F398910
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 306 | 206 | 306 | 137 |
Family's Representative Sequence
| Representative Sequence | 3300053078|Ga0495612_0362041|Ga0495612_0362041_195_641 |
| Length | 148 |
| Sequence | MQSRGGGAVDIEFLSTVAVIAPDPPASRKLYVDALGLPLKSGGDDEYHHSERIAGCKSFGIWPLSQAAEACFGTPEWPAERPVPQVSIEFDVADAAAVTLAARELEQAGYELLHPPREEPWGQTVARLQSPEGAIVGISYAPVLHDQH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 2 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 48 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 49 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 50 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 51 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 56 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 57 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 58 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 59 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 61 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 79 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 80 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 81 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 82 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 83 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 84 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 85 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 86 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 87 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 88 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 89 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 90 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 133 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 135 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 136 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 137 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 138 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 139 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 140 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 141 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 142 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 143 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 144 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 145 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 146 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 147 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 148 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 149 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 150 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 151 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 152 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 153 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 154 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 155 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 156 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 174 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 175 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 176 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 177 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 178 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 179 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 180 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 181 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 182 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 183 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 184 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 185 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 186 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 187 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 188 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 189 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 190 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 191 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 192 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 193 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 194 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 195 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 199 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 200 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 201 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 206 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.73 |
| Metatranscriptomes | 3.27 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.65 |
| Nodule | 0 |
| Rhizoplane | 12.42 |
| Rhizosphere | 76.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.46 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10149473 | 3300001989 | Bacteria | 691 |
| 2 | JGI25407J50210_10169364 | 3300003373 | Unclassified | 538 |
| 3 | Ga0070683_100001376 | 3300005329 | Bacteria | 18639 |
| 4 | Ga0070683_100118547 | 3300005329 | Bacteria | 2499 |
| 5 | Ga0070683_101165497 | 3300005329 | Bacteria | 740 |
| 6 | Ga0070690_100407453 | 3300005330 | Unclassified | 1000 |
| 7 | Ga0068869_100058154 | 3300005334 | Bacteria | 2826 |
| 8 | Ga0070682_100004885 | 3300005337 | Bacteria | 7440 |
| 9 | Ga0068868_100002487 | 3300005338 | Bacteria | 12790 |
| 10 | Ga0070660_100261892 | 3300005339 | Bacteria | 1412 |
| 11 | Ga0070689_100072030 | 3300005340 | Bacteria | 2701 |
| 12 | Ga0070691_10093240 | 3300005341 | Bacteria | 1487 |
| 13 | Ga0070692_10732742 | 3300005345 | Bacteria | 668 |
| 14 | Ga0070668_100197364 | 3300005347 | Bacteria | 1651 |
| 15 | Ga0070675_100230288 | 3300005354 | Bacteria | 1616 |
| 16 | Ga0070671_100199007 | 3300005355 | Bacteria | 1699 |
| 17 | Ga0070674_100042920 | 3300005356 | Bacteria | 3074 |
| 18 | Ga0070673_100102269 | 3300005364 | Bacteria | 2362 |
| 19 | Ga0070688_100130989 | 3300005365 | Bacteria | 1692 |
