ga0070668_100010031 | Ga0070668_1000100315 | 218 |
| 113 | 3300005353 | Ga0070669_100097105 | Ga0070669_1000971052 | 218 |
| 114 | 3300005354 | Ga0070675_100018611 | Ga0070675_1000186113 | 218 |
| 115 | 3300005355 | Ga0070671_100014244 | Ga0070671_1000142443 | 218 |
| 116 | 3300005356 | Ga0070674_100019119 | Ga0070674_1000191193 | 218 |
| 117 | 3300005364 | Ga0070673_100141105 | Ga0070673_1001411052 | 218 |
| 118 | 3300005365 | Ga0070688_100227763 | Ga0070688_1002277631 | 218 |
| 119 | 3300005366 | Ga0070659_100087417 | Ga0070659_1000874172 | 218 |
| 120 | 3300005367 | Ga0070667_100011622 | Ga0070667_1000116223 | 218 |
| 121 | 3300005367 | Ga0070667_100019678 | Ga0070667_1000196787 | 218 |
| 122 | 3300005437 | Ga0070710_10420109 | Ga0070710_104201091 | 218 |
| 123 | 3300005440 | Ga0070705_100018482 | Ga0070705_1000184824 | 218 |
| 124 | 3300005441 | Ga0070700_100605091 | Ga0070700_1006050911 | 218 |
| 125 | 3300005444 | Ga0070694_100028041 | Ga0070694_1000280413 | 218 |
| 126 | 3300005444 | Ga0070694_100582799 | Ga0070694_1005827991 | 218 |
| 127 | 3300005445 | Ga0070708_100000237 | Ga0070708_10000023719 | 218 |
| 128 | 3300005445 | Ga0070708_100402873 | Ga0070708_1004028732 | 218 |
| 129 | 3300005456 | Ga0070678_100033616 | Ga0070678_1000336163 | 218 |
| 130 | 3300005458 | Ga0070681_10017907 | Ga0070681_100179077 | 218 |
| 131 | 3300005458 | Ga0070681_10075853 | Ga0070681_100758532 | 218 |
| 132 | 3300005466 | Ga0070685_10001425 | Ga0070685_100014254 | 218 |
| 133 | 3300005467 | Ga0070706_100136247 | Ga0070706_1001362472 | 218 |
| 134 | 3300005468 | Ga0070707_100013888 | Ga0070707_1000138884 | 218 |
| 135 | 3300005471 | Ga0070698_100015032 | Ga0070698_1000150323 | 218 |
| 136 | 3300005471 | Ga0070698_100229172 | Ga0070698_1002291722 | 218 |
| 137 | 3300005471 | Ga0070698_100593331 | Ga0070698_1005933311 | 218 |
| 138 | 3300005518 | Ga0070699_100155558 | Ga0070699_1001555582 | 218 |
| 139 | 3300005518 | Ga0070699_100228751 | Ga0070699_1002287513 | 218 |
| 140 | 3300005530 | Ga0070679_100183095 | Ga0070679_1001830953 | 218 |
| 141 | 3300005530 | Ga0070679_100727797 | Ga0070679_1007277972 | 218 |
| 142 | 3300005536 | Ga0070697_100016236 | Ga0070697_1000162365 | 218 |
| 143 | 3300005536 | Ga0070697_101042943 | Ga0070697_1010429431 | 218 |
| 144 | 3300005539 | Ga0068853_100068383 | Ga0068853_1000683832 | 218 |
| 145 | 3300005544 | Ga0070686_100023817 | Ga0070686_1000238174 | 218 |
| 146 | 3300005545 | Ga0070695_100066814 | Ga0070695_1000668143 | 218 |
| 147 | 3300005545 | Ga0070695_100383381 | Ga0070695_1003833811 | 218 |
| 148 | 3300005545 | Ga0070695_100388847 | Ga0070695_1003888472 | 218 |
| 149 | 3300005546 | Ga0070696_100148399 | Ga0070696_1001483993 | 218 |
