F398910

General Info

Members Datasets Scaffolds Average Seq Length
306 206 306 137

Family's Representative Sequence

Representative Sequence 3300053078|Ga0495612_0362041|Ga0495612_0362041_195_641
Length 148
Sequence MQSRGGGAVDIEFLSTVAVIAPDPPASRKLYVDALGLPLKSGGDDEYHHSERIAGCKSFGIWPLSQAAEACFGTPEWPAERPVPQVSIEFDVADAAAVTLAARELEQAGYELLHPPREEPWGQTVARLQSPEGAIVGISYAPVLHDQH

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
82 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
87 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
90 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
136 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
143 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
144 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
145 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
146 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
147 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
148 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
149 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
150 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
151 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
152 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
153 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
154 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
155 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
156 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
157 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
158 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
159 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
160 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
161 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
162 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
163 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
164 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
165 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
166 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
167 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
168 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
169 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
170 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
171 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
172 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
173 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
176 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
177 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
182 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
183 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
186 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
187 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
188 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
189 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
190 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
191 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
192 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
193 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
194 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
195 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
197 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
198 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
199 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
200 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
201 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
202 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
203 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
204 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
205 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
206 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.73
Metatranscriptomes 3.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.65
Nodule 0
Rhizoplane 12.42
Rhizosphere 76.47
Stem 0
Stem Tuber 0
Unclassified 10.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10149473 3300001989 Bacteria 691
2 JGI25407J50210_10169364 3300003373 Unclassified 538
3 Ga0070683_100001376 3300005329 Bacteria 18639
4 Ga0070683_100118547 3300005329 Bacteria 2499
5 Ga0070683_101165497 3300005329 Bacteria 740
6 Ga0070690_100407453 3300005330 Unclassified 1000
7 Ga0068869_100058154 3300005334 Bacteria 2826
8 Ga0070682_100004885 3300005337 Bacteria 7440
9 Ga0068868_100002487 3300005338 Bacteria 12790
10 Ga0070660_100261892 3300005339 Bacteria 1412
11 Ga0070689_100072030 3300005340 Bacteria 2701
12 Ga0070691_10093240 3300005341 Bacteria 1487
13 Ga0070692_10732742 3300005345 Bacteria 668
14 Ga0070668_100197364 3300005347 Bacteria 1651
15 Ga0070675_100230288 3300005354 Bacteria 1616
16 Ga0070671_100199007 3300005355 Bacteria 1699
17 Ga0070674_100042920 3300005356 Bacteria 3074
18 Ga0070673_100102269 3300005364 Bacteria 2362