| 20 | Ga0070659_100016968 | 3300005366 | Bacteria | 5474 |
| 21 | Ga0070709_10136560 | 3300005434 | Bacteria | 1680 |
| 22 | Ga0070714_100014351 | 3300005435 | Bacteria | 6363 |
| 23 | Ga0070714_100278839 | 3300005435 | Bacteria | 1552 |
| 24 | Ga0070713_100338210 | 3300005436 | Unclassified | 1394 |
| 25 | Ga0070713_100396071 | 3300005436 | Bacteria | 1289 |
| 26 | Ga0070711_100057087 | 3300005439 | Bacteria | 2702 |
| 27 | Ga0070711_100094853 | 3300005439 | Bacteria | 2158 |
| 28 | Ga0070700_100011711 | 3300005441 | Bacteria | 4867 |
| 29 | Ga0070708_100579016 | 3300005445 | Bacteria | 1058 |
| 30 | Ga0070663_100018497 | 3300005455 | Bacteria | 4571 |
| 31 | Ga0070678_100006342 | 3300005456 | Bacteria | 6938 |
| 32 | Ga0070678_100036351 | 3300005456 | Bacteria | 3447 |
| 33 | Ga0070681_10330583 | 3300005458 | Bacteria | 1434 |
| 34 | Ga0070685_10032166 | 3300005466 | Bacteria | 2937 |
| 35 | Ga0070685_11381140 | 3300005466 | Bacteria | 540 |
| 36 | Ga0070706_100058997 | 3300005467 | Bacteria | 3541 |
| 37 | Ga0070706_100138143 | 3300005467 | Bacteria | 2274 |
| 38 | Ga0070707_100328397 | 3300005468 | Bacteria | 1486 |
| 39 | Ga0070698_100424683 | 3300005471 | Bacteria | 1264 |
| 40 | Ga0070698_100659675 | 3300005471 | Bacteria | 987 |
| 41 | Ga0070699_100284478 | 3300005518 | Bacteria | 1481 |
| 42 | Ga0070699_100641007 | 3300005518 | Bacteria | 970 |
| 43 | Ga0070679_100072055 | 3300005530 | Bacteria | 3447 |
| 44 | Ga0070684_100015680 | 3300005535 | Bacteria | 6182 |
| 45 | Ga0070684_100030362 | 3300005535 | Bacteria | 4591 |
| 46 | Ga0070684_100590807 | 3300005535 | Bacteria | 1032 |
| 47 | Ga0070697_100430382 | 3300005536 | Bacteria | 1147 |
| 48 | Ga0070695_100759150 | 3300005545 | Unclassified | 774 |
| 49 | Ga0070704_100067392 | 3300005549 | Bacteria | 2585 |
| 50 | Ga0070704_100627930 | 3300005549 | Bacteria | 947 |
| 51 | Ga0068855_101071823 | 3300005563 | Unclassified | 844 |
| 52 | Ga0070664_100087020 | 3300005564 | Bacteria | 2700 |
| 53 | Ga0070664_101683150 | 3300005564 | Bacteria | 601 |
| 54 | Ga0070664_102167297 | 3300005564 | Bacteria | 527 |
| 55 | Ga0068857_100046968 | 3300005577 | Bacteria | 3832 |
| 56 | Ga0068854_100663010 | 3300005578 | Bacteria | 897 |
| 57 | Ga0068856_100011858 | 3300005614 | Bacteria | 8442 |
| 58 | Ga0068856_100079329 | 3300005614 | Bacteria | 3255 |
| 59 | Ga0070702_100002872 | 3300005615 | Bacteria | 7566 |
| 60 | Ga0068852_100156000 | 3300005616 | Bacteria | 2127 |
| 61 | Ga0068859_100461406 | 3300005617 | Bacteria | 1366 |
| 62 | Ga0068864_100028058 | 3300005618 | Bacteria | 4757 |
| 63 | Ga0068861_100566871 | 3300005719 | Bacteria | 1037 |
| 64 | Ga0068851_10167286 | 3300005834 | Bacteria | 1211 |
| 65 | Ga0068863_100154597 | 3300005841 | Bacteria | 2196 |
| 66 | Ga0081538_10040194 | 3300005981 | Bacteria | 2987 |
| 67 | Ga0081538_10278631 | 3300005981 | Unclassified | 622 |
| 68 | Ga0070717_10143950 | 3300006028 | Bacteria | 2058 |
| 69 | Ga0070716_100077182 | 3300006173 | Bacteria | 1976 |
| 70 | Ga0070712_100020039 | 3300006175 | Bacteria | 4372 |
| 71 | Ga0097621_100260101 | 3300006237 | Bacteria | 1522 |
| 72 | Ga0075433_10743194 | 3300006852 | Unclassified | 858 |
| 73 | Ga0075434_100062679 | 3300006871 | Bacteria | 3701 |
| 74 | Ga0075434_100823486 | 3300006871 | Unclassified | 944 |
| 75 | Ga0068865_100052914 | 3300006881 | Bacteria | 2816 |
| 76 | Ga0075436_100917575 | 3300006914 | Unclassified | 655 |
| 77 | Ga0097620_100461427 | 3300006931 | Bacteria | 1366 |
| 78 | Ga0075435_100168894 | 3300007076 | Bacteria | 1845 |
| 79 | Ga0075435_101008716 | 3300007076 | Unclassified | 727 |
| 80 | Ga0105244_10444847 | 3300009036 | Bacteria | 596 |
| 81 | Ga0105245_10019225 | 3300009098 | Bacteria | 5981 |
| 82 | Ga0105245_11135054 | 3300009098 | Unclassified | 828 |
| 83 | Ga0114129_11635761 | 3300009147 | Bacteria | 787 |
| 84 | Ga0105241_11298194 | 3300009174 | Bacteria | 693 |
| 85 | Ga0105242_10475127 | 3300009176 | Bacteria | 1183 |
| 86 | Ga0105238_10463290 | 3300009551 | Bacteria | 1265 |
| 87 | Ga0105238_11644161 | 3300009551 | Bacteria | 673 |
| 88 | Ga0105239_10136026 | 3300010375 | Bacteria | 2736 |
| 89 | Ga0105246_10109333 | 3300011119 | Bacteria | 2028 |
| 90 | Ga0157369_11578943 | 3300013105 | Bacteria | 667 |
| 91 | Ga0157374_10005605 | 3300013296 | Bacteria | 10576 |
| 92 | Ga0157378_10078884 | 3300013297 | Bacteria | 2972 |
| 93 | Ga0163162_10700853 | 3300013306 | Bacteria | 1134 |
| 94 | Ga0157372_10044418 | 3300013307 | Bacteria | 4924 |
| 95 | Ga0157372_11521864 | 3300013307 | Bacteria | 771 |
| 96 | Ga0157375_10027006 | 3300013308 | Bacteria | 5360 |
| 97 | Ga0163163_10040439 | 3300014325 | Bacteria | 4552 |
| 98 | Ga0157377_10006343 | 3300014745 | Bacteria | 5633 |
| 99 | Ga0157376_10207235 | 3300014969 | Bacteria | 1808 |
| 100 | Ga0197907_11043966 | 3300020069 | Bacteria | 811 |
| 101 | Ga0206356_10968391 | 3300020070 | Unclassified | 506 |
| 102 | Ga0206349_1636136 | 3300020075 | Bacteria | 1058 |
| 103 | Ga0206355_1084253 | 3300020076 | Bacteria | 1131 |
| 104 | Ga0206352_10929549 | 3300020078 | Bacteria | 792 |
| 105 | Ga0206350_11333701 | 3300020080 | Bacteria | 953 |
| 106 | Ga0206354_10222355 | 3300020081 | Bacteria | 1285 |
| 107 | Ga0206353_10581476 | 3300020082 | Unclassified | 1132 |
| 108 | Ga0206353_11117393 | 3300020082 | Bacteria | 1439 |
| 109 | Ga0213873_10022600 | 3300021358 | Bacteria | 1491 |
| 110 | Ga0213873_10023621 | 3300021358 | Unclassified | 1467 |
| 111 | Ga0213874_10024459 | 3300021377 | Bacteria | 1694 |
| 112 | Ga0213874_10032306 | 3300021377 | Bacteria | 1519 |
| 113 | Ga0213876_10011234 | 3300021384 | Bacteria | 4784 |
| 114 | Ga0213876_10059767 | 3300021384 | Bacteria | 2011 |
| 115 | Ga0213876_10459216 | 3300021384 | Bacteria | 677 |
| 116 | Ga0213875_10000433 | 3300021388 | Bacteria | 36593 |
| 117 | Ga0213875_10008572 | 3300021388 | Bacteria | 5226 |
| 118 | Ga0213875_10073821 | 3300021388 | Bacteria | 1591 |