| 150 | 3300005548 | Ga0070665_100000026 | Ga0070665_10000002635 | 218 |
| 151 | 3300005548 | Ga0070665_100294992 | Ga0070665_1002949922 | 218 |
| 152 | 3300005563 | Ga0068855_100162647 | Ga0068855_1001626472 | 218 |
| 153 | 3300005564 | Ga0070664_100021201 | Ga0070664_1000212012 | 218 |
| 154 | 3300005614 | Ga0068856_100002786 | Ga0068856_1000027869 | 218 |
| 155 | 3300005614 | Ga0068856_100047909 | Ga0068856_1000479092 | 218 |
| 156 | 3300005614 | Ga0068856_100143379 | Ga0068856_1001433793 | 218 |
| 157 | 3300005615 | Ga0070702_100717057 | Ga0070702_1007170571 | 218 |
| 158 | 3300005616 | Ga0068852_100092481 | Ga0068852_1000924812 | 218 |
| 159 | 3300005617 | Ga0068859_100003211 | Ga0068859_1000032117 | 218 |
| 160 | 3300005617 | Ga0068859_100011283 | Ga0068859_1000112834 | 218 |
| 161 | 3300005617 | Ga0068859_100337578 | Ga0068859_1003375782 | 218 |
| 162 | 3300005617 | Ga0068859_100375011 | Ga0068859_1003750112 | 218 |
| 163 | 3300005618 | Ga0068864_100109626 | Ga0068864_1001096262 | 218 |
| 164 | 3300005618 | Ga0068864_100268943 | Ga0068864_1002689432 | 218 |
| 165 | 3300005719 | Ga0068861_100180307 | Ga0068861_1001803072 | 218 |
| 166 | 3300005842 | Ga0068858_100154203 | Ga0068858_1001542032 | 218 |
| 167 | 3300005842 | Ga0068858_100391893 | Ga0068858_1003918932 | 218 |
| 168 | 3300005843 | Ga0068860_100136201 | Ga0068860_1001362012 | 218 |
| 169 | 3300005843 | Ga0068860_100948305 | Ga0068860_1009483051 | 218 |
| 170 | 3300006237 | Ga0097621_100113154 | Ga0097621_1001131542 | 218 |
| 171 | 3300006237 | Ga0097621_100202672 | Ga0097621_1002026723 | 218 |
| 172 | 3300006358 | Ga0068871_100734873 | Ga0068871_1007348731 | 218 |
| 173 | 3300006358 | Ga0068871_100954215 | Ga0068871_1009542152 | 218 |
| 174 | 3300006852 | Ga0075433_10088432 | Ga0075433_100884324 | 218 |
| 175 | 3300006852 | Ga0075433_10553370 | Ga0075433_105533701 | 218 |
| 176 | 3300006871 | Ga0075434_100043778 | Ga0075434_1000437783 | 218 |
| 177 | 3300006871 | Ga0075434_100076062 | Ga0075434_1000760623 | 218 |
| 178 | 3300006871 | Ga0075434_100550305 | Ga0075434_1005503052 | 218 |
| 179 | 3300006914 | Ga0075436_100051161 | Ga0075436_1000511612 | 218 |
| 180 | 3300006914 | Ga0075436_100077583 | Ga0075436_1000775832 | 218 |
| 181 | 3300006931 | Ga0097620_100003211 | Ga0097620_10000321110 | 218 |
| 182 | 3300006931 | Ga0097620_100011281 | Ga0097620_1000112818 | 218 |
| 183 | 3300006931 | Ga0097620_100337584 | Ga0097620_1003375842 | 218 |
| 184 | 3300006931 | Ga0097620_100375006 | Ga0097620_1003750062 | 218 |
| 185 | 3300007076 | Ga0075435_100179359 | Ga0075435_1001793592 | 218 |
| 186 | 3300009094 | Ga0111539_10656941 | Ga0111539_106569412 | 218 |