19 Ga0070688_100130989 3300005365 Bacteria 1692
20 Ga0070659_100016968 3300005366 Bacteria 5474
21 Ga0070709_10136560 3300005434 Bacteria 1680
22 Ga0070714_100014351 3300005435 Bacteria 6363
23 Ga0070714_100278839 3300005435 Bacteria 1552
24 Ga0070713_100338210 3300005436 Unclassified 1394
25 Ga0070713_100396071 3300005436 Bacteria 1289
26 Ga0070711_100057087 3300005439 Bacteria 2702
27 Ga0070711_100094853 3300005439 Bacteria 2158
28 Ga0070700_100011711 3300005441 Bacteria 4867
29 Ga0070708_100579016 3300005445 Bacteria 1058
30 Ga0070663_100018497 3300005455 Bacteria 4571
31 Ga0070678_100006342 3300005456 Bacteria 6938
32 Ga0070678_100036351 3300005456 Bacteria 3447
33 Ga0070681_10330583 3300005458 Bacteria 1434
34 Ga0070685_10032166 3300005466 Bacteria 2937
35 Ga0070685_11381140 3300005466 Bacteria 540
36 Ga0070706_100058997 3300005467 Bacteria 3541
37 Ga0070706_100138143 3300005467 Bacteria 2274
38 Ga0070707_100328397 3300005468 Bacteria 1486
39 Ga0070698_100424683 3300005471 Bacteria 1264
40 Ga0070698_100659675 3300005471 Bacteria 987
41 Ga0070699_100284478 3300005518 Bacteria 1481
42 Ga0070699_100641007 3300005518 Bacteria 970
43 Ga0070679_100072055 3300005530 Bacteria 3447
44 Ga0070684_100015680 3300005535 Bacteria 6182
45 Ga0070684_100030362 3300005535 Bacteria 4591
46 Ga0070684_100590807 3300005535 Bacteria 1032
47 Ga0070697_100430382 3300005536 Bacteria 1147
48 Ga0070695_100759150 3300005545 Unclassified 774
49 Ga0070704_100067392 3300005549 Bacteria 2585
50 Ga0070704_100627930 3300005549 Bacteria 947
51 Ga0068855_101071823 3300005563 Unclassified 844
52 Ga0070664_100087020 3300005564 Bacteria 2700
53 Ga0070664_101683150 3300005564 Bacteria 601
54 Ga0070664_102167297 3300005564 Bacteria 527
55 Ga0068857_100046968 3300005577 Bacteria 3832
56 Ga0068854_100663010 3300005578 Bacteria 897
57 Ga0068856_100011858 3300005614 Bacteria 8442
58 Ga0068856_100079329 3300005614 Bacteria 3255
59 Ga0070702_100002872 3300005615 Bacteria 7566
60 Ga0068852_100156000 3300005616 Bacteria 2127
61 Ga0068859_100461406 3300005617 Bacteria 1366
62 Ga0068864_100028058 3300005618 Bacteria 4757
63 Ga0068861_100566871 3300005719 Bacteria 1037
64 Ga0068851_10167286 3300005834 Bacteria 1211
65 Ga0068863_100154597 3300005841 Bacteria 2196
66 Ga0081538_10040194 3300005981 Bacteria 2987
67 Ga0081538_10278631 3300005981 Unclassified 622
68 Ga0070717_10143950 3300006028 Bacteria 2058
69 Ga0070716_100077182 3300006173 Bacteria 1976
70 Ga0070712_100020039 3300006175 Bacteria 4372
71 Ga0097621_100260101 3300006237 Bacteria 1522
72 Ga0075433_10743194 3300006852 Unclassified 858
73 Ga0075434_100062679 3300006871 Bacteria 3701
74 Ga0075434_100823486 3300006871 Unclassified 944
75 Ga0068865_100052914 3300006881 Bacteria 2816
76 Ga0075436_100917575 3300006914 Unclassified 655
77 Ga0097620_100461427 3300006931 Bacteria 1366
78 Ga0075435_100168894 3300007076 Bacteria 1845
79 Ga0075435_101008716 3300007076 Unclassified 727
80 Ga0105244_10444847 3300009036 Bacteria 596
81 Ga0105245_10019225 3300009098 Bacteria 5981
82 Ga0105245_11135054 3300009098 Unclassified 828
83 Ga0114129_11635761 3300009147 Bacteria 787
84 Ga0105241_11298194 3300009174 Bacteria 693
85 Ga0105242_10475127 3300009176 Bacteria 1183
86 Ga0105238_10463290 3300009551 Bacteria 1265
87 Ga0105238_11644161 3300009551 Bacteria 673
88 Ga0105239_10136026 3300010375 Bacteria 2736
89 Ga0105246_10109333 3300011119 Bacteria 2028
90 Ga0157369_11578943 3300013105 Bacteria 667
91 Ga0157374_10005605 3300013296 Bacteria 10576
92 Ga0157378_10078884 3300013297 Bacteria 2972
93 Ga0163162_10700853 3300013306 Bacteria 1134
94 Ga0157372_10044418 3300013307 Bacteria 4924
95 Ga0157372_11521864 3300013307 Bacteria 771
96 Ga0157375_10027006 3300013308 Bacteria 5360
97 Ga0163163_10040439 3300014325 Bacteria 4552
98 Ga0157377_10006343 3300014745 Bacteria 5633
99 Ga0157376_10207235 3300014969 Bacteria 1808
100 Ga0197907_11043966 3300020069 Bacteria 811
101 Ga0206356_10968391 3300020070 Unclassified 506
102 Ga0206349_1636136 3300020075 Bacteria 1058
103 Ga0206355_1084253 3300020076 Bacteria 1131
104 Ga0206352_10929549 3300020078 Bacteria 792
105 Ga0206350_11333701 3300020080 Bacteria 953
106 Ga0206354_10222355 3300020081 Bacteria 1285
107 Ga0206353_10581476 3300020082 Unclassified 1132
108 Ga0206353_11117393 3300020082 Bacteria 1439
109 Ga0213873_10022600 3300021358 Bacteria 1491
110 Ga0213873_10023621 3300021358 Unclassified 1467
111 Ga0213874_10024459 3300021377 Bacteria 1694
112 Ga0213874_10032306 3300021377 Bacteria 1519
113 Ga0213876_10011234 3300021384 Bacteria 4784
114 Ga0213876_10059767 3300021384 Bacteria 2011
115 Ga0213876_10459216 3300021384 Bacteria 677
116 Ga0213875_10000433 3300021388 Bacteria 36593
117 Ga0213875_10008572 3300021388 Bacteria 5226
118 Ga0213875_10073821 3300021388 Bacteria 1591
119 Ga0224712_10281684 3300022467 Bacteria 774
120 Ga0207688_10004068 3300025901 Bacteria 7970
121 Ga0207684_10043657 3300025910 Bacteria 3801
122 Ga0207684_10406450 3300025910 Bacteria 1170
123 Ga0207707_10591637 3300025912 Unclassified 940
124 Ga0207695_10827494 3300025913 Bacteria 806
125 Ga0207693_10025726 3300025915 Bacteria 4664
126 Ga0207663_10096974 3300025916 Bacteria 1971
127 Ga0207660_10645083 3300025917 Unclassified 863
128 Ga0207662_10048379 3300025918 Bacteria 2519
129 Ga0207657_10031992 3300025919 Bacteria 4758
130 Ga0207657_10104887 3300025919 Bacteria 2341
131 Ga0207649_10018082 3300025920 Bacteria 4002
132 Ga0207646_10097109 3300025922 Bacteria 2639
133 Ga0207646_10216420 3300025922 Bacteria 1730
134 Ga0207681_11194457 3300025923 Bacteria 639
135 Ga0207694_10204524 3300025924 Bacteria 1607
136 Ga0207659_10128874 3300025926 Bacteria 1949
137 Ga0207687_10044151 3300025927 Bacteria 3074
138 Ga0207700_10178794 3300025928 Unclassified 1775
139 Ga0207700_11541350 3300025928 Bacteria 589
140 Ga0207664_10000006 3300025929 Bacteria 408702
141 Ga0207664_10005119 3300025929 Bacteria 8933
142 Ga0207664_10620332 3300025929 Bacteria 972
143 Ga0207644_10551848 3300025931 Unclassified 954
144 Ga0207644_10772678 3300025931 Bacteria 803
145 Ga0207690_10124250 3300025932 Bacteria 1879
146 Ga0207706_10049738 3300025933 Bacteria 3704
147 Ga0207670_10070280 3300025936 Bacteria 2418
148 Ga0207704_10030038 3300025938 Bacteria 3041
149 Ga0207665_10018329 3300025939 Bacteria 4600
150 Ga0207711_10342423 3300025941 Unclassified 1384
151 Ga0207689_10084475 3300025942 Bacteria 2609
152 Ga0207679_11190614 3300025945 Bacteria 699
153 Ga0207651_11058172 3300025960 Bacteria 726
154 Ga0207712_10240426 3300025961 Bacteria 1458
155 Ga0207668_10060112 3300025972 Bacteria 2666
156 Ga0207640_10038830 3300025981 Bacteria 3008
157 Ga0207677_10033375 3300026023 Bacteria 3320
158 Ga0207678_10026271 3300026067 Bacteria 5080
159 Ga0207708_10000245 3300026075 Bacteria 42725
160 Ga0207702_10004876 3300026078 Bacteria 11814
161 Ga0207702_10086306 3300026078 Bacteria 2736
162 Ga0207702_10969161 3300026078 Bacteria 843
163 Ga0207641_11583359 3300026088 Bacteria 657
164 Ga0207648_10189390 3300026089 Bacteria 1822
165 Ga0207676_10043587 3300026095 Bacteria 3456
166 Ga0207674_10083283 3300026116 Bacteria 3198
167 Ga0207675_100656846 3300026118 Bacteria 1055
168 Ga0207683_10001623 3300026121 Bacteria 20159
169 Ga0207683_10080218 3300026121 Bacteria 2895
170 Ga0207698_10054557 3300026142 Bacteria 3076
171 Ga0207428_10113670 3300027907 Bacteria 2081
172 Ga0268265_10193878 3300028380 Bacteria 1757
173 Ga0307415_100531760 3300032126 Bacteria 1034
174 Ga0373953_0054028 3300035117 Bacteria 1629
175 Ga0373935_0767776 3300035692 Bacteria 711
176 Ga0395900_0233493 3300037418 Unclassified 1849
177 Ga0395900_0929708 3300037418 Bacteria 792
178 Ga0395898_0094050 3300037466 Bacteria 2881
179 Ga0395898_0379591 3300037466 Bacteria 1348
180 Ga0395898_0797027 3300037466 Bacteria 885
181 Ga0436364_0638229 3300037853 Bacteria 996
182 Ga0436364_1040466 3300037853 Bacteria 95595
183 Ga0436364_1132411 3300037853 Bacteria 58691
184 Ga0436364_1427311 3300037853 Bacteria 97691
185 Ga0395901_0245398 3300038443 Unclassified 1867
186 Ga0395901_0375796 3300038443 Bacteria 1463
187 Ga0436365_0071633 3300039437 Bacteria 8901
188 Ga0436365_0430923 3300039437 Bacteria 2313
189 Ga0436365_0601902 3300039437 Unclassified 2406
190 Ga0436365_1468228 3300039437 Bacteria 2875
191 Ga0436363_0400563 3300039450 Bacteria 9528
192 Ga0436363_0882351 3300039450 Bacteria 628
193 Ga0436363_0982158 3300039450 Bacteria 635
194 Ga0436363_1201535 3300039450 Bacteria 2568
195 Ga0436363_1447314 3300039450 Bacteria 5976
196 Ga0436363_1481028 3300039450 Unclassified 1064
197 Ga0436363_1527363 3300039450 Bacteria 11977
198 Ga0436362_0963702 3300039453 Bacteria 5140
199 Ga0436362_1079976 3300039453 Unclassified 1390
200 Ga0436362_1290985 3300039453 Bacteria 700
201 Ga0451853_0946713 3300041512 Unclassified 587
202 Ga0466969_0339648 3300044656 Unclassified 680
203 Ga0466966_0316895 3300044684 Bacteria 937
204 Ga0466961_0226628 3300044693 Bacteria 1151
205 Ga0466961_0473666 3300044693 Bacteria 757
206 Ga0466961_0564999 3300044693 Unclassified 685
207 Ga0466963_1206582 3300044694 Unclassified 531
208 Ga0466964_0017369 3300044706 Bacteria 2753
209 Ga0466964_0141607 3300044706 Unclassified 1106
210 Ga0466964_0390937 3300044706 Bacteria 724
211 Ga0466968_0140716 3300044735 Bacteria 1103
212 Ga0466970_0196275 3300044765 Bacteria 1122
213 Ga0466957_0153691 3300044842 Bacteria 1490
214 Ga0466959_0210823 3300045049 Bacteria 1350
215 Ga0466958_0010651 3300045836 Bacteria 5157
216 Ga0466958_0023418 3300045836 Bacteria 3626
217 Ga0466958_0516335 3300045836 Bacteria 775
218 Ga0466967_0030624 3300045976 Unclassified 4518
219 Ga0466967_0058534 3300045976 Bacteria 3406
220 Ga0466967_0083097 3300045976 Bacteria 2895
221 Ga0495651_0113412 3300046462 Bacteria 2001
222 Ga0495653_0257662 3300046463 Unclassified 1155
223 Ga0495664_0595294 3300046477 Archaea 657
224 Ga0495608_0422397 3300046511 Bacteria 813
225 Ga0495618_0000799 3300046514 Bacteria 21969
226 Ga0495618_0557731 3300046514 Bacteria 685
227 Ga0495628_0505102 3300046516 Bacteria 873
228 Ga0495628_0530617 3300046516 Bacteria 847
229 Ga0495628_0932246 3300046516 Unclassified 601
230 Ga0495630_0000256 3300046517 Bacteria 42987
231 Ga0495630_0030495 3300046517 Bacteria 4012
232 Ga0495663_0128243 3300046525 Bacteria 854
233 Ga0495652_0188597 3300046529 Bacteria 1576
234 Ga0495634_0396159 3300046642 Unclassified 821
235 Ga0495635_0433603 3300046663 Unclassified 870
236 Ga0495599_0247643 3300046678 Bacteria 1085
237 Ga0495646_0580942 3300046680 Bacteria 570
238 Ga0495613_0541129 3300046689 Bacteria 780
239 Ga0495624_0218566 3300046690 Bacteria 1156
240 Ga0495604_0228171 3300047317 Unclassified 1279
241 Ga0495604_0578834 3300047317 Unclassified 722
242 Ga0495674_0208346 3300047319 Bacteria 1620
243 Ga0495674_0369859 3300047319 Bacteria 1161
244 Ga0496100_0019768 3300048903 Bacteria 4026
245 Ga0496102_0115168 3300048905 Bacteria 2508
246 Ga0496102_0689675 3300048905 Unclassified 944
247 Ga0496102_1259348 3300048905 Bacteria 659
248 Ga0496103_0475615 3300048906 Unclassified 800
249 Ga0496104_0014363 3300048907 Bacteria 7154
250 Ga0496104_0050134 3300048907 Bacteria 3939
251 Ga0496104_0568882 3300048907 Bacteria 1044
252 Ga0496104_0794625 3300048907 Unclassified 852
253 Ga0496105_0020263 3300048908 Bacteria 5373
254 Ga0496105_0135608 3300048908 Bacteria 2028
255 Ga0496106_0018838 3300048909 Bacteria 5114
256 Ga0496106_0541720 3300048909 Bacteria 934
257 Ga0496107_0037228 3300048910 Bacteria 3491
258 Ga0496107_0211048 3300048910 Bacteria 1444
259 Ga0496108_0017174 3300048911 Bacteria 5919
260 Ga0496108_0062060 3300048911 Bacteria 3147
261 Ga0496108_0234261 3300048911 Bacteria 1597
262 Ga0496108_0628196 3300048911 Bacteria 935
263 Ga0496109_0019734 3300048912 Bacteria 5947
264 Ga0496109_0148152 3300048912 Bacteria 2196
265 Ga0496109_0429950 3300048912 Bacteria 1247
266 Ga0496110_0059596 3300048913 Bacteria 3365
267 Ga0496110_0073637 3300048913 Bacteria 3031
268 Ga0496110_1468664 3300048913 Bacteria 591
269 Ga0496111_0109750 3300048914 Unclassified 2031
270 Ga0496111_0110685 3300048914 Bacteria 2022
271 Ga0496112_0001126 3300048915 Bacteria 19883
272 Ga0496112_0005330 3300048915 Bacteria 11101
273 Ga0496113_0001887 3300048916 Bacteria 11953
274 Ga0496113_0031666 3300048916 Bacteria 3840
275 Ga0496113_0130424 3300048916 Bacteria 1972
276 Ga0496114_0038297 3300048917 Bacteria 3967
277 Ga0496114_0107741 3300048917 Bacteria 2385
278 Ga0496114_0593368 3300048917 Bacteria 977
279 Ga0496115_0089299 3300048918 Bacteria 2517
280 Ga0496115_0535167 3300048918 Bacteria 938
281 Ga0496115_0672587 3300048918 Bacteria 816
282 Ga0496116_0000331 3300048919 Bacteria 76536
283 Ga0496117_0112486 3300048920 Bacteria 1693
284 Ga0496118_0019611 3300048921 Bacteria 6038
285 Ga0496119_0000837 3300048922 Bacteria 40910
286 Ga0496119_0215161 3300048922 Bacteria 986
287 Ga0496120_0001336 3300048923 Bacteria 30395
288 Ga0496121_0040633 3300048924 Bacteria 4077
289 Ga0496125_0037810 3300048928 Bacteria 4192
290 Ga0501047_0058568 3300049581 Bacteria 3721
291 Ga0501083_0007505 3300049744 Bacteria 7726
292 Ga0501083_0078026 3300049744 Bacteria 2197
293 Ga0501044_0056136 3300049823 Bacteria 4043
294 Ga0501044_0262761 3300049823 Bacteria 1664
295 nmdc:mga0n895_1114027_c1 3300050512 Bacteria 766
296 nmdc:mga0n895_146220_c1 3300050512 Bacteria 2393
297 nmdc:mga0n895_452931_c1 3300050512 Bacteria 1295
298 nmdc:mga0rr50_218455_c1 3300050513 Bacteria 1573
299 nmdc:mga0a205_906479_c1 3300050515 Bacteria 728
300 Ga0495601_0003055 3300053077 Bacteria 9541
301 Ga0495612_0362041 3300053078 Bacteria 656
302 Ga0495612_0525421 3300053078 Unclassified 544
303 Ga0495595_0089604 3300053084 Bacteria 1475
304 Ga0495619_0002184 3300053085 Bacteria 12959
305 Ga0500595_012372 3300053119 Bacteria 3304
306 Ga0500568_0240256 3300053139 Bacteria 660

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005466 Ga0070685_11381140 Ga0070685_113811401 121
2 3300009551 Ga0105238_11644161 Ga0105238_116441611 121
3 3300025929 Ga0207664_10620332 Ga0207664_106203322 121
4 3300048905 Ga0496102_1259348 Ga0496102_1259348_71_490 121
5 3300053119 Ga0500595_012372 Ga0500595_012372_486_899 124
6 3300046463 Ga0495653_0257662 Ga0495653_0257662_524_907 126
7 3300005545 Ga0070695_100759150 Ga0070695_1007591502 128
8 3300005456 Ga0070678_100006342 Ga0070678_1000063424 129
9 3300047317 Ga0495604_0578834 Ga0495604_0578834_14_406 129
10 3300039450 Ga0436363_0882351 Ga0436363_0882351_31_441 133
11 3300039450 Ga0436363_1201535 Ga0436363_1201535_1162_1572 133
12 3300039450 Ga0436363_1447314 Ga0436363_1447314_2850_3260 133
13 3300039453 Ga0436362_1290985 Ga0436362_1290985_142_552 133
14 3300005445 Ga0070708_100579016 Ga0070708_1005790162 134
15 3300005467 Ga0070706_100138143 Ga0070706_1001381433 134
16 3300005471 Ga0070698_100424683 Ga0070698_1004246832 134
17 3300005518 Ga0070699_100641007 Ga0070699_1006410072 134
18 3300025910 Ga0207684_10406450 Ga0207684_104064501 134
19 3300025922 Ga0207646_10216420 Ga0207646_102164203 134
20 3300046462 Ga0495651_0113412 Ga0495651_0113412_264_677 134
21 3300046516 Ga0495628_0530617 Ga0495628_0530617_410_823 134
22 3300005564 Ga0070664_101683150 Ga0070664_1016831501 135
23 3300005981 Ga0081538_10278631 Ga0081538_102786312 135
24 3300037418 Ga0395900_0233493 Ga0395900_0233493_1380_1790 135
25 3300037466 Ga0395898_0379591 Ga0395898_0379591_220_630 135
26 3300038443 Ga0395901_0245398 Ga0395901_0245398_381_791 135
27 3300044693 Ga0466961_0473666 Ga0466961_0473666_79_495 135
28 3300044842 Ga0466957_0153691 Ga0466957_0153691_544_960 135
29 3300046477 Ga0495664_0595294 Ga0495664_0595294_81_488 135
30 3300048911 Ga0496108_0628196 Ga0496108_0628196_168_578 135
31 3300003373 JGI25407J50210_10169364 JGI25407J50210_101693641 136
32 3300005329 Ga0070683_100118547 Ga0070683_1001185473 136
33 3300005329 Ga0070683_101165497 Ga0070683_1011654971 136
34 3300005355 Ga0070671_100199007 Ga0070671_1001990071 136
35 3300005434 Ga0070709_10136560 Ga0070709_101365601 136
36 3300005435 Ga0070714_100014351 Ga0070714_1000143512 136
37 3300005435 Ga0070714_100278839 Ga0070714_1002788392 136
38 3300005436 Ga0070713_100338210 Ga0070713_1003382101 136
39 3300005436 Ga0070713_100396071 Ga0070713_1003960711 136
40 3300005439 Ga0070711_100057087 Ga0070711_1000570873 136
41 3300005458 Ga0070681_10330583 Ga0070681_103305832 136
42 3300005467 Ga0070706_100058997 Ga0070706_1000589973 136
43 3300005468 Ga0070707_100328397 Ga0070707_1003283972 136
44 3300005471 Ga0070698_100659675 Ga0070698_1006596751 136
45 3300005518 Ga0070699_100284478 Ga0070699_1002844782 136
46 3300005530 Ga0070679_100072055 Ga0070679_1000720552 136
47 3300005535 Ga0070684_100030362 Ga0070684_1000303625 136
48 3300005536 Ga0070697_100430382 Ga0070697_1004303821 136
49 3300005549 Ga0070704_100627930 Ga0070704_1006279302 136
50 3300005563 Ga0068855_101071823 Ga0068855_1010718231 136
51 3300005564 Ga0070664_102167297 Ga0070664_1021672971 136
52 3300005577 Ga0068857_100046968 Ga0068857_1000469684 136
53 3300005614 Ga0068856_100079329 Ga0068856_1000793294 136
54 3300005981 Ga0081538_10040194 Ga0081538_100401942 136
55 3300006028 Ga0070717_10143950 Ga0070717_101439502 136
56 3300006852 Ga0075433_10743194 Ga0075433_107431942 136
57 3300006871 Ga0075434_100823486 Ga0075434_1008234862 136
58 3300006914 Ga0075436_100917575 Ga0075436_1009175751 136
59 3300007076 Ga0075435_100168894 Ga0075435_1001688943 136
60 3300007076 Ga0075435_101008716 Ga0075435_1010087161 136
61 3300009174 Ga0105241_11298194 Ga0105241_112981941 136
62 3300013105 Ga0157369_11578943 Ga0157369_115789431 136
63 3300013307 Ga0157372_11521864 Ga0157372_115218642 136
64 3300020069 Ga0197907_11043966 Ga0197907_110439661 136
65 3300020075 Ga0206349_1636136 Ga0206349_16361362 136
66 3300020076 Ga0206355_1084253 Ga0206355_10842531 136
67 3300020078 Ga0206352_10929549 Ga0206352_109295491 136
68 3300020080 Ga0206350_11333701 Ga0206350_113337011 136
69 3300020081 Ga0206354_10222355 Ga0206354_102223552 136
70 3300020082 Ga0206353_11117393 Ga0206353_111173931 136
71 3300021358 Ga0213873_10022600 Ga0213873_100226001 136
72 3300021358 Ga0213873_10023621 Ga0213873_100236213 136
73 3300021377 Ga0213874_10024459 Ga0213874_100244592 136
74 3300021377 Ga0213874_10032306 Ga0213874_100323062 136
75 3300021384 Ga0213876_10011234 Ga0213876_100112346 136
76 3300021384 Ga0213876_10059767 Ga0213876_100597672 136
77 3300021384 Ga0213876_10459216 Ga0213876_104592161 136
78 3300021388 Ga0213875_10000433 Ga0213875_100004336 136
79 3300021388 Ga0213875_10008572 Ga0213875_100085724 136
80 3300021388 Ga0213875_10073821 Ga0213875_100738211 136
81 3300022467 Ga0224712_10281684 Ga0224712_102816841 136
82 3300025910 Ga0207684_10043657 Ga0207684_100436574 136
83 3300025912 Ga0207707_10591637 Ga0207707_105916372 136
84 3300025917 Ga0207660_10645083 Ga0207660_106450832 136
85 3300025919 Ga0207657_10031992 Ga0207657_100319925 136
86 3300025922 Ga0207646_10097109 Ga0207646_100971092 136
87 3300025928 Ga0207700_10178794 Ga0207700_101787942 136
88 3300025928 Ga0207700_11541350 Ga0207700_115413501 136
89 3300025929 Ga0207664_10000006 Ga0207664_1000000620 136
90 3300025929 Ga0207664_10005119 Ga0207664_100051192 136
91 3300025931 Ga0207644_10772678 Ga0207644_107726781 136
92 3300025939 Ga0207665_10018329 Ga0207665_100183292 136
93 3300026078 Ga0207702_10004876 Ga0207702_100048762 136
94 3300026078 Ga0207702_10969161 Ga0207702_109691611 136
95 3300026116 Ga0207674_10083283 Ga0207674_100832832 136
96 3300032126 Ga0307415_100531760 Ga0307415_1005317602 136
97 3300035117 Ga0373953_0054028 Ga0373953_0054028_428_841 136
98 3300035692 Ga0373935_0767776 Ga0373935_0767776_276_689 136
99 3300037418 Ga0395900_0929708 Ga0395900_0929708_91_504 136
100 3300037466 Ga0395898_0797027 Ga0395898_0797027_172_585 136
101 3300037853 Ga0436364_0638229 Ga0436364_0638229_487_906 136
102 3300037853 Ga0436364_1040466 Ga0436364_1040466_26658_27077 136
103 3300037853 Ga0436364_1132411 Ga0436364_1132411_53671_54090 136
104 3300037853 Ga0436364_1427311 Ga0436364_1427311_43202_43615 136
105 3300039437 Ga0436365_0071633 Ga0436365_0071633_4818_5237 136
106 3300039437 Ga0436365_0430923 Ga0436365_0430923_1650_2069 136
107 3300039437 Ga0436365_0601902 Ga0436365_0601902_1594_2013 136
108 3300039437 Ga0436365_1468228 Ga0436365_1468228_2336_2755 136
109 3300039450 Ga0436363_0400563 Ga0436363_0400563_5242_5661 136
110 3300039450 Ga0436363_1481028 Ga0436363_1481028_458_877 136
111 3300039450 Ga0436363_1527363 Ga0436363_1527363_397_816 136
112 3300039453 Ga0436362_0963702 Ga0436362_0963702_2899_3318 136
113 3300039453 Ga0436362_1079976 Ga0436362_1079976_286_705 136
114 3300041512 Ga0451853_0946713 Ga0451853_0946713_133_552 136
115 3300044656 Ga0466969_0339648 Ga0466969_0339648_178_591 136
116 3300044684 Ga0466966_0316895 Ga0466966_0316895_226_645 136
117 3300044693 Ga0466961_0226628 Ga0466961_0226628_359_778 136
118 3300044693 Ga0466961_0564999 Ga0466961_0564999_93_512 136
119 3300044694 Ga0466963_1206582 Ga0466963_1206582_69_482 136
120 3300044706 Ga0466964_0017369 Ga0466964_0017369_1773_2192 136
121 3300044706 Ga0466964_0141607 Ga0466964_0141607_553_972 136
122 3300044735 Ga0466968_0140716 Ga0466968_0140716_359_778 136
123 3300044765 Ga0466970_0196275 Ga0466970_0196275_601_1020 136
124 3300045049 Ga0466959_0210823 Ga0466959_0210823_405_824 136
125 3300045836 Ga0466958_0010651 Ga0466958_0010651_733_1152 136
126 3300045836 Ga0466958_0023418 Ga0466958_0023418_1251_1670 136
127 3300045836 Ga0466958_0516335 Ga0466958_0516335_36_455 136
128 3300045976 Ga0466967_0030624 Ga0466967_0030624_2805_3224 136
129 3300045976 Ga0466967_0058534 Ga0466967_0058534_1094_1513 136
130 3300046511 Ga0495608_0422397 Ga0495608_0422397_268_681 136
131 3300046514 Ga0495618_0000799 Ga0495618_0000799_17751_18170 136
132 3300046514 Ga0495618_0557731 Ga0495618_0557731_253_672 136
133 3300046516 Ga0495628_0932246 Ga0495628_0932246_68_487 136
134 3300046517 Ga0495630_0030495 Ga0495630_0030495_2680_3099 136
135 3300046529 Ga0495652_0188597 Ga0495652_0188597_1027_1440 136
136 3300046663 Ga0495635_0433603 Ga0495635_0433603_24_437 136
137 3300046678 Ga0495599_0247643 Ga0495599_0247643_556_975 136
138 3300046680 Ga0495646_0580942 Ga0495646_0580942_79_492 136
139 3300046689 Ga0495613_0541129 Ga0495613_0541129_273_692 136
140 3300047317 Ga0495604_0228171 Ga0495604_0228171_791_1210 136
141 3300047319 Ga0495674_0208346 Ga0495674_0208346_1061_1480 136
142 3300047319 Ga0495674_0369859 Ga0495674_0369859_120_533 136
143 3300048907 Ga0496104_0014363 Ga0496104_0014363_6111_6524 136
144 3300048907 Ga0496104_0050134 Ga0496104_0050134_1117_1530 136
145 3300048907 Ga0496104_0568882 Ga0496104_0568882_154_573 136
146 3300048908 Ga0496105_0135608 Ga0496105_0135608_254_667 136
147 3300048909 Ga0496106_0541720 Ga0496106_0541720_48_461 136
148 3300048910 Ga0496107_0211048 Ga0496107_0211048_450_863 136
149 3300048911 Ga0496108_0062060 Ga0496108_0062060_269_682 136
150 3300048911 Ga0496108_0234261 Ga0496108_0234261_123_536 136
151 3300048912 Ga0496109_0148152 Ga0496109_0148152_274_693 136
152 3300048912 Ga0496109_0429950 Ga0496109_0429950_264_677 136
153 3300048913 Ga0496110_0073637 Ga0496110_0073637_2281_2700 136
154 3300048913 Ga0496110_1468664 Ga0496110_1468664_80_499 136
155 3300048914 Ga0496111_0110685 Ga0496111_0110685_1109_1528 136
156 3300048915 Ga0496112_0001126 Ga0496112_0001126_6847_7260 136
157 3300048916 Ga0496113_0031666 Ga0496113_0031666_101_514 136
158 3300048916 Ga0496113_0130424 Ga0496113_0130424_1503_1922 136
159 3300048917 Ga0496114_0107741 Ga0496114_0107741_335_748 136
160 3300048918 Ga0496115_0089299 Ga0496115_0089299_953_1366 136
161 3300048918 Ga0496115_0535167 Ga0496115_0535167_69_482 136
162 3300048918 Ga0496115_0672587 Ga0496115_0672587_104_517 136
163 3300048922 Ga0496119_0000837 Ga0496119_0000837_27305_27724 136
164 3300049823 Ga0501044_0262761 Ga0501044_0262761_429_842 136
165 3300050512 nmdc:mga0n895_1114027_c1 nmdc:mga0n895_1114027_c1_185_598 136
166 3300050512 nmdc:mga0n895_452931_c1 nmdc:mga0n895_452931_c1_440_859 136
167 3300050513 nmdc:mga0rr50_218455_c1 nmdc:mga0rr50_218455_c1_692_1111 136
168 3300050515 nmdc:mga0a205_906479_c1 nmdc:mga0a205_906479_c1_258_677 136
169 3300053078 Ga0495612_0525421 Ga0495612_0525421_81_500 136
170 3300053084 Ga0495595_0089604 Ga0495595_0089604_253_672 136
171 3300001989 JGI24739J22299_10149473 JGI24739J22299_101494732 137
172 3300005329 Ga0070683_100001376 Ga0070683_10000137615 137
173 3300005330 Ga0070690_100407453 Ga0070690_1004074532 137
174 3300005334 Ga0068869_100058154 Ga0068869_1000581542 137
175 3300005337 Ga0070682_100004885 Ga0070682_1000048858 137
176 3300005338 Ga0068868_100002487 Ga0068868_10000248711 137
177 3300005339 Ga0070660_100261892 Ga0070660_1002618922 137
178 3300005340 Ga0070689_100072030 Ga0070689_1000720303 137
179 3300005341 Ga0070691_10093240 Ga0070691_100932402 137
180 3300005345 Ga0070692_10732742 Ga0070692_107327422 137
181 3300005347 Ga0070668_100197364 Ga0070668_1001973642 137
182 3300005354 Ga0070675_100230288 Ga0070675_1002302882 137
183 3300005356 Ga0070674_100042920 Ga0070674_1000429201 137
184 3300005364 Ga0070673_100102269 Ga0070673_1001022692 137
185 3300005365 Ga0070688_100130989 Ga0070688_1001309892 137
186 3300005366 Ga0070659_100016968 Ga0070659_1000169686 137
187 3300005439 Ga0070711_100094853 Ga0070711_1000948533 137
188 3300005441 Ga0070700_100011711 Ga0070700_1000117114 137
189 3300005455 Ga0070663_100018497 Ga0070663_1000184974 137
190 3300005456 Ga0070678_100036351 Ga0070678_1000363512 137
191 3300005466 Ga0070685_10032166 Ga0070685_100321662 137
192 3300005535 Ga0070684_100015680 Ga0070684_1000156804 137
193 3300005535 Ga0070684_100590807 Ga0070684_1005908072 137
194 3300005549 Ga0070704_100067392 Ga0070704_1000673922 137
195 3300005564 Ga0070664_100087020 Ga0070664_1000870202 137
196 3300005578 Ga0068854_100663010 Ga0068854_1006630102 137
197 3300005614 Ga0068856_100011858 Ga0068856_1000118587 137
198 3300005615 Ga0070702_100002872 Ga0070702_1000028724 137
199 3300005616 Ga0068852_100156000 Ga0068852_1001560002 137
200 3300005617 Ga0068859_100461406 Ga0068859_1004614062 137
201 3300005618 Ga0068864_100028058 Ga0068864_1000280586 137
202 3300005719 Ga0068861_100566871 Ga0068861_1005668712 137
203 3300005834 Ga0068851_10167286 Ga0068851_101672862 137
204 3300005841 Ga0068863_100154597 Ga0068863_1001545972 137
205 3300006173 Ga0070716_100077182 Ga0070716_1000771823 137
206 3300006175 Ga0070712_100020039 Ga0070712_1000200394 137
207 3300006237 Ga0097621_100260101 Ga0097621_1002601012 137
208 3300006871 Ga0075434_100062679 Ga0075434_1000626796 137
209 3300006881 Ga0068865_100052914 Ga0068865_1000529143 137
210 3300006931 Ga0097620_100461427 Ga0097620_1004614272 137
211 3300009036 Ga0105244_10444847 Ga0105244_104448472 137
212 3300009098 Ga0105245_10019225 Ga0105245_100192252 137
213 3300009098 Ga0105245_11135054 Ga0105245_111350542 137
214 3300009147 Ga0114129_11635761 Ga0114129_116357611 137
215 3300009176 Ga0105242_10475127 Ga0105242_104751272 137
216 3300009551 Ga0105238_10463290 Ga0105238_104632902 137
217 3300010375 Ga0105239_10136026 Ga0105239_101360263 137
218 3300011119 Ga0105246_10109333 Ga0105246_101093333 137
219 3300013296 Ga0157374_10005605 Ga0157374_100056055 137
220 3300013297 Ga0157378_10078884 Ga0157378_100788843 137
221 3300013306 Ga0163162_10700853 Ga0163162_107008532 137
222 3300013307 Ga0157372_10044418 Ga0157372_100444187 137
223 3300013308 Ga0157375_10027006 Ga0157375_100270065 137
224 3300014325 Ga0163163_10040439 Ga0163163_100404396 137
225 3300014745 Ga0157377_10006343 Ga0157377_100063432 137
226 3300014969 Ga0157376_10207235 Ga0157376_102072352 137
227 3300020070 Ga0206356_10968391 Ga0206356_109683911 137
228 3300020082 Ga0206353_10581476 Ga0206353_105814761 137
229 3300025901 Ga0207688_10004068 Ga0207688_100040685 137
230 3300025913 Ga0207695_10827494 Ga0207695_108274942 137
231 3300025915 Ga0207693_10025726 Ga0207693_100257262 137
232 3300025916 Ga0207663_10096974 Ga0207663_100969743 137
233 3300025918 Ga0207662_10048379 Ga0207662_100483791 137
234 3300025919 Ga0207657_10104887 Ga0207657_101048872 137
235 3300025920 Ga0207649_10018082 Ga0207649_100180824 137
236 3300025923 Ga0207681_11194457 Ga0207681_111944571 137
237 3300025924 Ga0207694_10204524 Ga0207694_102045242 137
238 3300025926 Ga0207659_10128874 Ga0207659_101288742 137
239 3300025927 Ga0207687_10044151 Ga0207687_100441514 137
240 3300025931 Ga0207644_10551848 Ga0207644_105518482 137
241 3300025932 Ga0207690_10124250 Ga0207690_101242502 137
242 3300025933 Ga0207706_10049738 Ga0207706_100497382 137
243 3300025936 Ga0207670_10070280 Ga0207670_100702803 137
244 3300025938 Ga0207704_10030038 Ga0207704_100300382 137
245 3300025941 Ga0207711_10342423 Ga0207711_103424232 137
246 3300025942 Ga0207689_10084475 Ga0207689_100844752 137
247 3300025945 Ga0207679_11190614 Ga0207679_111906142 137
248 3300025960 Ga0207651_11058172 Ga0207651_110581722 137
249 3300025961 Ga0207712_10240426 Ga0207712_102404262 137
250 3300025972 Ga0207668_10060112 Ga0207668_100601123 137
251 3300025981 Ga0207640_10038830 Ga0207640_100388301 137
252 3300026023 Ga0207677_10033375 Ga0207677_100333753 137
253 3300026067 Ga0207678_10026271 Ga0207678_100262712 137
254 3300026075 Ga0207708_10000245 Ga0207708_100002459 137
255 3300026078 Ga0207702_10086306 Ga0207702_100863062 137
256 3300026088 Ga0207641_11583359 Ga0207641_115833592 137
257 3300026089 Ga0207648_10189390 Ga0207648_101893902 137
258 3300026095 Ga0207676_10043587 Ga0207676_100435873 137
259 3300026118 Ga0207675_100656846 Ga0207675_1006568462 137
260 3300026121 Ga0207683_10001623 Ga0207683_1000162315 137
261 3300026121 Ga0207683_10080218 Ga0207683_100802183 137
262 3300026142 Ga0207698_10054557 Ga0207698_100545573 137
263 3300027907 Ga0207428_10113670 Ga0207428_101136702 137
264 3300028380 Ga0268265_10193878 Ga0268265_101938782 137
265 3300037466 Ga0395898_0094050 Ga0395898_0094050_2316_2729 137
266 3300038443 Ga0395901_0375796 Ga0395901_0375796_222_635 137
267 3300039450 Ga0436363_0982158 Ga0436363_0982158_59_481 137
268 3300044706 Ga0466964_0390937 Ga0466964_0390937_272_688 137
269 3300045976 Ga0466967_0083097 Ga0466967_0083097_1576_1992 137
270 3300046516 Ga0495628_0505102 Ga0495628_0505102_351_773 137
271 3300046517 Ga0495630_0000256 Ga0495630_0000256_36410_36823 137
272 3300046525 Ga0495663_0128243 Ga0495663_0128243_42_458 137
273 3300046642 Ga0495634_0396159 Ga0495634_0396159_243_656 137
274 3300046690 Ga0495624_0218566 Ga0495624_0218566_208_621 137
275 3300048903 Ga0496100_0019768 Ga0496100_0019768_385_798 137
276 3300048905 Ga0496102_0115168 Ga0496102_0115168_480_893 137
277 3300048905 Ga0496102_0689675 Ga0496102_0689675_106_519 137
278 3300048906 Ga0496103_0475615 Ga0496103_0475615_68_481 137
279 3300048907 Ga0496104_0794625 Ga0496104_0794625_197_610 137
280 3300048908 Ga0496105_0020263 Ga0496105_0020263_2980_3393 137
281 3300048909 Ga0496106_0018838 Ga0496106_0018838_2216_2629 137
282 3300048910 Ga0496107_0037228 Ga0496107_0037228_1666_2079 137
283 3300048911 Ga0496108_0017174 Ga0496108_0017174_2060_2473 137
284 3300048912 Ga0496109_0019734 Ga0496109_0019734_2499_2912 137
285 3300048913 Ga0496110_0059596 Ga0496110_0059596_2217_2630 137
286 3300048914 Ga0496111_0109750 Ga0496111_0109750_146_559 137
287 3300048915 Ga0496112_0005330 Ga0496112_0005330_6613_7026 137
288 3300048916 Ga0496113_0001887 Ga0496113_0001887_6740_7153 137
289 3300048917 Ga0496114_0038297 Ga0496114_0038297_1523_1936 137
290 3300048917 Ga0496114_0593368 Ga0496114_0593368_162_578 137
291 3300048919 Ga0496116_0000331 Ga0496116_0000331_55523_55936 137
292 3300048920 Ga0496117_0112486 Ga0496117_0112486_56_469 137
293 3300048921 Ga0496118_0019611 Ga0496118_0019611_2645_3058 137
294 3300048922 Ga0496119_0215161 Ga0496119_0215161_444_857 137
295 3300048923 Ga0496120_0001336 Ga0496120_0001336_24017_24430 137
296 3300048924 Ga0496121_0040633 Ga0496121_0040633_144_557 137
297 3300048928 Ga0496125_0037810 Ga0496125_0037810_1167_1580 137
298 3300049581 Ga0501047_0058568 Ga0501047_0058568_222_635 137
299 3300049744 Ga0501083_0007505 Ga0501083_0007505_1944_2357 137
300 3300049744 Ga0501083_0078026 Ga0501083_0078026_1448_1861 137
301 3300049823 Ga0501044_0056136 Ga0501044_0056136_1884_2297 137
302 3300050512 nmdc:mga0n895_146220_c1 nmdc:mga0n895_146220_c1_355_768 137
303 3300053077 Ga0495601_0003055 Ga0495601_0003055_7254_7667 137
304 3300053078 Ga0495612_0362041 Ga0495612_0362041_195_641 137
305 3300053085 Ga0495619_0002184 Ga0495619_0002184_1606_2019 137
306 3300053139 Ga0500568_0240256 Ga0500568_0240256_219_632 137

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

14

138

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1kmz-assembly1.cif.gz_A molecular basis of mitomycin c resictance in streptomyces: crystal structures of the mrd protein with and without a drug derivative 0.7899 6 132
1kmz-assembly1.cif.gz_A molecular basis of mitomycin c resictance in streptomyces: crystal structures of the mrd protein with and without a drug derivative 0.7578 6 132
4rt5-assembly1.cif.gz_B the crystal structure of a glyoxalase/bleomycin resistance protein/dioxygenase protein from planctomyces limnophilus dsm 3776 0.699 2 135
2r6u-assembly2.cif.gz_D crystal structure of gene product rha04853 from rhodococcus sp. rha1 0.6972 3 133
2i4e-assembly2.cif.gz_B structural studies of protein tyrosine phosphatase beta catalytic domain in complex with inhibitors 0.6898 102 132
ID Description Score Start End Superfamily
2kjzB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9086 79 132 3.30.720.110
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8527 74 132 3.30.720.110
2kjzB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8371 79 132 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8304 79 130 3.30.720.110
3sk1A02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8048 81 133 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A6L7X5H9-F1-model_v4 VOC family protein 0.979 81 134
AF-A0A431R9P7-F1-model_v4 VOC family protein 0.9783 81 137
AF-K2AJS8-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase 0.978 79 134 GO:0051213
AF-A0A7W0G7P7-F1-model_v4 VOC family protein 0.9779 83 134
AF-A0A259IWH6-F1-model_v4 Glyoxalase 0.977 79 134

Feature Viewer

pLDDT pTM Quality
94.68 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map