| 119 | Ga0224712_10281684 | 3300022467 | Bacteria | 774 |
| 120 | Ga0207688_10004068 | 3300025901 | Bacteria | 7970 |
| 121 | Ga0207684_10043657 | 3300025910 | Bacteria | 3801 |
| 122 | Ga0207684_10406450 | 3300025910 | Bacteria | 1170 |
| 123 | Ga0207707_10591637 | 3300025912 | Unclassified | 940 |
| 124 | Ga0207695_10827494 | 3300025913 | Bacteria | 806 |
| 125 | Ga0207693_10025726 | 3300025915 | Bacteria | 4664 |
| 126 | Ga0207663_10096974 | 3300025916 | Bacteria | 1971 |
| 127 | Ga0207660_10645083 | 3300025917 | Unclassified | 863 |
| 128 | Ga0207662_10048379 | 3300025918 | Bacteria | 2519 |
| 129 | Ga0207657_10031992 | 3300025919 | Bacteria | 4758 |
| 130 | Ga0207657_10104887 | 3300025919 | Bacteria | 2341 |
| 131 | Ga0207649_10018082 | 3300025920 | Bacteria | 4002 |
| 132 | Ga0207646_10097109 | 3300025922 | Bacteria | 2639 |
| 133 | Ga0207646_10216420 | 3300025922 | Bacteria | 1730 |
| 134 | Ga0207681_11194457 | 3300025923 | Bacteria | 639 |
| 135 | Ga0207694_10204524 | 3300025924 | Bacteria | 1607 |
| 136 | Ga0207659_10128874 | 3300025926 | Bacteria | 1949 |
| 137 | Ga0207687_10044151 | 3300025927 | Bacteria | 3074 |
| 138 | Ga0207700_10178794 | 3300025928 | Unclassified | 1775 |
| 139 | Ga0207700_11541350 | 3300025928 | Bacteria | 589 |
| 140 | Ga0207664_10000006 | 3300025929 | Bacteria | 408702 |
| 141 | Ga0207664_10005119 | 3300025929 | Bacteria | 8933 |
| 142 | Ga0207664_10620332 | 3300025929 | Bacteria | 972 |
| 143 | Ga0207644_10551848 | 3300025931 | Unclassified | 954 |
| 144 | Ga0207644_10772678 | 3300025931 | Bacteria | 803 |
| 145 | Ga0207690_10124250 | 3300025932 | Bacteria | 1879 |
| 146 | Ga0207706_10049738 | 3300025933 | Bacteria | 3704 |
| 147 | Ga0207670_10070280 | 3300025936 | Bacteria | 2418 |
| 148 | Ga0207704_10030038 | 3300025938 | Bacteria | 3041 |
| 149 | Ga0207665_10018329 | 3300025939 | Bacteria | 4600 |
| 150 | Ga0207711_10342423 | 3300025941 | Unclassified | 1384 |
| 151 | Ga0207689_10084475 | 3300025942 | Bacteria | 2609 |
| 152 | Ga0207679_11190614 | 3300025945 | Bacteria | 699 |
| 153 | Ga0207651_11058172 | 3300025960 | Bacteria | 726 |
| 154 | Ga0207712_10240426 | 3300025961 | Bacteria | 1458 |
| 155 | Ga0207668_10060112 | 3300025972 | Bacteria | 2666 |
| 156 | Ga0207640_10038830 | 3300025981 | Bacteria | 3008 |
| 157 | Ga0207677_10033375 | 3300026023 | Bacteria | 3320 |
| 158 | Ga0207678_10026271 | 3300026067 | Bacteria | 5080 |
| 159 | Ga0207708_10000245 | 3300026075 | Bacteria | 42725 |
| 160 | Ga0207702_10004876 | 3300026078 | Bacteria | 11814 |
| 161 | Ga0207702_10086306 | 3300026078 | Bacteria | 2736 |
| 162 | Ga0207702_10969161 | 3300026078 | Bacteria | 843 |
| 163 | Ga0207641_11583359 | 3300026088 | Bacteria | 657 |
| 164 | Ga0207648_10189390 | 3300026089 | Bacteria | 1822 |
| 165 | Ga0207676_10043587 | 3300026095 | Bacteria | 3456 |
| 166 | Ga0207674_10083283 | 3300026116 | Bacteria | 3198 |
| 167 | Ga0207675_100656846 | 3300026118 | Bacteria | 1055 |
| 168 | Ga0207683_10001623 | 3300026121 | Bacteria | 20159 |
| 169 | Ga0207683_10080218 | 3300026121 | Bacteria | 2895 |
| 170 | Ga0207698_10054557 | 3300026142 | Bacteria | 3076 |
| 171 | Ga0207428_10113670 | 3300027907 | Bacteria | 2081 |
| 172 | Ga0268265_10193878 | 3300028380 | Bacteria | 1757 |
| 173 | Ga0307415_100531760 | 3300032126 | Bacteria | 1034 |
| 174 | Ga0373953_0054028 | 3300035117 | Bacteria | 1629 |
| 175 | Ga0373935_0767776 | 3300035692 | Bacteria | 711 |
| 176 | Ga0395900_0233493 | 3300037418 | Unclassified | 1849 |
| 177 | Ga0395900_0929708 | 3300037418 | Bacteria | 792 |
| 178 | Ga0395898_0094050 | 3300037466 | Bacteria | 2881 |
| 179 | Ga0395898_0379591 | 3300037466 | Bacteria | 1348 |
| 180 | Ga0395898_0797027 | 3300037466 | Bacteria | 885 |
| 181 | Ga0436364_0638229 | 3300037853 | Bacteria | 996 |
| 182 | Ga0436364_1040466 | 3300037853 | Bacteria | 95595 |
| 183 | Ga0436364_1132411 | 3300037853 | Bacteria | 58691 |
| 184 | Ga0436364_1427311 | 3300037853 | Bacteria | 97691 |
| 185 | Ga0395901_0245398 | 3300038443 | Unclassified | 1867 |
| 186 | Ga0395901_0375796 | 3300038443 | Bacteria | 1463 |
| 187 | Ga0436365_0071633 | 3300039437 | Bacteria | 8901 |
| 188 | Ga0436365_0430923 | 3300039437 | Bacteria | 2313 |
| 189 | Ga0436365_0601902 | 3300039437 | Unclassified | 2406 |
| 190 | Ga0436365_1468228 | 3300039437 | Bacteria | 2875 |
| 191 | Ga0436363_0400563 | 3300039450 | Bacteria | 9528 |
| 192 | Ga0436363_0882351 | 3300039450 | Bacteria | 628 |
| 193 | Ga0436363_0982158 | 3300039450 | Bacteria | 635 |
| 194 | Ga0436363_1201535 | 3300039450 | Bacteria | 2568 |
| 195 | Ga0436363_1447314 | 3300039450 | Bacteria | 5976 |
| 196 | Ga0436363_1481028 | 3300039450 | Unclassified | 1064 |
| 197 | Ga0436363_1527363 | 3300039450 | Bacteria | 11977 |
| 198 | Ga0436362_0963702 | 3300039453 | Bacteria | 5140 |
| 199 | Ga0436362_1079976 | 3300039453 | Unclassified | 1390 |
| 200 | Ga0436362_1290985 | 3300039453 | Bacteria | 700 |
| 201 | Ga0451853_0946713 | 3300041512 | Unclassified | 587 |
| 202 | Ga0466969_0339648 | 3300044656 | Unclassified | 680 |
| 203 | Ga0466966_0316895 | 3300044684 | Bacteria | 937 |
| 204 | Ga0466961_0226628 | 3300044693 | Bacteria | 1151 |
| 205 | Ga0466961_0473666 | 3300044693 | Bacteria | 757 |
| 206 | Ga0466961_0564999 | 3300044693 | Unclassified | 685 |
| 207 | Ga0466963_1206582 | 3300044694 | Unclassified | 531 |
| 208 | Ga0466964_0017369 | 3300044706 | Bacteria | 2753 |
| 209 | Ga0466964_0141607 | 3300044706 | Unclassified | 1106 |
| 210 | Ga0466964_0390937 | 3300044706 | Bacteria | 724 |
| 211 | Ga0466968_0140716 | 3300044735 | Bacteria | 1103 |
| 212 | Ga0466970_0196275 | 3300044765 | Bacteria | 1122 |
| 213 | Ga0466957_0153691 | 3300044842 | Bacteria | 1490 |
| 214 | Ga0466959_0210823 | 3300045049 | Bacteria | 1350 |
| 215 | Ga0466958_0010651 | 3300045836 | Bacteria | 5157 |
| 216 | Ga0466958_0023418 | 3300045836 | Bacteria | 3626 |