| 187 | 3300009101 | Ga0105247_10029100 | Ga0105247_100291002 | 218 |
| 188 | 3300009147 | Ga0114129_10040282 | Ga0114129_100402826 | 218 |
| 189 | 3300009147 | Ga0114129_10232542 | Ga0114129_102325424 | 218 |
| 190 | 3300009147 | Ga0114129_10286053 | Ga0114129_102860532 | 218 |
| 191 | 3300009147 | Ga0114129_10994261 | Ga0114129_109942612 | 218 |
| 192 | 3300009148 | Ga0105243_10086069 | Ga0105243_100860692 | 218 |
| 193 | 3300009174 | Ga0105241_10161705 | Ga0105241_101617052 | 218 |
| 194 | 3300009176 | Ga0105242_10068611 | Ga0105242_100686114 | 218 |
| 195 | 3300009177 | Ga0105248_10003342 | Ga0105248_100033425 | 218 |
| 196 | 3300009177 | Ga0105248_10068677 | Ga0105248_100686775 | 218 |
| 197 | 3300009177 | Ga0105248_10492137 | Ga0105248_104921372 | 218 |
| 198 | 3300009551 | Ga0105238_10306443 | Ga0105238_103064432 | 218 |
| 199 | 3300010375 | Ga0105239_10005799 | Ga0105239_100057995 | 218 |
| 200 | 3300013100 | Ga0157373_10503929 | Ga0157373_105039292 | 218 |
| 201 | 3300013102 | Ga0157371_10128808 | Ga0157371_101288082 | 218 |
| 202 | 3300013296 | Ga0157374_10015332 | Ga0157374_100153322 | 218 |
| 203 | 3300013297 | Ga0157378_10382353 | Ga0157378_103823531 | 218 |
| 204 | 3300013306 | Ga0163162_10152017 | Ga0163162_101520173 | 218 |
| 205 | 3300013308 | Ga0157375_10435420 | Ga0157375_104354203 | 218 |
| 206 | 3300014325 | Ga0163163_10292464 | Ga0163163_102924642 | 218 |
| 207 | 3300014326 | Ga0157380_10164236 | Ga0157380_101642363 | 218 |
| 208 | 3300014326 | Ga0157380_10202146 | Ga0157380_102021463 | 218 |
| 209 | 3300014968 | Ga0157379_10430855 | Ga0157379_104308552 | 218 |
| 210 | 3300025315 | Ga0207697_10001865 | Ga0207697_100018656 | 218 |
| 211 | 3300025898 | Ga0207692_10358108 | Ga0207692_103581082 | 218 |
| 212 | 3300025901 | Ga0207688_10025519 | Ga0207688_100255193 | 218 |
| 213 | 3300025907 | Ga0207645_10003342 | Ga0207645_100033428 | 218 |
| 214 | 3300025909 | Ga0207705_10312884 | Ga0207705_103128841 | 218 |
| 215 | 3300025910 | Ga0207684_10000047 | Ga0207684_1000004728 | 218 |
| 216 | 3300025910 | Ga0207684_10065798 | Ga0207684_100657982 | 218 |
| 217 | 3300025910 | Ga0207684_10114425 | Ga0207684_101144252 | 218 |
| 218 | 3300025911 | Ga0207654_10182991 | Ga0207654_101829912 | 218 |
| 219 | 3300025912 | Ga0207707_10024166 | Ga0207707_100241667 | 218 |
| 220 | 3300025912 | Ga0207707_10099375 | Ga0207707_100993753 | 218 |
| 221 | 3300025917 | Ga0207660_10026080 | Ga0207660_100260805 | 218 |
| 222 | 3300025918 | Ga0207662_10069376 | Ga0207662_100693763 | 218 |
| 223 | 3300025918 | Ga0207662_10101118 | Ga0207662_101011183 | 218 |
| 224 | 3300025919 | Ga0207657_10006391 | Ga0207657_100063915 | 218 |
| 225 | 3300025920 | Ga0207649_10428751 | Ga0207649_104287512 | 218 |
| 226 | 3300025921 | Ga0207652_10137516 | Ga0207652_101375163 | 218 |
| 227 | 3300025921 | Ga0207652_10880910 | Ga0207652_108809102 | 218 |
| 228 | 3300025923 | Ga0207681_10281934 | Ga0207681_102819343 | 218 |
| 229 | 3300025925 | Ga0207650_10118126 | Ga0207650_101181262 | 218 |
| 230 | 3300025925 | Ga0207650_10145519 | Ga0207650_101455193 | 218 |
| 231 | 3300025925 | Ga0207650_10900898 | Ga0207650_109008981 | 218 |
| 232 | 3300025926 | Ga0207659_10016717 | Ga0207659_100167174 | 218 |
| 233 | 3300025927 | Ga0207687_10285084 | Ga0207687_102850842 | 218 |
| 234 | 3300025931 | Ga0207644_10289659 | Ga0207644_102896592 | 218 |
| 235 | 3300025933 | Ga0207706_10000999 | Ga0207706_1000099910 | 218 |
| 236 | 3300025936 | Ga0207670_10168404 | Ga0207670_101684043 | 218 |
| 237 | 3300025937 | Ga0207669_10039910 | Ga0207669_100399104 | 218 |
| 238 | 3300025940 | Ga0207691_10026915 | Ga0207691_100269156 | 218 |
| 239 | 3300025941 | Ga0207711_10006529 | Ga0207711_100065296 | 218 |
| 240 | 3300025941 | Ga0207711_10024065 | Ga0207711_100240655 | 218 |
| 241 | 3300025941 | Ga0207711_10387797 | Ga0207711_103877972 | 218 |
| 242 | 3300025945 | Ga0207679_10159281 | Ga0207679_101592813 | 218 |
| 243 | 3300025949 | Ga0207667_10090835 | Ga0207667_100908354 | 218 |
| 244 | 3300025961 | Ga0207712_10065753 | Ga0207712_100657532 | 218 |
| 245 | 3300025972 | Ga0207668_10149582 | Ga0207668_101495822 | 218 |
| 246 | 3300025986 | Ga0207658_10029639 | Ga0207658_100296392 | 218 |
| 247 | 3300026041 | Ga0207639_10054879 | Ga0207639_100548793 | 218 |
| 248 | 3300026075 | Ga0207708_10001354 | Ga0207708_1000135410 | 218 |
| 249 | 3300026078 | Ga0207702_10015704 | Ga0207702_100157046 | 218 |
| 250 | 3300026078 | Ga0207702_10250191 | Ga0207702_102501912 | 218 |
| 251 | 3300026078 | Ga0207702_10271940 | Ga0207702_102719402 | 218 |
| 252 | 3300026088 | Ga0207641_10026966 | Ga0207641_100269662 | 218 |
| 253 | 3300026088 | Ga0207641_10285135 | Ga0207641_102851352 | 218 |
| 254 | 3300026121 | Ga0207683_10001033 | Ga0207683_1000103319 | 218 |
| 255 | 3300028379 | Ga0268266_10000001 | Ga0268266_100000011234 | 218 |
| 256 | 3300028379 | Ga0268266_10200070 | Ga0268266_102000702 | 218 |
| 257 | 3300028381 | Ga0268264_10634311 | Ga0268264_106343112 | 218 |
| 258 | 3300032004 | Ga0307414_10054546 | Ga0307414_100545462 | 218 |
| 259 | 3300035170 | Ga0373943_0272119 | Ga0373943_0272119_161_820 | 218 |
| 260 | 3300035695 | Ga0373927_0199735 | Ga0373927_0199735_441_1100 | 218 |
| 261 | 3300036647 | Ga0316582_0407436 | Ga0316582_0407436_93_749 | 218 |
| 262 | 3300037312 | Ga0395899_0023366 | Ga0395899_0023366_1283_1939 | 218 |
| 263 | 3300037418 | Ga0395900_0009078 | Ga0395900_0009078_4132_4788 | 218 |
| 264 | 3300037418 | Ga0395900_0037872 | Ga0395900_0037872_462_1118 | 218 |
| 265 | 3300037466 | Ga0395898_0025330 | Ga0395898_0025330_3042_3698 | 218 |
| 266 | 3300037466 | Ga0395898_0079967 | Ga0395898_0079967_620_1276 | 218 |
| 267 | 3300038443 | Ga0395901_0000661 | Ga0395901_0000661_5972_6628 | 218 |
| 268 | 3300038726 | Ga0400490_01349 | Ga0400490_01349_20346_21002 | 218 |
| 269 | 3300038727 | Ga0400491_23637 | Ga0400491_23637_761_1417 | 218 |
| 270 | 3300041997 | Ga0439431_0036991 | Ga0439431_0036991_34_690 | 218 |
| 271 | 3300042004 | Ga0439445_0022484 | Ga0439445_0022484_153_809 | 218 |
| 272 | 3300042012 | Ga0439455_0025081 | Ga0439455_0025081_24_680 | 218 |
| 273 | 3300042013 | Ga0439456_001258 | Ga0439456_001258_3876_4532 | 218 |
| 274 | 3300042532 | Ga0450893_0001057 | Ga0450893_0001057_912_1568 | 218 |
| 275 | 3300044672 | Ga0466982_0070688 | Ga0466982_0070688_459_1121 | 218 |
| 276 | 3300045051 | Ga0451576_0154077 | Ga0451576_0154077_225_881 | 218 |
| 277 | 3300046472 | Ga0495580_0249769 | Ga0495580_0249769_536_1195 | 218 |
| 278 | 3300046491 | Ga0495584_0021451 | Ga0495584_0021451_140_799 | 218 |
| 279 | 3300046512 | Ga0495610_0001388 | Ga0495610_0001388_5642_6304 | 218 |
| 280 | 3300046543 | Ga0495645_0034067 | Ga0495645_0034067_1331_2005 | 218 |
| 281 | 3300046678 | Ga0495599_0034710 | Ga0495599_0034710_1198_1872 | 218 |
| 282 | 3300046691 | Ga0495670_0019872 | Ga0495670_0019872_974_1636 | 218 |
| 283 | 3300046809 | Ga0495600_0008252 | Ga0495600_0008252_1097_1771 | 218 |
| 284 | 3300048903 | Ga0496100_0048603 | Ga0496100_0048603_1314_1979 | 218 |
| 285 | 3300048903 | Ga0496100_0058291 | Ga0496100_0058291_907_1563 | 218 |
| 286 | 3300048904 | Ga0496101_0029439 | Ga0496101_0029439_455_1129 | 218 |
| 287 | 3300048905 | Ga0496102_0144902 | Ga0496102_0144902_45_701 | 218 |
| 288 | 3300048905 | Ga0496102_0343273 | Ga0496102_0343273_51_707 | 218 |
| 289 | 3300048905 | Ga0496102_0795960 | Ga0496102_0795960_178_834 | 218 |
| 290 | 3300048909 | Ga0496106_0060327 | Ga0496106_0060327_615_1271 | 218 |
| 291 | 3300048909 | Ga0496106_0065427 | Ga0496106_0065427_1551_2207 | 218 |
| 292 | 3300048912 | Ga0496109_0236952 | Ga0496109_0236952_22_678 | 218 |
| 293 | 3300048915 | Ga0496112_0230108 | Ga0496112_0230108_630_1286 | 218 |
| 294 | 3300048915 | Ga0496112_0842238 | Ga0496112_0842238_67_723 | 218 |
| 295 | 3300049741 | Ga0501079_0373797 | Ga0501079_0373797_385_1041 | 218 |
| 296 | 3300050494 | nmdc:mga06z11_38808_c1 | nmdc:mga06z11_38808_c1_888_1550 | 218 |
| 297 | 3300050507 | nmdc:mga05p37_57615_c1 | nmdc:mga05p37_57615_c1_3372_4028 | 218 |
| 298 | 3300050512 | nmdc:mga0n895_261771_c1 | nmdc:mga0n895_261771_c1_804_1460 | 218 |
| 299 | 3300050512 | nmdc:mga0n895_419704_c1 | nmdc:mga0n895_419704_c1_274_930 | 218 |
| 300 | 3300050513 | nmdc:mga0rr50_328873_c1 | nmdc:mga0rr50_328873_c1_467_1123 | 218 |
| 301 | 3300050514 | nmdc:mga08x19_10974_c1 | nmdc:mga08x19_10974_c1_169_825 | 218 |
| 302 | 3300050514 | nmdc:mga08x19_154564_c1 | nmdc:mga08x19_154564_c1_654_1310 | 218 |
| 303 | 3300050515 | nmdc:mga0a205_115998_c1 | nmdc:mga0a205_115998_c1_1826_2482 | 218 |
| 304 | 3300050515 | nmdc:mga0a205_664806_c1 | nmdc:mga0a205_664806_c1_127_783 | 218 |
| 305 | 3300003203 | JGI25406J46586_10021329 | JGI25406J46586_100213292 | 219 |
| 306 | 3300005985 | Ga0081539_10000369 | Ga0081539_1000036923 | 219 |
| 307 | 3300025917 | Ga0207660_10214179 | Ga0207660_102141793 | 219 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5xvq-assembly2.cif.gz_B | crystal structure of monkey nicotinamide n-methyltransferase (nnmt) bound with end product, 1-methyl nicotinamide (mna) | 0.6978 | 146 | 176 |
| 7ble-assembly1.cif.gz_A | co-crystal structure of human nicotinamide n-methyltransferase (nnmt) with the tricyclic inhibitor (3) | 0.6793 | 146 | 176 |
| 6chh-assembly1.cif.gz_D | structure of human nnmt in complex with bisubstrate inhibitor ms2756 | 0.6754 | 146 | 176 |
| 7nbj-assembly3.cif.gz_C | co-crystal structure of human nicotinamide n-methyltransferase (nnmt) with the bisubstrate-like inhibitor (1) | 0.675 | 146 | 176 |
| 6chh-assembly1.cif.gz_C | structure of human nnmt in complex with bisubstrate inhibitor ms2756 | 0.6743 | 146 | 176 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9SZY5_29_117_2.60.40.1120 | Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain | 0.814 | 11 | 36 | 2.60.40.1120 |
| af_Q58952_4_249_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.7333 | 146 | 176 | 3.40.50.150 |
| af_I1JPT8_30_125_2.60.40.1120 | Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain | 0.72 | 11 | 36 | 2.60.40.1120 |
| af_Q9AV31_37_132_2.60.40.1120 | Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain | 0.7129 | 12 | 36 | 2.60.40.1120 |
| 3a27A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.7049 | 146 | 176 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0M2H6K7-F1-model_v4 | Contractile injection system tube protein N-terminal domain-containing protein | 0.9479 | 7 | 218 |
|
| AF-A0A419A4L8-F1-model_v4 | Uncharacterized protein | 0.9473 | 12 | 210 |
|
| AF-A0A3D9U6F7-F1-model_v4 | deleted | 0.9464 | 7 | 218 |
|
| AF-A0A7W7XGP1-F1-model_v4 | Uncharacterized protein | 0.9456 | 7 | 218 |
|
| AF-A0A023XMJ8-F1-model_v4 | deleted | 0.9438 | 18 | 219 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar