F399020

General Info

Members Datasets Scaffolds Average Seq Length
307 213 614 50

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_100249809|Ga0070669_1002498093
Length 56
Sequence MIRKLPSGKYRLYSVKKNPKTGKRRNLGTFSTRAAAVKHEQAVQFFKRGGARKRVA

Samples

Sample ID Description Type Environment
1 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
2 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
3 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
4 3300003397 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM Metagenome Rhizosphere
5 3300003405 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM Metagenome Rhizosphere
6 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
89 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
136 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
143 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
144 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
145 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
146 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
152 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
153 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
154 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
155 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
156 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
157 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
161 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
162 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
165 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
166 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
167 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
168 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
169 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
180 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
181 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
182 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
183 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
184 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
185 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
186 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
187 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
188 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
189 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
190 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
191 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
192 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
193 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
194 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
195 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
196 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
197 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
198 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
199 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
200 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
202 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
203 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
204 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
205 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
206 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
207 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
208 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
209 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
210 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
211 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
212 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
213 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.7
Metatranscriptomes 1.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.95
Nodule 0
Rhizoplane 2.61
Rhizosphere 95.11
Stem 0
Stem Tuber 0
Unclassified 18.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070669_100249809 3300005353 Bacteria 1412
2 JGI26128J50194_1005579 3300003347 Unclassified 826
3 JGI26145J50221_1017470 3300003371 Unclassified 675
4 JGI26133J50247_103670 3300003397 Unclassified 540
5 JGI26132J50249_102912 3300003405 Unclassified 614
6 JGI26141J51220_1000064 3300003503 Unclassified 4603
7 Ga0055531_10048089 3300003794 Bacteria 1154
8 Ga0065715_10202328 3300005293 Bacteria 1355
9 Ga0065707_10917662 3300005295 Bacteria 562
10 Ga0065707_11122583 3300005295 Unclassified 511
11 Ga0070676_10871407 3300005328 Bacteria 669
12 Ga0070690_101221659 3300005330 Unclassified 600
13 Ga0070680_100452290 3300005336 Bacteria 1097
14 Ga0068868_101570627 3300005338 Bacteria 617
15 Ga0070689_100260491 3300005340 Unclassified 1433
16 Ga0070689_100442282 3300005340 Unclassified 1105
17 Ga0070687_100390251 3300005343 Unclassified 910
18 Ga0070668_100308184 3300005347 Bacteria 1330
19 Ga0070669_100102210 3300005353 Bacteria 2164
20 Ga0070669_100211773 3300005353 Bacteria 1529
21 Ga0070669_100278790 3300005353 Bacteria 1339
22 Ga0070675_100357502 3300005354 Bacteria 1296
23 Ga0070688_100315050 3300005365 Unclassified 1135
24 Ga0070688_100374876 3300005365 Unclassified 1047
25 Ga0070667_100327100 3300005367 Bacteria 1384
26 Ga0070667_100763772 3300005367 Bacteria 896
27 Ga0070667_102251824 3300005367 Unclassified 513
28 Ga0070713_101460926 3300005436 Bacteria 663
29 Ga0070713_101502749 3300005436 Bacteria 653
30 Ga0070710_10866668 3300005437 Bacteria 649
31 Ga0070711_100390403 3300005439 Bacteria 1127
32 Ga0070705_100395626 3300005440 Bacteria 1022
33 Ga0070705_100460181 3300005440 Unclassified 956
34 Ga0070700_100625419 3300005441 Unclassified 847
35 Ga0070694_100173094 3300005444 Unclassified 1592
36 Ga0070694_100287756 3300005444 Bacteria 1255
37 Ga0070708_100111242 3300005445 Bacteria 2518
38 Ga0070708_101424756 3300005445 Bacteria 646
39 Ga0070681_10404842 3300005458 Bacteria 1276
40 Ga0070681_11134080 3300005458 Bacteria 703
41 Ga0068867_100144420 3300005459 Bacteria 1863
42 Ga0068867_100806946 3300005459 Bacteria 837
43 Ga0070706_100006956 3300005467 Bacteria 10670
44 Ga0070707_100490614 3300005468 Bacteria 1190
45 Ga0070698_100203699 3300005471 Bacteria 1914
46 Ga0070698_100977424 3300005471 Unclassified 793
47 Ga0070699_100031334 3300005518 Bacteria 4589
48 Ga0070699_102111959 3300005518 Bacteria 514
49 Ga0070679_100657313 3300005530 Bacteria 991
50 Ga0070697_100001388 3300005536 Bacteria 18330
51 Ga0070697_100243517 3300005536 Bacteria 1536
52 Ga0070697_100368378 3300005536 Bacteria 1243
53 Ga0070672_101120978 3300005543 Bacteria 699
54 Ga0070686_101466687 3300005544 Unclassified 574
55 Ga0070695_100003563 3300005545 Bacteria 9091
56 Ga0070695_100166109 3300005545 Bacteria 1554
57 Ga0070665_102651934 3300005548 Bacteria 501
58 Ga0070704_101306006 3300005549 Bacteria 664
59 Ga0068856_100346482 3300005614 Bacteria 1504
60 Ga0068852_102399467 3300005616 Bacteria 548
61 Ga0068859_101389871 3300005617 Unclassified 774
62 Ga0068859_102466022 3300005617 Bacteria 573
63 Ga0068866_10000015 3300005718 Bacteria 72420
64 Ga0068861_100578040 3300005719 Bacteria 1028
65 Ga0068863_100201576 3300005841 Bacteria 1914
66 Ga0068858_100047140 3300005842 Unclassified 3996
67 Ga0068858_101223545 3300005842 Bacteria 738
68 Ga0068860_101666140 3300005843 Bacteria 660
69 Ga0068862_100077595 3300005844 Unclassified 2877
70 Ga0081455_10088856 3300005937 Bacteria 2509
71 Ga0070717_10233184 3300006028 Bacteria 1621
72 Ga0075364_10020202 3300006051 Bacteria 4189
73 Ga0075366_10751715 3300006195 Bacteria 606
74 Ga0097621_100613861 3300006237 Unclassified 995
75 Ga0097621_100800040 3300006237 Bacteria 873
76 Ga0097621_100821402 3300006237 Bacteria 862
77 Ga0068871_100010388 3300006358 Bacteria 6793
78 Ga0068871_101969011 3300006358 Bacteria 556
79 Ga0075428_101940026 3300006844 Bacteria 611
80 Ga0075430_100073502 3300006846 Bacteria 2867
81 Ga0075430_100301159 3300006846 Bacteria 1326
82 Ga0075430_101219828 3300006846 Unclassified 619
83 Ga0075430_101788872 3300006846 Bacteria 504
84 Ga0075431_100091013 3300006847 Bacteria 3149
85 Ga0075431_100133878 3300006847 Unclassified 2555
86 Ga0075431_100231541 3300006847 Bacteria 1882
87 Ga0075431_100540635 3300006847 Bacteria 1153
88 Ga0075433_10323259 3300006852 Bacteria 1365
89 Ga0075434_100107461 3300006871 Bacteria 2800
90 Ga0075429_100077398 3300006880 Bacteria 2898
91 Ga0075429_100302260 3300006880 Bacteria 1401
92 Ga0068865_100413001 3300006881 Bacteria 1108
93 Ga0075436_100091410 3300006914 Bacteria 2116
94 Ga0075436_100173775 3300006914 Bacteria 1521
95 Ga0097620_101390027 3300006931 Unclassified 774
96 Ga0097620_102466406 3300006931 Bacteria 573
97 Ga0075435_100514198 3300007076 Bacteria 1036
98 Ga0075435_101952296 3300007076 Unclassified 515
99 Ga0099794_10228043 3300007265 Bacteria 958
100 Ga0105240_10000604 3300009093 Bacteria 66605
101 Ga0111539_10127699 3300009094 Bacteria 2978
102 Ga0105245_11143730 3300009098 Bacteria 825
103 Ga0105245_11533600 3300009098 Bacteria 717
104 Ga0105245_12344191 3300009098 Bacteria 587
105 Ga0114129_10027298 3300009147 Bacteria 8084
106 Ga0114129_10030717 3300009147 Bacteria 7599
107 Ga0105241_10013482 3300009174 Bacteria 5990
108 Ga0105242_10000069 3300009176 Bacteria 72563
109 Ga0105248_10451835 3300009177 Bacteria 1448
110 Ga0105248_12463398 3300009177 Bacteria 593
111 Ga0105237_11196698 3300009545 Bacteria 766
112 Ga0105238_10024252 3300009551 Bacteria 6184
113 Ga0105249_10000766 3300009553 Bacteria 28871
114 Ga0105239_10000306 3300010375 Bacteria 72563
115 Ga0105239_12627228 3300010375 Bacteria 587
116 Ga0157374_10039665 3300013296 Bacteria 4334
117 Ga0157374_11048985 3300013296 Bacteria 835
118 Ga0157378_11132743 3300013297 Bacteria 820
119 Ga0163162_10004439 3300013306 Bacteria 13506
120 Ga0157372_10127623 3300013307 Bacteria 2925
121 Ga0157375_10134871 3300013308 Bacteria 2591
122 Ga0157375_13296255 3300013308 Unclassified 538
123 Ga0163163_10194028 3300014325 Bacteria 2079
124 Ga0157380_10926072 3300014326 Bacteria 899
125 Ga0157380_11363340 3300014326 Bacteria 758
126 Ga0157379_10204440 3300014968 Bacteria 1786
127 Ga0157376_10065003 3300014969 Bacteria 3078
128 Ga0157376_12270908 3300014969 Unclassified 582
129 Ga0163161_10768826 3300017792 Unclassified 807
130 Ga0163161_11105701 3300017792 Bacteria 681
131 Ga0206353_10734278 3300020082 Bacteria 525
132 Ga0228598_1047821 3300024227 Bacteria 847
133 Ga0207692_10204010 3300025898 Bacteria 1164
134 Ga0207642_10000013 3300025899 Bacteria 72542
135 Ga0207645_10379305 3300025907 Bacteria 949
136 Ga0207684_10006421 3300025910 Bacteria 10717
137 Ga0207684_10487228 3300025910 Bacteria 1057
138 Ga0207654_10277199 3300025911 Bacteria 1133
139 Ga0207707_11254105 3300025912 Bacteria 598
140 Ga0207695_10010676 3300025913 Bacteria 11219
141 Ga0207671_11008027 3300025914 Bacteria 656
142 Ga0207693_10659311 3300025915 Unclassified 812
143 Ga0207662_11261887 3300025918 Unclassified 525
144 Ga0207646_10827674 3300025922 Bacteria 823
145 Ga0207681_10113995 3300025923 Bacteria 1971
146 Ga0207681_10359792 3300025923 Bacteria 1167
147 Ga0207681_10515905 3300025923 Bacteria 980
148 Ga0207687_10958127 3300025927 Bacteria 733
149 Ga0207644_10684553 3300025931 Bacteria 855
150 Ga0207686_10000096 3300025934 Bacteria 72574
151 Ga0207670_11811020 3300025936 Bacteria 519
152 Ga0207691_10173534 3300025940 Bacteria 1887
153 Ga0207711_11684242 3300025941 Bacteria 577
154 Ga0207711_12048291 3300025941 Bacteria 515
155 Ga0207712_10001264 3300025961 Bacteria 17408
156 Ga0207712_11573929 3300025961 Bacteria 589
157 Ga0207668_11105937 3300025972 Bacteria 710
158 Ga0207668_11550964 3300025972 Unclassified 598
159 Ga0207658_11090040 3300025986 Bacteria 729
160 Ga0207658_12092450 3300025986 Unclassified 514
161 Ga0207677_10270075 3300026023 Bacteria 1391
162 Ga0207677_11154525 3300026023 Bacteria 708
163 Ga0207703_10655737 3300026035 Unclassified 996
164 Ga0207703_12239989 3300026035 Unclassified 522
165 Ga0207708_10185957 3300026075 Bacteria 1651
166 Ga0207708_10235399 3300026075 Unclassified 1471
167 Ga0207708_11832099 3300026075 Bacteria 532
168 Ga0207641_12093726 3300026088 Unclassified 567
169 Ga0207648_10338044 3300026089 Bacteria 1355
170 Ga0207648_10468074 3300026089 Bacteria 1150
171 Ga0207676_11677762 3300026095 Bacteria 634
172 Ga0207674_10552856 3300026116 Bacteria 1112
173 Ga0207675_100119904 3300026118 Bacteria 2488
174 Ga0207675_100448161 3300026118 Bacteria 1279
175 Ga0207675_101121336 3300026118 Unclassified 807
176 Ga0209967_1031928 3300027364 Bacteria 789
177 Ga0209981_1025190 3300027378 Bacteria 860
178 Ga0209996_1004297 3300027395 Bacteria 1810
179 Ga0210000_1026799 3300027462 Bacteria 895
180 Ga0209995_1002211 3300027471 Bacteria 3059
181 Ga0209968_1005618 3300027526 Bacteria 1885
182 Ga0209999_1001883 3300027543 Bacteria 3648
183 Ga0209982_1000799 3300027552 Bacteria 4083
184 Ga0209970_1002638 3300027614 Bacteria 3032
185 Ga0210002_1032528 3300027617 Bacteria 870
186 Ga0210002_1104738 3300027617 Bacteria 513
187 Ga0209983_1000381 3300027665 Bacteria 9450
188 Ga0209971_1000291 3300027682 Bacteria 13987
189 Ga0209966_1000119 3300027695 Bacteria 35102
190 Ga0209998_10000058 3300027717 Bacteria 46200
191 Ga0209974_10001860 3300027876 Bacteria 7703
192 Ga0207428_10149295 3300027907 Bacteria 1780
193 Ga0268265_10069192 3300028380 Bacteria 2740
194 Ga0268265_10397876 3300028380 Unclassified 1272
195 Ga0307515_10030554 3300028794 Bacteria 9035
196 Ga0265762_1008616 3300030760 Bacteria 1814
197 Ga0265763_1012987 3300030763 Bacteria 802
198 Ga0265760_10257288 3300031090 Unclassified 606
199 Ga0307408_101952776 3300031548 Unclassified 563
200 Ga0307413_11540733 3300031824 Bacteria 589
201 Ga0307416_100864944 3300032002 Bacteria 1003
202 Ga0307414_11142830 3300032004 Bacteria 720
203 Ga0307411_10572183 3300032005 Unclassified 967
204 Ga0307411_11362973 3300032005 Bacteria 648
205 Ga0373936_0054664 3300035113 Bacteria 1620
206 Ga0373943_0863537 3300035170 Bacteria 540
207 Ga0373927_0304590 3300035695 Bacteria 1049
208 Ga0373937_0093711 3300036401 Bacteria 2785
209 Ga0373937_2153521 3300036401 Unclassified 504
210 Ga0373925_0046482 3300037068 Bacteria 3228
211 Ga0453683_0526111 3300044673 Bacteria 768
212 Ga0451576_1028257 3300045051 Bacteria 863
213 Ga0451576_1133824 3300045051 Unclassified 818
214 Ga0451576_2047928 3300045051 Bacteria 589
215 Ga0495590_0005319 3300046457 Bacteria 5111
216 Ga0495616_0005309 3300046513 Bacteria 7941
217 Ga0495640_0539109 3300046533 Bacteria 708
218 Ga0495625_0579951 3300046660 Bacteria 676
219 Ga0495635_0195226 3300046663 Bacteria 1374
220 Ga0495635_0785946 3300046663 Unclassified 614
221 Ga0495658_0395379 3300046683 Bacteria 881
222 Ga0495624_0548075 3300046690 Bacteria 691
223 Ga0496100_0932309 3300048903 Bacteria 682
224 Ga0496101_0016145 3300048904 Bacteria 5042
225 Ga0496107_0039014 3300048910 Bacteria 3407
226 Ga0496108_0867482 3300048911 Bacteria 776
227 Ga0496109_1224573 3300048912 Bacteria 687
228 Ga0496112_1738433 3300048915 Bacteria 536
229 Ga0496114_0031253 3300048917 Bacteria 4381
230 Ga0496115_0036477 3300048918 Bacteria 3893
231 Ga0501292_042447 3300049515 Bacteria 788
232 Ga0501297_006660 3300049520 Bacteria 1238
233 Ga0501299_046458 3300049522 Bacteria 886
234 Ga0501033_0243669 3300049570 Bacteria 1275
235 Ga0501036_0102806 3300049572 Unclassified 2417
236 Ga0501036_0633783 3300049572 Bacteria 886
237 Ga0501038_0153530 3300049574 Bacteria 1876
238 Ga0501039_0076812 3300049575 Bacteria 2597
239 Ga0501040_0013772 3300049576 Bacteria 5322
240 Ga0501040_0259870 3300049576 Bacteria 1239
241 Ga0501041_0067880 3300049577 Bacteria 2186
242 Ga0501041_0469308 3300049577 Bacteria 799
243 Ga0501042_0049828 3300049578 Bacteria 2988
244 Ga0501046_0654262 3300049580 Bacteria 743
245 Ga0501047_0695913 3300049581 Bacteria 834
246 Ga0501048_0894438 3300049582 Bacteria 638
247 Ga0501068_0796833 3300049584 Unclassified 620
248 Ga0501072_0034140 3300049588 Bacteria 3986
249 Ga0501072_0240142 3300049588 Bacteria 1443
250 Ga0501073_0071661 3300049589 Bacteria 2414
251 Ga0501073_0816467 3300049589 Bacteria 643
252 Ga0501073_1100618 3300049589 Unclassified 546
253 Ga0501074_0057744 3300049590 Bacteria 2796
254 Ga0501074_0166700 3300049590 Bacteria 1573
255 Ga0501075_0055991 3300049591 Bacteria 2968
256 Ga0501075_0099474 3300049591 Bacteria 2208
257 Ga0501075_0959014 3300049591 Unclassified 650
258 Ga0501076_0085239 3300049592 Bacteria 2538
259 Ga0501076_0205147 3300049592 Bacteria 1610
260 Ga0501077_0012409 3300049593 Bacteria 5337
261 Ga0501077_0061119 3300049593 Bacteria 2391
262 Ga0501209_069376 3300049656 Bacteria 1000
263 Ga0501216_006346 3300049660 Bacteria 1811
264 Ga0501217_019452 3300049661 Bacteria 1585
265 Ga0501227_018008 3300049665 Bacteria 1599
266 Ga0501233_047076 3300049668 Bacteria 1033
267 Ga0501235_050701 3300049669 Bacteria 961
268 Ga0501221_010767 3300049704 Bacteria 1632
269 Ga0501225_0010008 3300049705 Bacteria 2692
270 Ga0501079_0016760 3300049741 Bacteria 5596
271 Ga0501079_0027085 3300049741 Bacteria 4393
272 Ga0501080_0021781 3300049742 Bacteria 5937
273 Ga0501080_0123510 3300049742 Bacteria 2398
274 Ga0501081_0001519 3300049743 Bacteria 14264
275 Ga0501081_0020791 3300049743 Unclassified 4378
276 Ga0501081_0029270 3300049743 Bacteria 3721
277 Ga0501083_0047186 3300049744 Bacteria 2911
278 Ga0501083_0233876 3300049744 Bacteria 1197
279 Ga0501083_0949952 3300049744 Unclassified 559
280 Ga0501268_111619 3300049765 Unclassified 597
281 Ga0501212_055797 3300049851 Bacteria 676
282 nmdc:mga00v17_319502_c1 3300050491 Unclassified 1009
283 nmdc:mga05p37_56311_c1 3300050507 Bacteria 4840
284 nmdc:mga05p37_96679_c1 3300050507 Bacteria 3639
285 nmdc:mga09592_68543_c2 3300050508 Bacteria 2719
286 nmdc:mga0qj67_111849_c1 3300050509 Bacteria 2205
287 nmdc:mga0qj67_192485_c1 3300050509 Bacteria 1657
288 nmdc:mga0qj67_260306_c1 3300050509 Bacteria 1407
289 nmdc:mga0qj67_838733_c1 3300050509 Unclassified 726
290 nmdc:mga0qj67_88994_c1 3300050509 Bacteria 2479
291 nmdc:mga06r32_194597_c1 3300050510 Bacteria 2015
292 nmdc:mga06r32_336647_c1 3300050510 Bacteria 1494
293 nmdc:mga06r32_563587_c1 3300050510 Bacteria 1112
294 nmdc:mga06r32_62814_c1 3300050510 Bacteria 3578
295 nmdc:mga08y16_175989_c1 3300050511 Bacteria 2222
296 nmdc:mga0n895_1044271_c1 3300050512 Unclassified 796
297 nmdc:mga0n895_922391_c1 3300050512 Bacteria 858
298 nmdc:mga08x19_109025_c1 3300050514 Bacteria 1845
299 nmdc:mga08x19_143666_c1 3300050514 Bacteria 1613
300 Ga0495619_0331089 3300053085 Bacteria 1054
301 Ga0500583_0028263 3300053092 Bacteria 2430
302 Ga0500642_0042168 3300053130 Bacteria 1977
303 Ga0501084_0071475 3300054114 Bacteria 2905
304 Ga0501084_1248917 3300054114 Unclassified 623
305 Ga0501082_0007639 3300060353 Bacteria 9323
306 Ga0501082_0160963 3300060353 Bacteria 1950
307 Ga0530510_0016491 3300061734 Bacteria 5231
308 Ga0070669_100249809
309 JGI26128J50194_1005579
310 JGI26145J50221_1017470
311 JGI26133J50247_103670
312 JGI26132J50249_102912
313 JGI26141J51220_1000064
314 Ga0055531_10048089
315 Ga0065715_10202328
316 Ga0065707_10917662
317 Ga0065707_11122583
318 Ga0070676_10871407
319 Ga0070690_101221659
320 Ga0070680_100452290
321 Ga0068868_101570627
322 Ga0070689_100260491
323 Ga0070689_100442282
324 Ga0070687_100390251
325 Ga0070668_100308184
326 Ga0070669_100102210
327 Ga0070669_100211773
328 Ga0070669_100278790
329 Ga0070675_100357502
330 Ga0070688_100315050
331 Ga0070688_100374876
332 Ga0070667_100327100
333 Ga0070667_100763772
334 Ga0070667_102251824
335 Ga0070713_101460926
336 Ga0070713_101502749
337 Ga0070710_10866668
338 Ga0070711_100390403
339 Ga0070705_100395626
340 Ga0070705_100460181
341 Ga0070700_100625419
342 Ga0070694_100173094
343 Ga0070694_100287756
344 Ga0070708_100111242
345 Ga0070708_101424756
346 Ga0070681_10404842
347 Ga0070681_11134080
348 Ga0068867_100144420
349 Ga0068867_100806946
350 Ga0070706_100006956
351 Ga0070707_100490614
352 Ga0070698_100203699
353 Ga0070698_100977424
354 Ga0070699_100031334
355 Ga0070699_102111959
356 Ga0070679_100657313
357 Ga0070697_100001388
358 Ga0070697_100243517
359 Ga0070697_100368378
360 Ga0070672_101120978
361 Ga0070686_101466687
362 Ga0070695_100003563
363 Ga0070695_100166109
364 Ga0070665_102651934
365 Ga0070704_101306006
366 Ga0068856_100346482
367 Ga0068852_102399467
368 Ga0068859_101389871
369 Ga0068859_102466022
370 Ga0068866_10000015
371 Ga0068861_100578040
372 Ga0068863_100201576
373 Ga0068858_100047140
374 Ga0068858_101223545
375 Ga0068860_101666140
376 Ga0068862_100077595
377 Ga0081455_10088856
378 Ga0070717_10233184
379 Ga0075364_10020202
380 Ga0075366_10751715
381 Ga0097621_100613861
382 Ga0097621_100800040
383 Ga0097621_100821402
384 Ga0068871_100010388
385 Ga0068871_101969011
386 Ga0075428_101940026
387 Ga0075430_100073502
388 Ga0075430_100301159
389 Ga0075430_101219828
390 Ga0075430_101788872
391 Ga0075431_100091013
392 Ga0075431_100133878
393 Ga0075431_100231541
394 Ga0075431_100540635
395 Ga0075433_10323259
396 Ga0075434_100107461
397 Ga0075429_100077398
398 Ga0075429_100302260
399 Ga0068865_100413001
400 Ga0075436_100091410
401 Ga0075436_100173775
402 Ga0097620_101390027
403 Ga0097620_102466406
404 Ga0075435_100514198
405 Ga0075435_101952296
406 Ga0099794_10228043
407 Ga0105240_10000604
408 Ga0111539_10127699
409 Ga0105245_11143730
410 Ga0105245_11533600
411 Ga0105245_12344191
412 Ga0114129_10027298
413 Ga0114129_10030717
414 Ga0105241_10013482
415 Ga0105242_10000069
416 Ga0105248_10451835
417 Ga0105248_12463398
418 Ga0105237_11196698
419 Ga0105238_10024252
420 Ga0105249_10000766
421 Ga0105239_10000306
422 Ga0105239_12627228
423 Ga0157374_10039665
424 Ga0157374_11048985
425 Ga0157378_11132743
426 Ga0163162_10004439
427 Ga0157372_10127623
428 Ga0157375_10134871
429 Ga0157375_13296255
430 Ga0163163_10194028
431 Ga0157380_10926072
432 Ga0157380_11363340
433 Ga0157379_10204440
434 Ga0157376_10065003
435 Ga0157376_12270908
436 Ga0163161_10768826
437 Ga0163161_11105701
438 Ga0206353_10734278
439 Ga0228598_1047821
440 Ga0207692_10204010
441 Ga0207642_10000013
442 Ga0207645_10379305
443 Ga0207684_10006421
444 Ga0207684_10487228
445 Ga0207654_10277199
446 Ga0207707_11254105
447 Ga0207695_10010676
448 Ga0207671_11008027
449 Ga0207693_10659311
450 Ga0207662_11261887
451 Ga0207646_10827674
452 Ga0207681_10113995
453 Ga0207681_10359792
454 Ga0207681_10515905
455 Ga0207687_10958127
456 Ga0207644_10684553
457 Ga0207686_10000096
458 Ga0207670_11811020
459 Ga0207691_10173534
460 Ga0207711_11684242
461 Ga0207711_12048291
462 Ga0207712_10001264
463 Ga0207712_11573929
464 Ga0207668_11105937
465 Ga0207668_11550964
466 Ga0207658_11090040
467 Ga0207658_12092450
468 Ga0207677_10270075
469 Ga0207677_11154525
470 Ga0207703_10655737
471 Ga0207703_12239989
472 Ga0207708_10185957
473 Ga0207708_10235399
474 Ga0207708_11832099
475 Ga0207641_12093726
476 Ga0207648_10338044
477 Ga0207648_10468074
478 Ga0207676_11677762
479 Ga0207674_10552856
480 Ga0207675_100119904
481 Ga0207675_100448161
482 Ga0207675_101121336
483 Ga0209967_1031928
484 Ga0209981_1025190
485 Ga0209996_1004297
486 Ga0210000_1026799
487 Ga0209995_1002211
488 Ga0209968_1005618
489 Ga0209999_1001883
490 Ga0209982_1000799
491 Ga0209970_1002638
492 Ga0210002_1032528
493 Ga0210002_1104738
494 Ga0209983_1000381
495 Ga0209971_1000291
496 Ga0209966_1000119
497 Ga0209998_10000058
498 Ga0209974_10001860
499 Ga0207428_10149295
500 Ga0268265_10069192
501 Ga0268265_10397876
502 Ga0307515_10030554
503 Ga0265762_1008616
504 Ga0265763_1012987
505 Ga0265760_10257288
506 Ga0307408_101952776
507 Ga0307413_11540733
508 Ga0307416_100864944
509 Ga0307414_11142830
510 Ga0307411_10572183
511 Ga0307411_11362973
512 Ga0373936_0054664
513 Ga0373943_0863537
514 Ga0373927_0304590
515 Ga0373937_0093711
516 Ga0373937_2153521
517 Ga0373925_0046482
518 Ga0453683_0526111
519 Ga0451576_1028257
520 Ga0451576_1133824
521 Ga0451576_2047928
522 Ga0495590_0005319
523 Ga0495616_0005309
524 Ga0495640_0539109
525 Ga0495625_0579951
526 Ga0495635_0195226
527 Ga0495635_0785946
528 Ga0495658_0395379
529 Ga0495624_0548075
530 Ga0496100_0932309
531 Ga0496101_0016145
532 Ga0496107_0039014
533 Ga0496108_0867482
534 Ga0496109_1224573
535 Ga0496112_1738433
536 Ga0496114_0031253
537 Ga0496115_0036477
538 Ga0501292_042447
539 Ga0501297_006660
540 Ga0501299_046458
541 Ga0501033_0243669
542 Ga0501036_0102806
543 Ga0501036_0633783
544 Ga0501038_0153530
545 Ga0501039_0076812
546 Ga0501040_0013772
547 Ga0501040_0259870
548 Ga0501041_0067880
549 Ga0501041_0469308
550 Ga0501042_0049828
551 Ga0501046_0654262
552 Ga0501047_0695913
553 Ga0501048_0894438
554 Ga0501068_0796833
555 Ga0501072_0034140
556 Ga0501072_0240142
557 Ga0501073_0071661
558 Ga0501073_0816467
559 Ga0501073_1100618
560 Ga0501074_0057744
561 Ga0501074_0166700
562 Ga0501075_0055991
563 Ga0501075_0099474
564 Ga0501075_0959014
565 Ga0501076_0085239
566 Ga0501076_0205147
567 Ga0501077_0012409
568 Ga0501077_0061119
569 Ga0501209_069376
570 Ga0501216_006346
571 Ga0501217_019452
572 Ga0501227_018008
573 Ga0501233_047076
574 Ga0501235_050701
575 Ga0501221_010767
576 Ga0501225_0010008
577 Ga0501079_0016760
578 Ga0501079_0027085
579 Ga0501080_0021781
580 Ga0501080_0123510
581 Ga0501081_0001519
582 Ga0501081_0020791
583 Ga0501081_0029270
584 Ga0501083_0047186
585 Ga0501083_0233876
586 Ga0501083_0949952
587 Ga0501268_111619
588 Ga0501212_055797
589 nmdc:mga00v17_319502_c1
590 nmdc:mga05p37_56311_c1
591 nmdc:mga05p37_96679_c1
592 nmdc:mga09592_68543_c2
593 nmdc:mga0qj67_111849_c1
594 nmdc:mga0qj67_192485_c1
595 nmdc:mga0qj67_260306_c1
596 nmdc:mga0qj67_838733_c1
597 nmdc:mga0qj67_88994_c1
598 nmdc:mga06r32_194597_c1
599 nmdc:mga06r32_336647_c1
600 nmdc:mga06r32_563587_c1
601 nmdc:mga06r32_62814_c1
602 nmdc:mga08y16_175989_c1
603 nmdc:mga0n895_1044271_c1
604 nmdc:mga0n895_922391_c1
605 nmdc:mga08x19_109025_c1
606 nmdc:mga08x19_143666_c1
607 Ga0495619_0331089
608 Ga0500583_0028263
609 Ga0500642_0042168
610 Ga0501084_0071475
611 Ga0501084_1248917
612 Ga0501082_0007639
613 Ga0501082_0160963
614 Ga0530510_0016491

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1pzx-assembly1.cif.gz_A hypothetical protein apc36103 from bacillus stearothermophilus: a lipid binding protein 0.6886 7 39
7wq5-assembly1.cif.gz_A crystal structure of arabidopsis transcriptional factor wrinkled1 with dsdna 0.6878 2 36
6ven-assembly1.cif.gz_M yeast compass in complex with a ubiquitinated nucleosome 0.6485 2 33
7s1q-assembly1.cif.gz_B prmt5/mep50 crystal structure with mta and a phthalazinone inhibitor bound (compound 9) 0.6446 2 32
4x61-assembly1.cif.gz_B crystal structure of prmt5:mep50 with epz015666 and sam 0.6428 2 32
ID Description Score Start End Superfamily
af_Q9AWS7_65_121_3.30.730.10 Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain 0.8344 2 38 3.30.730.10
af_A0A1D6KJ58_29_91_3.30.730.10 Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain 0.7956 2 36 3.30.730.10
af_K7KP57_178_237_3.30.730.10 Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain 0.7831 2 38 3.30.730.10
af_A0A0R0FVZ4_228_287_3.30.730.10 Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain 0.7728 2 38 3.30.730.10
af_K7VB02_32_90_3.30.730.10 Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain 0.764 2 36 3.30.730.10
ID Description Score Start End GO Terms
AF-A0A0P9DTT4-F1-model_v4 deleted 1.016 2 48
AF-A0A2V5YM63-F1-model_v4 Uncharacterized protein 1.007 1 39
AF-A0A7V3F6V5-F1-model_v4 AP2-like integrase N-terminal domain-containing protein 1.005 1 48
AF-A0A5D3KS17-F1-model_v4 Uncharacterized protein 1.005 1 36
AF-A0A2V7LIK5-F1-model_v4 AP2-like integrase N-terminal domain-containing protein 1.004 1 48

Map