| 217 | Ga0466958_0516335 | 3300045836 | Bacteria | 775 |
| 218 | Ga0466967_0030624 | 3300045976 | Unclassified | 4518 |
| 219 | Ga0466967_0058534 | 3300045976 | Bacteria | 3406 |
| 220 | Ga0466967_0083097 | 3300045976 | Bacteria | 2895 |
| 221 | Ga0495651_0113412 | 3300046462 | Bacteria | 2001 |
| 222 | Ga0495653_0257662 | 3300046463 | Unclassified | 1155 |
| 223 | Ga0495664_0595294 | 3300046477 | Archaea | 657 |
| 224 | Ga0495608_0422397 | 3300046511 | Bacteria | 813 |
| 225 | Ga0495618_0000799 | 3300046514 | Bacteria | 21969 |
| 226 | Ga0495618_0557731 | 3300046514 | Bacteria | 685 |
| 227 | Ga0495628_0505102 | 3300046516 | Bacteria | 873 |
| 228 | Ga0495628_0530617 | 3300046516 | Bacteria | 847 |
| 229 | Ga0495628_0932246 | 3300046516 | Unclassified | 601 |
| 230 | Ga0495630_0000256 | 3300046517 | Bacteria | 42987 |
| 231 | Ga0495630_0030495 | 3300046517 | Bacteria | 4012 |
| 232 | Ga0495663_0128243 | 3300046525 | Bacteria | 854 |
| 233 | Ga0495652_0188597 | 3300046529 | Bacteria | 1576 |
| 234 | Ga0495634_0396159 | 3300046642 | Unclassified | 821 |
| 235 | Ga0495635_0433603 | 3300046663 | Unclassified | 870 |
| 236 | Ga0495599_0247643 | 3300046678 | Bacteria | 1085 |
| 237 | Ga0495646_0580942 | 3300046680 | Bacteria | 570 |
| 238 | Ga0495613_0541129 | 3300046689 | Bacteria | 780 |
| 239 | Ga0495624_0218566 | 3300046690 | Bacteria | 1156 |
| 240 | Ga0495604_0228171 | 3300047317 | Unclassified | 1279 |
| 241 | Ga0495604_0578834 | 3300047317 | Unclassified | 722 |
| 242 | Ga0495674_0208346 | 3300047319 | Bacteria | 1620 |
| 243 | Ga0495674_0369859 | 3300047319 | Bacteria | 1161 |
| 244 | Ga0496100_0019768 | 3300048903 | Bacteria | 4026 |
| 245 | Ga0496102_0115168 | 3300048905 | Bacteria | 2508 |
| 246 | Ga0496102_0689675 | 3300048905 | Unclassified | 944 |
| 247 | Ga0496102_1259348 | 3300048905 | Bacteria | 659 |
| 248 | Ga0496103_0475615 | 3300048906 | Unclassified | 800 |
| 249 | Ga0496104_0014363 | 3300048907 | Bacteria | 7154 |
| 250 | Ga0496104_0050134 | 3300048907 | Bacteria | 3939 |
| 251 | Ga0496104_0568882 | 3300048907 | Bacteria | 1044 |
| 252 | Ga0496104_0794625 | 3300048907 | Unclassified | 852 |
| 253 | Ga0496105_0020263 | 3300048908 | Bacteria | 5373 |
| 254 | Ga0496105_0135608 | 3300048908 | Bacteria | 2028 |
| 255 | Ga0496106_0018838 | 3300048909 | Bacteria | 5114 |
| 256 | Ga0496106_0541720 | 3300048909 | Bacteria | 934 |
| 257 | Ga0496107_0037228 | 3300048910 | Bacteria | 3491 |
| 258 | Ga0496107_0211048 | 3300048910 | Bacteria | 1444 |
| 259 | Ga0496108_0017174 | 3300048911 | Bacteria | 5919 |
| 260 | Ga0496108_0062060 | 3300048911 | Bacteria | 3147 |
| 261 | Ga0496108_0234261 | 3300048911 | Bacteria | 1597 |
| 262 | Ga0496108_0628196 | 3300048911 | Bacteria | 935 |
| 263 | Ga0496109_0019734 | 3300048912 | Bacteria | 5947 |
| 264 | Ga0496109_0148152 | 3300048912 | Bacteria | 2196 |
| 265 | Ga0496109_0429950 | 3300048912 | Bacteria | 1247 |
| 266 | Ga0496110_0059596 | 3300048913 | Bacteria | 3365 |
| 267 | Ga0496110_0073637 | 3300048913 | Bacteria | 3031 |
| 268 | Ga0496110_1468664 | 3300048913 | Bacteria | 591 |
| 269 | Ga0496111_0109750 | 3300048914 | Unclassified | 2031 |
| 270 | Ga0496111_0110685 | 3300048914 | Bacteria | 2022 |
| 271 | Ga0496112_0001126 | 3300048915 | Bacteria | 19883 |
| 272 | Ga0496112_0005330 | 3300048915 | Bacteria | 11101 |
| 273 | Ga0496113_0001887 | 3300048916 | Bacteria | 11953 |
| 274 | Ga0496113_0031666 | 3300048916 | Bacteria | 3840 |
| 275 | Ga0496113_0130424 | 3300048916 | Bacteria | 1972 |
| 276 | Ga0496114_0038297 | 3300048917 | Bacteria | 3967 |
| 277 | Ga0496114_0107741 | 3300048917 | Bacteria | 2385 |
| 278 | Ga0496114_0593368 | 3300048917 | Bacteria | 977 |
| 279 | Ga0496115_0089299 | 3300048918 | Bacteria | 2517 |
| 280 | Ga0496115_0535167 | 3300048918 | Bacteria | 938 |
| 281 | Ga0496115_0672587 | 3300048918 | Bacteria | 816 |
| 282 | Ga0496116_0000331 | 3300048919 | Bacteria | 76536 |
| 283 | Ga0496117_0112486 | 3300048920 | Bacteria | 1693 |
| 284 | Ga0496118_0019611 | 3300048921 | Bacteria | 6038 |
| 285 | Ga0496119_0000837 | 3300048922 | Bacteria | 40910 |
| 286 | Ga0496119_0215161 | 3300048922 | Bacteria | 986 |
| 287 | Ga0496120_0001336 | 3300048923 | Bacteria | 30395 |
| 288 | Ga0496121_0040633 | 3300048924 | Bacteria | 4077 |
| 289 | Ga0496125_0037810 | 3300048928 | Bacteria | 4192 |
| 290 | Ga0501047_0058568 | 3300049581 | Bacteria | 3721 |
| 291 | Ga0501083_0007505 | 3300049744 | Bacteria | 7726 |
| 292 | Ga0501083_0078026 | 3300049744 | Bacteria | 2197 |
| 293 | Ga0501044_0056136 | 3300049823 | Bacteria | 4043 |
| 294 | Ga0501044_0262761 | 3300049823 | Bacteria | 1664 |
| 295 | nmdc:mga0n895_1114027_c1 | 3300050512 | Bacteria | 766 |
| 296 | nmdc:mga0n895_146220_c1 | 3300050512 | Bacteria | 2393 |
| 297 | nmdc:mga0n895_452931_c1 | 3300050512 | Bacteria | 1295 |
| 298 | nmdc:mga0rr50_218455_c1 | 3300050513 | Bacteria | 1573 |
| 299 | nmdc:mga0a205_906479_c1 | 3300050515 | Bacteria | 728 |
| 300 | Ga0495601_0003055 | 3300053077 | Bacteria | 9541 |
| 301 | Ga0495612_0362041 | 3300053078 | Bacteria | 656 |
| 302 | Ga0495612_0525421 | 3300053078 | Unclassified | 544 |
| 303 | Ga0495595_0089604 | 3300053084 | Bacteria | 1475 |
| 304 | Ga0495619_0002184 | 3300053085 | Bacteria | 12959 |
| 305 | Ga0500595_012372 | 3300053119 | Bacteria | 3304 |
| 306 | Ga0500568_0240256 | 3300053139 | Bacteria | 660 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005466 | Ga0070685_11381140 | Ga0070685_113811401 | 121 |
| 2 | 3300009551 | Ga0105238_11644161 | Ga0105238_116441611 | 121 |
| 3 | 3300025929 | Ga0207664_10620332 | Ga0207664_106203322 | 121 |
| 4 | 3300048905 | Ga0496102_1259348 | Ga0496102_1259348_71_490 | 121 |
| 5 | 3300053119 | Ga0500595_012372 | Ga0500595_012372_486_899 | 124 |
| 6 | 3300046463 | Ga0495653_0257662 | Ga0495653_0257662_524_907 | 126 |
| 7 | 3300005545 | Ga0070695_100759150 | Ga0070695_1007591502 | 128 |
| 8 | 3300005456 | Ga0070678_100006342 | Ga0070678_1000063424 | 129 |
| 9 | 3300047317 | Ga0495604_0578834 | Ga0495604_0578834_14_406 | 129 |
| 10 | 3300039450 | Ga0436363_0882351 | Ga0436363_0882351_31_441 | 133 |
| 11 | 3300039450 | Ga0436363_1201535 | Ga0436363_1201535_1162_1572 | 133 |
| 12 | 3300039450 | Ga0436363_1447314 | Ga0436363_1447314_2850_3260 | 133 |
| 13 | 3300039453 | Ga0436362_1290985 | Ga0436362_1290985_142_552 | 133 |
| 14 | 3300005445 | Ga0070708_100579016 | Ga0070708_1005790162 | 134 |
| 15 | 3300005467 | Ga0070706_100138143 | Ga0070706_1001381433 | 134 |
| 16 | 3300005471 | Ga0070698_100424683 | Ga0070698_1004246832 | 134 |
| 17 | 3300005518 | Ga0070699_100641007 | Ga0070699_1006410072 | 134 |
| 18 | 3300025910 | Ga0207684_10406450 | Ga0207684_104064501 | 134 |
| 19 | 3300025922 | Ga0207646_10216420 | Ga0207646_102164203 | 134 |
| 20 | 3300046462 | Ga0495651_0113412 | Ga0495651_0113412_264_677 | 134 |
| 21 | 3300046516 | Ga0495628_0530617 | Ga0495628_0530617_410_823 | 134 |
| 22 | 3300005564 | Ga0070664_101683150 | Ga0070664_1016831501 | 135 |
| 23 | 3300005981 | Ga0081538_10278631 | Ga0081538_102786312 | 135 |
| 24 | 3300037418 | Ga0395900_0233493 | Ga0395900_0233493_1380_1790 | 135 |
| 25 | 3300037466 | Ga0395898_0379591 | Ga0395898_0379591_220_630 | 135 |
| 26 | 3300038443 | Ga0395901_0245398 | Ga0395901_0245398_381_791 | 135 |
| 27 | 3300044693 | Ga0466961_0473666 | Ga0466961_0473666_79_495 | 135 |
| 28 | 3300044842 | Ga0466957_0153691 | Ga0466957_0153691_544_960 | 135 |
| 29 | 3300046477 | Ga0495664_0595294 | Ga0495664_0595294_81_488 | 135 |
| 30 | 3300048911 | Ga0496108_0628196 | Ga0496108_0628196_168_578 | 135 |
| 31 | 3300003373 | JGI25407J50210_10169364 | JGI25407J50210_101693641 | 136 |
| 32 | 3300005329 | Ga0070683_100118547 | Ga0070683_1001185473 | 136 |
| 33 | 3300005329 | Ga0070683_101165497 | Ga0070683_1011654971 | 136 |
| 34 | 3300005355 | Ga0070671_100199007 | Ga0070671_1001990071 | 136 |
| 35 | 3300005434 | Ga0070709_10136560 | Ga0070709_101365601 | 136 |
| 36 | 3300005435 | Ga0070714_100014351 | Ga0070714_1000143512 | 136 |
| 37 | 3300005435 | Ga0070714_100278839 | Ga0070714_1002788392 | 136 |
| 38 | 3300005436 | Ga0070713_100338210 | Ga0070713_1003382101 | 136 |
| 39 | 3300005436 | Ga0070713_100396071 | Ga0070713_1003960711 | 136 |
| 40 | 3300005439 | Ga0070711_100057087 | Ga0070711_1000570873 | 136 |
| 41 | 3300005458 | Ga0070681_10330583 | Ga0070681_103305832 | 136 |
| 42 | 3300005467 | Ga0070706_100058997 | Ga0070706_1000589973 | 136 |
| 43 | 3300005468 | Ga0070707_100328397 | Ga0070707_1003283972 | 136 |
| 44 | 3300005471 | Ga0070698_100659675 | Ga0070698_1006596751 | 136 |
| 45 | 3300005518 | Ga0070699_100284478 | Ga0070699_1002844782 | 136 |
| 46 | 3300005530 | Ga0070679_100072055 | Ga0070679_1000720552 | 136 |
| 47 | 3300005535 | Ga0070684_100030362 | Ga0070684_1000303625 | 136 |
| 48 | 3300005536 | Ga0070697_100430382 | Ga0070697_1004303821 | 136 |
| 49 | 3300005549 | Ga0070704_100627930 | Ga0070704_1006279302 | 136 |
| 50 | 3300005563 | Ga0068855_101071823 | Ga0068855_1010718231 | 136 |
| 51 | 3300005564 | Ga0070664_102167297 | Ga0070664_1021672971 | 136 |
| 52 | 3300005577 | Ga0068857_100046968 | Ga0068857_1000469684 | 136 |
| 53 | 3300005614 | Ga0068856_100079329 | Ga0068856_1000793294 | 136 |
| 54 | 3300005981 | Ga0081538_10040194 | Ga0081538_100401942 | 136 |
| 55 | 3300006028 | Ga0070717_10143950 | Ga0070717_101439502 | 136 |
| 56 | 3300006852 | Ga0075433_10743194 | Ga0075433_107431942 | 136 |
| 57 | 3300006871 | Ga0075434_100823486 | Ga0075434_1008234862 | 136 |
| 58 | 3300006914 | Ga0075436_100917575 | Ga0075436_1009175751 | 136 |
| 59 | 3300007076 | Ga0075435_100168894 | Ga0075435_1001688943 | 136 |
| 60 | 3300007076 | Ga0075435_101008716 | Ga0075435_1010087161 | 136 |
| 61 | 3300009174 | Ga0105241_11298194 | Ga0105241_112981941 | 136 |
| 62 | 3300013105 | Ga0157369_11578943 | Ga0157369_115789431 | 136 |
| 63 | 3300013307 | Ga0157372_11521864 | Ga0157372_115218642 | 136 |
| 64 | 3300020069 | Ga0197907_11043966 | Ga0197907_110439661 | 136 |
| 65 | 3300020075 | Ga0206349_1636136 | Ga0206349_16361362 | 136 |
| 66 | 3300020076 | Ga0206355_1084253 | Ga0206355_10842531 | 136 |
| 67 | 3300020078 | Ga0206352_10929549 | Ga0206352_109295491 | 136 |
| 68 | 3300020080 | Ga0206350_11333701 | Ga0206350_113337011 | 136 |
| 69 | 3300020081 | Ga0206354_10222355 | Ga0206354_102223552 | 136 |
| 70 | 3300020082 | Ga0206353_11117393 | Ga0206353_111173931 | 136 |
| 71 | 3300021358 | Ga0213873_10022600 | Ga0213873_100226001 | 136 |
| 72 | 3300021358 | Ga0213873_10023621 | Ga0213873_100236213 | 136 |
| 73 | 3300021377 | Ga0213874_10024459 | Ga0213874_100244592 | 136 |
| 74 | 3300021377 | Ga0213874_10032306 | Ga0213874_100323062 | 136 |
| 75 | 3300021384 | Ga0213876_10011234 | Ga0213876_100112346 | 136 |
| 76 | 3300021384 | Ga0213876_10059767 | Ga0213876_100597672 | 136 |
| 77 | 3300021384 | Ga0213876_10459216 | Ga0213876_104592161 | 136 |
| 78 | 3300021388 | Ga0213875_10000433 | Ga0213875_100004336 | 136 |
| 79 | 3300021388 | Ga0213875_10008572 | Ga0213875_100085724 | 136 |
| 80 | 3300021388 | Ga0213875_10073821 | Ga0213875_100738211 | 136 |
| 81 | 3300022467 | Ga0224712_10281684 | Ga0224712_102816841 | 136 |
| 82 | 3300025910 | Ga0207684_10043657 | Ga0207684_100436574 | 136 |
| 83 | 3300025912 | Ga0207707_10591637 | Ga0207707_105916372 | 136 |
| 84 | 3300025917 | Ga0207660_10645083 | Ga0207660_106450832 | 136 |
| 85 | 3300025919 | Ga0207657_10031992 | Ga0207657_100319925 | 136 |
| 86 | 3300025922 | Ga0207646_10097109 | Ga0207646_100971092 | 136 |
| 87 | 3300025928 | Ga0207700_10178794 | Ga0207700_101787942 | 136 |
| 88 | 3300025928 | Ga0207700_11541350 | Ga0207700_115413501 | 136 |
| 89 | 3300025929 | Ga0207664_10000006 | Ga0207664_1000000620 | 136 |
| 90 | 3300025929 | Ga0207664_10005119 | Ga0207664_100051192 | 136 |
| 91 | 3300025931 | Ga0207644_10772678 | Ga0207644_107726781 | 136 |
| 92 | 3300025939 | Ga0207665_10018329 | Ga0207665_100183292 | 136 |
| 93 | 3300026078 | Ga0207702_10004876 | Ga0207702_100048762 | 136 |
| 94 | 3300026078 | Ga0207702_10969161 | Ga0207702_109691611 | 136 |
| 95 | 3300026116 | Ga0207674_10083283 | Ga0207674_100832832 | 136 |
| 96 | 3300032126 | Ga0307415_100531760 | Ga0307415_1005317602 | 136 |
| 97 | 3300035117 | Ga0373953_0054028 | Ga0373953_0054028_428_841 | 136 |
| 98 | 3300035692 | Ga0373935_0767776 | Ga0373935_0767776_276_689 | 136 |
| 99 | 3300037418 | Ga0395900_0929708 | Ga0395900_0929708_91_504 | 136 |
| 100 | 3300037466 | Ga0395898_0797027 | Ga0395898_0797027_172_585 | 136 |
| 101 | 3300037853 | Ga0436364_0638229 | Ga0436364_0638229_487_906 | 136 |
| 102 | 3300037853 | Ga0436364_1040466 | Ga0436364_1040466_26658_27077 | 136 |
| 103 | 3300037853 | Ga0436364_1132411 | Ga0436364_1132411_53671_54090 | 136 |
| 104 | 3300037853 | Ga0436364_1427311 | Ga0436364_1427311_43202_43615 | 136 |
| 105 | 3300039437 | Ga0436365_0071633 | Ga0436365_0071633_4818_5237 | 136 |
| 106 | 3300039437 | Ga0436365_0430923 | Ga0436365_0430923_1650_2069 | 136 |
| 107 | 3300039437 | Ga0436365_0601902 | Ga0436365_0601902_1594_2013 | 136 |
| 108 | 3300039437 | Ga0436365_1468228 | Ga0436365_1468228_2336_2755 | 136 |
| 109 | 3300039450 | Ga0436363_0400563 | Ga0436363_0400563_5242_5661 | 136 |
| 110 | 3300039450 | Ga0436363_1481028 | Ga0436363_1481028_458_877 | 136 |
| 111 | 3300039450 | Ga0436363_1527363 | Ga0436363_1527363_397_816 | 136 |
| 112 | 3300039453 | Ga0436362_0963702 | Ga0436362_0963702_2899_3318 | 136 |
| 113 | 3300039453 | Ga0436362_1079976 | Ga0436362_1079976_286_705 | 136 |
| 114 | 3300041512 | Ga0451853_0946713 | Ga0451853_0946713_133_552 | 136 |
| 115 | 3300044656 | Ga0466969_0339648 | Ga0466969_0339648_178_591 | 136 |
| 116 | 3300044684 | Ga0466966_0316895 | Ga0466966_0316895_226_645 | 136 |
| 117 | 3300044693 | Ga0466961_0226628 | Ga0466961_0226628_359_778 | 136 |
| 118 | 3300044693 | Ga0466961_0564999 | Ga0466961_0564999_93_512 | 136 |
| 119 | 3300044694 | Ga0466963_1206582 | Ga0466963_1206582_69_482 | 136 |
| 120 | 3300044706 | Ga0466964_0017369 | Ga0466964_0017369_1773_2192 | 136 |
| 121 | 3300044706 | Ga0466964_0141607 | Ga0466964_0141607_553_972 | 136 |
| 122 | 3300044735 | Ga0466968_0140716 | Ga0466968_0140716_359_778 | 136 |
| 123 | 3300044765 | Ga0466970_0196275 | Ga0466970_0196275_601_1020 | 136 |
| 124 | 3300045049 | Ga0466959_0210823 | Ga0466959_0210823_405_824 | 136 |
| 125 | 3300045836 | Ga0466958_0010651 | Ga0466958_0010651_733_1152 | 136 |
| 126 | 3300045836 | Ga0466958_0023418 | Ga0466958_0023418_1251_1670 | 136 |
| 127 | 3300045836 | Ga0466958_0516335 | Ga0466958_0516335_36_455 | 136 |
| 128 | 3300045976 | Ga0466967_0030624 | Ga0466967_0030624_2805_3224 | 136 |
| 129 | 3300045976 | Ga0466967_0058534 | Ga0466967_0058534_1094_1513 | 136 |
| 130 | 3300046511 | Ga0495608_0422397 | Ga0495608_0422397_268_681 | 136 |
| 131 | 3300046514 | Ga0495618_0000799 | Ga0495618_0000799_17751_18170 | 136 |
| 132 | 3300046514 | Ga0495618_0557731 | Ga0495618_0557731_253_672 | 136 |
| 133 | 3300046516 | Ga0495628_0932246 | Ga0495628_0932246_68_487 | 136 |
| 134 | 3300046517 | Ga0495630_0030495 | Ga0495630_0030495_2680_3099 | 136 |
| 135 | 3300046529 | Ga0495652_0188597 | Ga0495652_0188597_1027_1440 | 136 |
| 136 | 3300046663 | Ga0495635_0433603 | Ga0495635_0433603_24_437 | 136 |
| 137 | 3300046678 | Ga0495599_0247643 | Ga0495599_0247643_556_975 | 136 |
| 138 | 3300046680 | Ga0495646_0580942 | Ga0495646_0580942_79_492 | 136 |
| 139 | 3300046689 | Ga0495613_0541129 | Ga0495613_0541129_273_692 | 136 |
| 140 | 3300047317 | Ga0495604_0228171 | Ga0495604_0228171_791_1210 | 136 |
| 141 | 3300047319 | Ga0495674_0208346 | Ga0495674_0208346_1061_1480 | 136 |
| 142 | 3300047319 | Ga0495674_0369859 | Ga0495674_0369859_120_533 | 136 |
| 143 | 3300048907 | Ga0496104_0014363 | Ga0496104_0014363_6111_6524 | 136 |
| 144 | 3300048907 | Ga0496104_0050134 | Ga0496104_0050134_1117_1530 | 136 |
| 145 | 3300048907 | Ga0496104_0568882 | Ga0496104_0568882_154_573 | 136 |
| 146 | 3300048908 | Ga0496105_0135608 | Ga0496105_0135608_254_667 | 136 |
| 147 | 3300048909 | Ga0496106_0541720 | Ga0496106_0541720_48_461 | 136 |
| 148 | 3300048910 | Ga0496107_0211048 | Ga0496107_0211048_450_863 | 136 |
| 149 | 3300048911 | Ga0496108_0062060 | Ga0496108_0062060_269_682 | 136 |
| 150 | 3300048911 | Ga0496108_0234261 | Ga0496108_0234261_123_536 | 136 |
| 151 | 3300048912 | Ga0496109_0148152 | Ga0496109_0148152_274_693 | 136 |
| 152 | 3300048912 | Ga0496109_0429950 | Ga0496109_0429950_264_677 | 136 |
| 153 | 3300048913 | Ga0496110_0073637 | Ga0496110_0073637_2281_2700 | 136 |
| 154 | 3300048913 | Ga0496110_1468664 | Ga0496110_1468664_80_499 | 136 |
| 155 | 3300048914 | Ga0496111_0110685 | Ga0496111_0110685_1109_1528 | 136 |
| 156 | 3300048915 | Ga0496112_0001126 | Ga0496112_0001126_6847_7260 | 136 |
| 157 | 3300048916 | Ga0496113_0031666 | Ga0496113_0031666_101_514 | 136 |
| 158 | 3300048916 | Ga0496113_0130424 | Ga0496113_0130424_1503_1922 | 136 |
| 159 | 3300048917 | Ga0496114_0107741 | Ga0496114_0107741_335_748 | 136 |
| 160 | 3300048918 | Ga0496115_0089299 | Ga0496115_0089299_953_1366 | 136 |
| 161 | 3300048918 | Ga0496115_0535167 | Ga0496115_0535167_69_482 | 136 |
| 162 | 3300048918 | Ga0496115_0672587 | Ga0496115_0672587_104_517 | 136 |
| 163 | 3300048922 | Ga0496119_0000837 | Ga0496119_0000837_27305_27724 | 136 |
| 164 | 3300049823 | Ga0501044_0262761 | Ga0501044_0262761_429_842 | 136 |
| 165 | 3300050512 | nmdc:mga0n895_1114027_c1 | nmdc:mga0n895_1114027_c1_185_598 | 136 |
| 166 | 3300050512 | nmdc:mga0n895_452931_c1 | nmdc:mga0n895_452931_c1_440_859 | 136 |
| 167 | 3300050513 | nmdc:mga0rr50_218455_c1 | nmdc:mga0rr50_218455_c1_692_1111 | 136 |
| 168 | 3300050515 | nmdc:mga0a205_906479_c1 | nmdc:mga0a205_906479_c1_258_677 | 136 |
| 169 | 3300053078 | Ga0495612_0525421 | Ga0495612_0525421_81_500 | 136 |
| 170 | 3300053084 | Ga0495595_0089604 | Ga0495595_0089604_253_672 | 136 |
| 171 | 3300001989 | JGI24739J22299_10149473 | JGI24739J22299_101494732 | 137 |
| 172 | 3300005329 | Ga0070683_100001376 | Ga0070683_10000137615 | 137 |
| 173 | 3300005330 | Ga0070690_100407453 | Ga0070690_1004074532 | 137 |
| 174 | 3300005334 | Ga0068869_100058154 | Ga0068869_1000581542 | 137 |
| 175 | 3300005337 | Ga0070682_100004885 | Ga0070682_1000048858 | 137 |
| 176 | 3300005338 | Ga0068868_100002487 | Ga0068868_10000248711 | 137 |
| 177 | 3300005339 | Ga0070660_100261892 | Ga0070660_1002618922 | 137 |
| 178 | 3300005340 | Ga0070689_100072030 | Ga0070689_1000720303 | 137 |
| 179 | 3300005341 | Ga0070691_10093240 | Ga0070691_100932402 | 137 |
| 180 | 3300005345 | Ga0070692_10732742 | Ga0070692_107327422 | 137 |
| 181 | 3300005347 | Ga0070668_100197364 | Ga0070668_1001973642 | 137 |
| 182 | 3300005354 | Ga0070675_100230288 | Ga0070675_1002302882 | 137 |
| 183 | 3300005356 | Ga0070674_100042920 | Ga0070674_1000429201 | 137 |
| 184 | 3300005364 | Ga0070673_100102269 | Ga0070673_1001022692 | 137 |
| 185 | 3300005365 | Ga0070688_100130989 | Ga0070688_1001309892 | 137 |
| 186 | 3300005366 | Ga0070659_100016968 | Ga0070659_1000169686 | 137 |
| 187 | 3300005439 | Ga0070711_100094853 | Ga0070711_1000948533 | 137 |
| 188 | 3300005441 | Ga0070700_100011711 | Ga0070700_1000117114 | 137 |
| 189 | 3300005455 | Ga0070663_100018497 | Ga0070663_1000184974 | 137 |
| 190 | 3300005456 | Ga0070678_100036351 | Ga0070678_1000363512 | 137 |
| 191 | 3300005466 | Ga0070685_10032166 | Ga0070685_100321662 | 137 |
| 192 | 3300005535 | Ga0070684_100015680 | Ga0070684_1000156804 | 137 |
| 193 | 3300005535 | Ga0070684_100590807 | Ga0070684_1005908072 | 137 |
| 194 | 3300005549 | Ga0070704_100067392 | Ga0070704_1000673922 | 137 |
| 195 | 3300005564 | Ga0070664_100087020 | Ga0070664_1000870202 | 137 |
| 196 | 3300005578 | Ga0068854_100663010 | Ga0068854_1006630102 | 137 |
| 197 | 3300005614 | Ga0068856_100011858 | Ga0068856_1000118587 | 137 |
| 198 | 3300005615 | Ga0070702_100002872 | Ga0070702_1000028724 | 137 |
| 199 | 3300005616 | Ga0068852_100156000 | Ga0068852_1001560002 | 137 |
| 200 | 3300005617 | Ga0068859_100461406 | Ga0068859_1004614062 | 137 |
| 201 | 3300005618 | Ga0068864_100028058 | Ga0068864_1000280586 | 137 |
| 202 | 3300005719 | Ga0068861_100566871 | Ga0068861_1005668712 | 137 |
| 203 | 3300005834 | Ga0068851_10167286 | Ga0068851_101672862 | 137 |
| 204 | 3300005841 | Ga0068863_100154597 | Ga0068863_1001545972 | 137 |
| 205 | 3300006173 | Ga0070716_100077182 | Ga0070716_1000771823 | 137 |
| 206 | 3300006175 | Ga0070712_100020039 | Ga0070712_1000200394 | 137 |
| 207 | 3300006237 | Ga0097621_100260101 | Ga0097621_1002601012 | 137 |
| 208 | 3300006871 | Ga0075434_100062679 | Ga0075434_1000626796 | 137 |
| 209 | 3300006881 | Ga0068865_100052914 | Ga0068865_1000529143 | 137 |
| 210 | 3300006931 | Ga0097620_100461427 | Ga0097620_1004614272 | 137 |
| 211 | 3300009036 | Ga0105244_10444847 | Ga0105244_104448472 | 137 |
| 212 | 3300009098 | Ga0105245_10019225 | Ga0105245_100192252 | 137 |
| 213 | 3300009098 | Ga0105245_11135054 | Ga0105245_111350542 | 137 |
| 214 | 3300009147 | Ga0114129_11635761 | Ga0114129_116357611 | 137 |
| 215 | 3300009176 | Ga0105242_10475127 | Ga0105242_104751272 | 137 |
| 216 | 3300009551 | Ga0105238_10463290 | Ga0105238_104632902 | 137 |
| 217 | 3300010375 | Ga0105239_10136026 | Ga0105239_101360263 | 137 |
| 218 | 3300011119 | Ga0105246_10109333 | Ga0105246_101093333 | 137 |
| 219 | 3300013296 | Ga0157374_10005605 | Ga0157374_100056055 | 137 |
| 220 | 3300013297 | Ga0157378_10078884 | Ga0157378_100788843 | 137 |
| 221 | 3300013306 | Ga0163162_10700853 | Ga0163162_107008532 | 137 |
| 222 | 3300013307 | Ga0157372_10044418 | Ga0157372_100444187 | 137 |
| 223 | 3300013308 | Ga0157375_10027006 | Ga0157375_100270065 | 137 |
| 224 | 3300014325 | Ga0163163_10040439 | Ga0163163_100404396 | 137 |
| 225 | 3300014745 | Ga0157377_10006343 | Ga0157377_100063432 | 137 |
| 226 | 3300014969 | Ga0157376_10207235 | Ga0157376_102072352 | 137 |
| 227 | 3300020070 | Ga0206356_10968391 | Ga0206356_109683911 | 137 |
| 228 | 3300020082 | Ga0206353_10581476 | Ga0206353_105814761 | 137 |
| 229 | 3300025901 | Ga0207688_10004068 | Ga0207688_100040685 | 137 |
| 230 | 3300025913 | Ga0207695_10827494 | Ga0207695_108274942 | 137 |
| 231 | 3300025915 | Ga0207693_10025726 | Ga0207693_100257262 | 137 |
| 232 | 3300025916 | Ga0207663_10096974 | Ga0207663_100969743 | 137 |
| 233 | 3300025918 | Ga0207662_10048379 | Ga0207662_100483791 | 137 |
| 234 | 3300025919 | Ga0207657_10104887 | Ga0207657_101048872 | 137 |
| 235 | 3300025920 | Ga0207649_10018082 | Ga0207649_100180824 | 137 |
| 236 | 3300025923 | Ga0207681_11194457 | Ga0207681_111944571 | 137 |
| 237 | 3300025924 | Ga0207694_10204524 | Ga0207694_102045242 | 137 |
| 238 | 3300025926 | Ga0207659_10128874 | Ga0207659_101288742 | 137 |
| 239 | 3300025927 | Ga0207687_10044151 | Ga0207687_100441514 | 137 |
| 240 | 3300025931 | Ga0207644_10551848 | Ga0207644_105518482 | 137 |
| 241 | 3300025932 | Ga0207690_10124250 | Ga0207690_101242502 | 137 |
| 242 | 3300025933 | Ga0207706_10049738 | Ga0207706_100497382 | 137 |
| 243 | 3300025936 | Ga0207670_10070280 | Ga0207670_100702803 | 137 |
| 244 | 3300025938 | Ga0207704_10030038 | Ga0207704_100300382 | 137 |
| 245 | 3300025941 | Ga0207711_10342423 | Ga0207711_103424232 | 137 |
| 246 | 3300025942 | Ga0207689_10084475 | Ga0207689_100844752 | 137 |
| 247 | 3300025945 | Ga0207679_11190614 | Ga0207679_111906142 | 137 |
| 248 | 3300025960 | Ga0207651_11058172 | Ga0207651_110581722 | 137 |
| 249 | 3300025961 | Ga0207712_10240426 | Ga0207712_102404262 | 137 |
| 250 | 3300025972 | Ga0207668_10060112 | Ga0207668_100601123 | 137 |
| 251 | 3300025981 | Ga0207640_10038830 | Ga0207640_100388301 | 137 |
| 252 | 3300026023 | Ga0207677_10033375 | Ga0207677_100333753 | 137 |
| 253 | 3300026067 | Ga0207678_10026271 | Ga0207678_100262712 | 137 |
| 254 | 3300026075 | Ga0207708_10000245 | Ga0207708_100002459 | 137 |
| 255 | 3300026078 | Ga0207702_10086306 | Ga0207702_100863062 | 137 |
| 256 | 3300026088 | Ga0207641_11583359 | Ga0207641_115833592 | 137 |
| 257 | 3300026089 | Ga0207648_10189390 | Ga0207648_101893902 | 137 |
| 258 | 3300026095 | Ga0207676_10043587 | Ga0207676_100435873 | 137 |
| 259 | 3300026118 | Ga0207675_100656846 | Ga0207675_1006568462 | 137 |
| 260 | 3300026121 | Ga0207683_10001623 | Ga0207683_1000162315 | 137 |
| 261 | 3300026121 | Ga0207683_10080218 | Ga0207683_100802183 | 137 |
| 262 | 3300026142 | Ga0207698_10054557 | Ga0207698_100545573 | 137 |
| 263 | 3300027907 | Ga0207428_10113670 | Ga0207428_101136702 | 137 |
| 264 | 3300028380 | Ga0268265_10193878 | Ga0268265_101938782 | 137 |
| 265 | 3300037466 | Ga0395898_0094050 | Ga0395898_0094050_2316_2729 | 137 |
| 266 | 3300038443 | Ga0395901_0375796 | Ga0395901_0375796_222_635 | 137 |
| 267 | 3300039450 | Ga0436363_0982158 | Ga0436363_0982158_59_481 | 137 |
| 268 | 3300044706 | Ga0466964_0390937 | Ga0466964_0390937_272_688 | 137 |
| 269 | 3300045976 | Ga0466967_0083097 | Ga0466967_0083097_1576_1992 | 137 |
| 270 | 3300046516 | Ga0495628_0505102 | Ga0495628_0505102_351_773 | 137 |
| 271 | 3300046517 | Ga0495630_0000256 | Ga0495630_0000256_36410_36823 | 137 |
| 272 | 3300046525 | Ga0495663_0128243 | Ga0495663_0128243_42_458 | 137 |
| 273 | 3300046642 | Ga0495634_0396159 | Ga0495634_0396159_243_656 | 137 |
| 274 | 3300046690 | Ga0495624_0218566 | Ga0495624_0218566_208_621 | 137 |
| 275 | 3300048903 | Ga0496100_0019768 | Ga0496100_0019768_385_798 | 137 |
| 276 | 3300048905 | Ga0496102_0115168 | Ga0496102_0115168_480_893 | 137 |
| 277 | 3300048905 | Ga0496102_0689675 | Ga0496102_0689675_106_519 | 137 |
| 278 | 3300048906 | Ga0496103_0475615 | Ga0496103_0475615_68_481 | 137 |
| 279 | 3300048907 | Ga0496104_0794625 | Ga0496104_0794625_197_610 | 137 |
| 280 | 3300048908 | Ga0496105_0020263 | Ga0496105_0020263_2980_3393 | 137 |
| 281 | 3300048909 | Ga0496106_0018838 | Ga0496106_0018838_2216_2629 | 137 |
| 282 | 3300048910 | Ga0496107_0037228 | Ga0496107_0037228_1666_2079 | 137 |
| 283 | 3300048911 | Ga0496108_0017174 | Ga0496108_0017174_2060_2473 | 137 |
| 284 | 3300048912 | Ga0496109_0019734 | Ga0496109_0019734_2499_2912 | 137 |
| 285 | 3300048913 | Ga0496110_0059596 | Ga0496110_0059596_2217_2630 | 137 |
| 286 | 3300048914 | Ga0496111_0109750 | Ga0496111_0109750_146_559 | 137 |
| 287 | 3300048915 | Ga0496112_0005330 | Ga0496112_0005330_6613_7026 | 137 |
| 288 | 3300048916 | Ga0496113_0001887 | Ga0496113_0001887_6740_7153 | 137 |
| 289 | 3300048917 | Ga0496114_0038297 | Ga0496114_0038297_1523_1936 | 137 |
| 290 | 3300048917 | Ga0496114_0593368 | Ga0496114_0593368_162_578 | 137 |
| 291 | 3300048919 | Ga0496116_0000331 | Ga0496116_0000331_55523_55936 | 137 |
| 292 | 3300048920 | Ga0496117_0112486 | Ga0496117_0112486_56_469 | 137 |
| 293 | 3300048921 | Ga0496118_0019611 | Ga0496118_0019611_2645_3058 | 137 |
| 294 | 3300048922 | Ga0496119_0215161 | Ga0496119_0215161_444_857 | 137 |
| 295 | 3300048923 | Ga0496120_0001336 | Ga0496120_0001336_24017_24430 | 137 |
| 296 | 3300048924 | Ga0496121_0040633 | Ga0496121_0040633_144_557 | 137 |
| 297 | 3300048928 | Ga0496125_0037810 | Ga0496125_0037810_1167_1580 | 137 |
| 298 | 3300049581 | Ga0501047_0058568 | Ga0501047_0058568_222_635 | 137 |
| 299 | 3300049744 | Ga0501083_0007505 | Ga0501083_0007505_1944_2357 | 137 |
| 300 | 3300049744 | Ga0501083_0078026 | Ga0501083_0078026_1448_1861 | 137 |
| 301 | 3300049823 | Ga0501044_0056136 | Ga0501044_0056136_1884_2297 | 137 |
| 302 | 3300050512 | nmdc:mga0n895_146220_c1 | nmdc:mga0n895_146220_c1_355_768 | 137 |
| 303 | 3300053077 | Ga0495601_0003055 | Ga0495601_0003055_7254_7667 | 137 |
| 304 | 3300053078 | Ga0495612_0362041 | Ga0495612_0362041_195_641 | 137 |
| 305 | 3300053085 | Ga0495619_0002184 | Ga0495619_0002184_1606_2019 | 137 |
| 306 | 3300053139 | Ga0500568_0240256 | Ga0500568_0240256_219_632 | 137 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1kmz-assembly1.cif.gz_A | molecular basis of mitomycin c resictance in streptomyces: crystal structures of the mrd protein with and without a drug derivative | 0.7899 | 6 | 132 |
| 1kmz-assembly1.cif.gz_A | molecular basis of mitomycin c resictance in streptomyces: crystal structures of the mrd protein with and without a drug derivative | 0.7578 | 6 | 132 |
| 4rt5-assembly1.cif.gz_B | the crystal structure of a glyoxalase/bleomycin resistance protein/dioxygenase protein from planctomyces limnophilus dsm 3776 | 0.699 | 2 | 135 |
| 2r6u-assembly2.cif.gz_D | crystal structure of gene product rha04853 from rhodococcus sp. rha1 | 0.6972 | 3 | 133 |
| 2i4e-assembly2.cif.gz_B | structural studies of protein tyrosine phosphatase beta catalytic domain in complex with inhibitors | 0.6898 | 102 | 132 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2kjzB02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.9086 | 79 | 132 | 3.30.720.110 |
| af_P9WKQ3_98_165_3.30.720.110 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8527 | 74 | 132 | 3.30.720.110 |
| 2kjzB02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8371 | 79 | 132 | 3.30.720.110 |
| 3m2oB02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8304 | 79 | 130 | 3.30.720.110 |
| 3sk1A02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8048 | 81 | 133 | 3.30.720.110 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6L7X5H9-F1-model_v4 | VOC family protein | 0.979 | 81 | 134 |
|
| AF-A0A431R9P7-F1-model_v4 | VOC family protein | 0.9783 | 81 | 137 |
|
| AF-K2AJS8-F1-model_v4 | Glyoxalase/bleomycin resistance protein/dioxygenase | 0.978 | 79 | 134 |
GO:0051213
|
| AF-A0A7W0G7P7-F1-model_v4 | VOC family protein | 0.9779 | 83 | 134 |
|
| AF-A0A259IWH6-F1-model_v4 | Glyoxalase | 0.977 | 79 | 134 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar