F398815

General Info

Members Datasets Scaffolds Average Seq Length
306 179 612 384

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0035842|Ga0495638_0035842_16_1164
Length 382
Sequence VLAATIGFLGDFDLAEEAAQEAFAVAAERWPRDGAPERPAAWLATAARNRAIDRVRRERTLAAKTRLLDVPEAASGAEETVEDAMEATAFPDERLELLFTCCHPALSTEAQVALTLRALGGLTTPQIARAFLVPEPTMAQRLVRAKRKIKAAGIPFRVPPDHLLPERVAAVGAVVYLIFNEGYGGDGELGAEALRLGRALAELMPDEPEAHGLLALMLLHDARRAARFADGELVLLADQDSTLWDAAEIAAGRTELDRALALRGRGPYVLQAAIASLHAAEPRDWPQIAALYSELSRLTGSAVVELNRAVALAEAEGPAAGLEIVEGLELGDYLYLHSSRAELLRRLGRAAEAADAYRRALELVEDEAERRLLERRLAELGV

Samples

Sample ID Description Type Environment
1 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
120 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
121 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
122 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
123 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
129 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
130 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
131 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
132 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
133 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
134 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
135 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
136 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
137 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
138 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
139 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
140 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
141 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
144 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
155 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
156 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
157 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
158 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
159 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
160 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
161 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
162 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
163 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
164 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
165 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
168 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
169 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
172 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
173 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
174 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
175 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
176 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
177 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
178 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
179 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.98
Nodule 0
Rhizoplane 4.9
Rhizosphere 94.12
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495638_0035842 3300046460 Bacteria 3161
2 ARcpr5yngRDRAFT_c002579 3300000043 Bacteria 1869
3 JGI25407J50210_10004534 3300003373 Bacteria 3379
4 Ga0070683_100051181 3300005329 Bacteria 3824
5 Ga0070670_100144802 3300005331 Bacteria 2055
6 Ga0070670_100279902 3300005331 Bacteria 1456
7 Ga0070680_100045784 3300005336 Bacteria 3557
8 Ga0070682_100004449 3300005337 Bacteria 7780
9 Ga0070682_100046743 3300005337 Bacteria 2687
10 Ga0070682_100053371 3300005337 Bacteria 2533
11 Ga0070682_100128046 3300005337 Bacteria 1714
12 Ga0068868_100056865 3300005338 Bacteria 3089
13 Ga0070660_100006426 3300005339 Bacteria 8146
14 Ga0070660_100065830 3300005339 Bacteria 2821
15 Ga0070689_100054456 3300005340 Bacteria 3097
16 Ga0070691_10005665 3300005341 Bacteria 5695
17 Ga0070661_100013401 3300005344 Bacteria 5755
18 Ga0070661_100032533 3300005344 Bacteria 3776
19 Ga0070692_10001978 3300005345 Bacteria 7760
20 Ga0070692_10006512 3300005345 Bacteria 5076
21 Ga0070668_100038990 3300005347 Bacteria 3634
22 Ga0070668_100072396 3300005347 Bacteria 2685
23 Ga0070675_100005503 3300005354 Bacteria 9694
24 Ga0070671_100063883 3300005355 Bacteria 3066
25 Ga0070674_100039071 3300005356 Bacteria 3203
26 Ga0070674_100044679 3300005356 Bacteria 3022
27 Ga0070673_100003272 3300005364 Bacteria 10052
28 Ga0070673_100039159 3300005364 Bacteria 3625
29 Ga0070688_100001684 3300005365 Bacteria 11040
30 Ga0070659_100018493 3300005366 Bacteria 5258
31 Ga0070659_100019949 3300005366 Bacteria 5088
32 Ga0070659_100029752 3300005366 Bacteria 4221
33 Ga0070667_100176265 3300005367 Bacteria 1889
34 Ga0070701_10034878 3300005438 Bacteria 2523
35 Ga0070701_10046570 3300005438 Bacteria 2230
36 Ga0070694_100076545 3300005444 Bacteria 2316
37 Ga0070708_100164547 3300005445 Bacteria 2068
38 Ga0070663_100021470 3300005455 Bacteria 4295
39 Ga0070678_100020731 3300005456 Bacteria 4319
40 Ga0070662_100022055 3300005457 Bacteria 4355
41 Ga0070662_100121944 3300005457 Bacteria 1999
42 Ga0070681_10001960 3300005458 Bacteria 18610
43 Ga0068867_100083330 3300005459 Bacteria 2414
44 Ga0068867_100108237 3300005459 Bacteria 2131
45 Ga0070706_100046263 3300005467 Bacteria 4017
46 Ga0070706_100093847 3300005467 Bacteria 2784
47 Ga0070698_100001207 3300005471 Bacteria 28694
48 Ga0070698_100027626 3300005471 Bacteria 5899
49 Ga0070679_100006758 3300005530 Bacteria 10697
50 Ga0070684_100028982 3300005535 Bacteria 4688
51 Ga0070684_100037211 3300005535 Bacteria 4172
52 Ga0070684_100057540 3300005535 Bacteria 3395
53 Ga0070684_100065955 3300005535 Bacteria 3178
54 Ga0070684_100347173 3300005535 Bacteria 1365
55 Ga0068853_100008648 3300005539 Bacteria 8185
56 Ga0070672_100004142 3300005543 Bacteria 9466
57 Ga0070672_100019912 3300005543 Bacteria 4882
58 Ga0070686_100074751 3300005544 Bacteria 2228
59 Ga0070696_100142232 3300005546 Bacteria 1754
60 Ga0070665_100169940 3300005548 Bacteria 2181
61 Ga0068855_100009917 3300005563 Bacteria 11486
62 Ga0070664_100051205 3300005564 Bacteria 3496
63 Ga0068857_100127205 3300005577 Bacteria 2297
64 Ga0068854_100014764 3300005578 Bacteria 5156
65 Ga0068856_100011442 3300005614 Bacteria 8609
66 Ga0068856_100077379 3300005614 Bacteria 3296
67 Ga0068856_100131667 3300005614 Bacteria 2506
68 Ga0068856_100289213 3300005614 Bacteria 1656
69 Ga0070702_100004598 3300005615 Bacteria 6322
70 Ga0070702_100027985 3300005615 Bacteria 3049
71 Ga0068852_100058500 3300005616 Bacteria 3339
72 Ga0068859_100199824 3300005617 Bacteria 2084
73 Ga0068864_100002446 3300005618 Bacteria 15342
74 Ga0068866_10022906 3300005718 Bacteria 2897
75 Ga0068866_10080758 3300005718 Bacteria 1745
76 Ga0068861_100016223 3300005719 Bacteria 5266
77 Ga0068851_10056645 3300005834 Bacteria 2000
78 Ga0068863_100038026 3300005841 Bacteria 4580
79 Ga0081455_10049149 3300005937 Bacteria 3638
80 Ga0081538_10000112 3300005981 Bacteria 81614
81 Ga0081538_10000723 3300005981 Bacteria 35973
82 Ga0081538_10001129 3300005981 Bacteria 28267
83 Ga0081538_10001237 3300005981 Bacteria 26766
84 Ga0081538_10004189 3300005981 Bacteria 13379
85 Ga0081538_10018613 3300005981 Bacteria 5205
86 Ga0081538_10024962 3300005981 Bacteria 4237
87 Ga0081539_10002754 3300005985 Bacteria 23660
88 Ga0075365_10020125 3300006038 Bacteria 4132
89 Ga0075432_10000256 3300006058 Bacteria 14544
90 Ga0075432_10032306 3300006058 Bacteria 1814
91 Ga0097621_100021889 3300006237 Bacteria 4954
92 Ga0068871_100038569 3300006358 Bacteria 3817
93 Ga0075428_100003661 3300006844 Bacteria 16849
94 Ga0075428_100007225 3300006844 Bacteria 12300
95 Ga0075430_100001581 3300006846 Bacteria 18597
96 Ga0075431_100266019 3300006847 Bacteria 1739
97 Ga0075433_10005757 3300006852 Bacteria 9751
98 Ga0075434_100004879 3300006871 Bacteria 12150
99 Ga0075429_100006112 3300006880 Bacteria 10409
100 Ga0075429_100033952 3300006880 Bacteria 4433
101 Ga0075429_100141647 3300006880 Bacteria 2105
102 Ga0068865_100012582 3300006881 Bacteria 5331
103 Ga0097620_100199822 3300006931 Bacteria 2084
104 Ga0075435_100010937 3300007076 Bacteria 6649
105 Ga0111539_10003999 3300009094 Bacteria 19355
106 Ga0111539_10010353 3300009094 Bacteria 11741
107 Ga0111539_10018070 3300009094 Bacteria 8735
108 Ga0111539_10043656 3300009094 Bacteria 5373
109 Ga0111539_10102498 3300009094 Bacteria 3359
110 Ga0111539_10175428 3300009094 Bacteria 2504
111 Ga0111539_10257954 3300009094 Bacteria 2030
112 Ga0105245_10021863 3300009098 Bacteria 5615
113 Ga0105245_10031671 3300009098 Bacteria 4681
114 Ga0105245_10238958 3300009098 Bacteria 1760
115 Ga0114129_10001306 3300009147 Bacteria 33269
116 Ga0114129_10007643 3300009147 Bacteria 15385
117 Ga0114129_10114978 3300009147 Bacteria 3710
118 Ga0105242_10064387 3300009176 Bacteria 3022
119 Ga0105248_10073663 3300009177 Bacteria 3838
120 Ga0105239_10012022 3300010375 Bacteria 9653
121 Ga0105239_10016925 3300010375 Bacteria 8058
122 Ga0105239_10085742 3300010375 Bacteria 3471
123 Ga0157371_10008776 3300013102 Bacteria 8018
124 Ga0157371_10220680 3300013102 Bacteria 1361
125 Ga0157369_10112428 3300013105 Bacteria 2893
126 Ga0157374_10145629 3300013296 Bacteria 2301
127 Ga0157378_10161308 3300013297 Bacteria 2097
128 Ga0163162_10101306 3300013306 Bacteria 2972
129 Ga0157372_10015578 3300013307 Bacteria 8150
130 Ga0157372_10115513 3300013307 Bacteria 3077
131 Ga0157375_10016171 3300013308 Bacteria 6692
132 Ga0163163_10240519 3300014325 Bacteria 1860
133 Ga0157380_10018270 3300014326 Bacteria 5203
134 Ga0157377_10033865 3300014745 Bacteria 2791
135 Ga0157379_10082850 3300014968 Bacteria 2874
136 Ga0207710_10015238 3300025900 Bacteria 3246
137 Ga0207688_10024238 3300025901 Bacteria 3327
138 Ga0207643_10010659 3300025908 Bacteria 4954
139 Ga0207707_10214172 3300025912 Bacteria 1677
140 Ga0207660_10041598 3300025917 Bacteria 3221
141 Ga0207657_10006924 3300025919 Bacteria 11686
142 Ga0207657_10059931 3300025919 Bacteria 3268
143 Ga0207649_10037756 3300025920 Bacteria 2920
144 Ga0207649_10053062 3300025920 Bacteria 2518
145 Ga0207652_10014730 3300025921 Bacteria 6338
146 Ga0207694_10039589 3300025924 Bacteria 3627
147 Ga0207687_10006499 3300025927 Bacteria 7720
148 Ga0207690_10006808 3300025932 Bacteria 6778
149 Ga0207690_10122354 3300025932 Bacteria 1892
150 Ga0207706_10002917 3300025933 Bacteria 16524
151 Ga0207686_10006569 3300025934 Bacteria 6262
152 Ga0207669_10013964 3300025937 Bacteria 4011
153 Ga0207669_10015953 3300025937 Bacteria 3802
154 Ga0207691_10004695 3300025940 Bacteria 13225
155 Ga0207691_10010964 3300025940 Bacteria 8697
156 Ga0207711_10277397 3300025941 Bacteria 1543
157 Ga0207661_10000559 3300025944 Bacteria 23755
158 Ga0207661_10071558 3300025944 Bacteria 2834
159 Ga0207651_10090591 3300025960 Bacteria 2236
160 Ga0207668_10090766 3300025972 Bacteria 2243
161 Ga0207640_10015684 3300025981 Bacteria 4390
162 Ga0207658_10247868 3300025986 Bacteria 1512
163 Ga0207677_10029694 3300026023 Bacteria 3478
164 Ga0207703_10031467 3300026035 Bacteria 4195
165 Ga0207639_10094303 3300026041 Bacteria 2402
166 Ga0207678_10040053 3300026067 Bacteria 4064
167 Ga0207678_10063597 3300026067 Bacteria 3171
168 Ga0207708_10039650 3300026075 Bacteria 3589
169 Ga0207702_10087785 3300026078 Bacteria 2716
170 Ga0207648_10024835 3300026089 Bacteria 5345
171 Ga0207648_10047368 3300026089 Bacteria 3768
172 Ga0207648_10122523 3300026089 Bacteria 2286
173 Ga0207674_10061148 3300026116 Bacteria 3806
174 Ga0207674_10174124 3300026116 Bacteria 2104
175 Ga0207675_100054500 3300026118 Bacteria 3730
176 Ga0207683_10010150 3300026121 Bacteria 8035
177 Ga0207683_10024814 3300026121 Bacteria 5165
178 Ga0207698_10006255 3300026142 Bacteria 7408
179 Ga0207428_10000536 3300027907 Bacteria 45269
180 Ga0207428_10041233 3300027907 Bacteria 3739
181 Ga0207428_10069279 3300027907 Bacteria 2774
182 Ga0268266_10215317 3300028379 Bacteria 1763
183 Ga0373932_0010199 3300035112 Bacteria 2271
184 Ga0373941_0009412 3300035115 Bacteria 2461
185 Ga0373961_0009456 3300035241 Bacteria 2386
186 Ga0373931_0045355 3300035691 Bacteria 2321
187 Ga0373947_0001154 3300035725 Bacteria 16203
188 Ga0395900_0001791 3300037418 Bacteria 24637
189 Ga0395900_0001810 3300037418 Bacteria 24466
190 Ga0395900_0009064 3300037418 Bacteria 10198
191 Ga0395900_0014893 3300037418 Bacteria 7923
192 Ga0395900_0069947 3300037418 Bacteria 3608
193 Ga0395900_0097030 3300037418 Bacteria 3029
194 Ga0395900_0132684 3300037418 Bacteria 2552
195 Ga0395900_0136868 3300037418 Bacteria 2509
196 Ga0395900_0290593 3300037418 Bacteria 1623
197 Ga0395898_0000824 3300037466 Bacteria 51781
198 Ga0395898_0003652 3300037466 Bacteria 17113
199 Ga0395898_0009894 3300037466 Bacteria 9998
200 Ga0395898_0022401 3300037466 Bacteria 6398
201 Ga0395898_0041850 3300037466 Bacteria 4522
202 Ga0395898_0058980 3300037466 Bacteria 3735
203 Ga0395898_0078337 3300037466 Bacteria 3189
204 Ga0395905_0007732 3300037471 Bacteria 10666
205 Ga0395905_0039995 3300037471 Bacteria 4399
206 Ga0395905_0061421 3300037471 Bacteria 3515
207 Ga0395905_0101943 3300037471 Bacteria 2694
208 Ga0395905_0167920 3300037471 Bacteria 2062
209 Ga0395905_0216497 3300037471 Bacteria 1793
210 Ga0395901_0001584 3300038443 Bacteria 23533
211 Ga0395901_0003623 3300038443 Bacteria 15580
212 Ga0395901_0008618 3300038443 Bacteria 10305
213 Ga0395901_0018615 3300038443 Bacteria 7093
214 Ga0395901_0021222 3300038443 Bacteria 6652
215 Ga0395901_0029855 3300038443 Bacteria 5614
216 Ga0395901_0039101 3300038443 Bacteria 4909
217 Ga0395901_0104894 3300038443 Bacteria 2966
218 Ga0395901_0114617 3300038443 Bacteria 2831
219 Ga0395901_0277298 3300038443 Bacteria 1743
220 Ga0466964_0014291 3300044706 Bacteria 3018
221 Ga0466958_0036705 3300045836 Bacteria 2935
222 Ga0466967_0173141 3300045976 Bacteria 2032
223 Ga0495630_0109629 3300046517 Bacteria 2091
224 Ga0495631_0032831 3300046518 Bacteria 2338
225 Ga0495634_0131226 3300046642 Bacteria 1597
226 Ga0495589_0096193 3300046794 Bacteria 1436
227 Ga0495676_0073637 3300047321 Bacteria 2618
228 Ga0495676_0168695 3300047321 Bacteria 1542
229 Ga0496106_0015438 3300048909 Bacteria 5653
230 Ga0496106_0063570 3300048909 Bacteria 2805
231 Ga0496107_0007203 3300048910 Bacteria 7662
232 Ga0496108_0011624 3300048911 Bacteria 7161
233 Ga0496108_0096885 3300048911 Bacteria 2513
234 Ga0496109_0005697 3300048912 Bacteria 10428
235 Ga0496110_0020011 3300048913 Bacteria 5643
236 Ga0496110_0039410 3300048913 Bacteria 4114
237 Ga0496110_0057578 3300048913 Bacteria 3421
238 Ga0496111_0002529 3300048914 Bacteria 11030
239 Ga0496111_0097129 3300048914 Bacteria 2162
240 Ga0496112_0030813 3300048915 Bacteria 5196
241 Ga0496112_0162963 3300048915 Bacteria 2196
242 Ga0496112_0374183 3300048915 Bacteria 1366
243 Ga0496114_0089619 3300048917 Bacteria 2610
244 Ga0501032_0016957 3300049569 Bacteria 5119
245 Ga0501033_0025189 3300049570 Bacteria 4482
246 Ga0501036_0021230 3300049572 Bacteria 5455
247 Ga0501036_0033721 3300049572 Bacteria 4329
248 Ga0501038_0044240 3300049574 Bacteria 3871
249 Ga0501039_0011391 3300049575 Bacteria 6771
250 Ga0501040_0006340 3300049576 Bacteria 7683
251 Ga0501040_0006615 3300049576 Bacteria 7523
252 Ga0501040_0019795 3300049576 Bacteria 4478
253 Ga0501041_0006618 3300049577 Bacteria 6786
254 Ga0501041_0012244 3300049577 Bacteria 5082
255 Ga0501041_0021822 3300049577 Bacteria 3835
256 Ga0501042_0006630 3300049578 Bacteria 7538
257 Ga0501043_0020562 3300049579 Bacteria 5178
258 Ga0501048_0044417 3300049582 Bacteria 3177
259 Ga0501068_0039089 3300049584 Bacteria 2844
260 Ga0501069_0014025 3300049585 Bacteria 4281
261 Ga0501069_0053420 3300049585 Bacteria 2250
262 Ga0501070_0121003 3300049586 Bacteria 2163
263 Ga0501071_0003019 3300049587 Bacteria 10420
264 Ga0501072_0002298 3300049588 Bacteria 14312
265 Ga0501072_0010887 3300049588 Bacteria 6937
266 Ga0501072_0033603 3300049588 Bacteria 4019
267 Ga0501075_0012937 3300049591 Bacteria 5945
268 Ga0501076_0036450 3300049592 Bacteria 3853
269 Ga0501076_0196311 3300049592 Bacteria 1647
270 Ga0501077_0018389 3300049593 Bacteria 4422
271 Ga0501079_0005613 3300049741 Bacteria 9363
272 Ga0501079_0012703 3300049741 Bacteria 6433
273 Ga0501079_0098092 3300049741 Bacteria 2272
274 Ga0501079_0130819 3300049741 Bacteria 1953
275 Ga0501080_0051940 3300049742 Bacteria 3815
276 Ga0501081_0067059 3300049743 Bacteria 2496
277 Ga0501035_0054272 3300049822 Bacteria 3581
278 Ga0501044_0085569 3300049823 Bacteria 3186
279 Ga0501045_0006588 3300049824 Bacteria 8045
280 nmdc:mga00v17_26161_c1 3300050491 Bacteria 3397
281 nmdc:mga0yw44_10313_c1 3300050492 Bacteria 4766
282 nmdc:mga05p37_2685_c1 3300050507 Bacteria 20688
283 nmdc:mga05p37_52133_c1 3300050507 Bacteria 5031
284 nmdc:mga05p37_922_c1 3300050507 Bacteria 33178
285 nmdc:mga09592_132776_c1 3300050508 Bacteria 2143
286 nmdc:mga09592_154_c1 3300050508 Bacteria 47375
287 nmdc:mga09592_8889_c1 3300050508 Bacteria 8167
288 nmdc:mga0qj67_2167_c1 3300050509 Bacteria 13961
289 nmdc:mga0qj67_94008_c1 3300050509 Bacteria 2411
290 nmdc:mga06r32_130_c1 3300050510 Bacteria 55123
291 nmdc:mga06r32_5698_c1 3300050510 Bacteria 11216
292 nmdc:mga08y16_141163_c1 3300050511 Bacteria 2504
293 nmdc:mga08y16_159200_c1 3300050511 Bacteria 2346
294 nmdc:mga08y16_42502_c1 3300050511 Bacteria 4760
295 nmdc:mga08y16_88261_c1 3300050511 Bacteria 3232
296 nmdc:mga0n895_19505_c1 3300050512 Bacteria 6304
297 nmdc:mga0n895_6064_c1 3300050512 Bacteria 10191
298 nmdc:mga0rr50_159026_c1 3300050513 Bacteria 1832
299 nmdc:mga0rr50_39899_c1 3300050513 Bacteria 3409
300 nmdc:mga0a205_16745_c1 3300050515 Bacteria 6864
301 nmdc:mga0a205_3354_c1 3300050515 Bacteria 12991
302 Ga0501084_0001632 3300054114 Bacteria 17799
303 Ga0501084_0043700 3300054114 Bacteria 3748
304 Ga0501084_0070103 3300054114 Bacteria 2935
305 Ga0501084_0230418 3300054114 Bacteria 1564
306 Ga0501082_0013960 3300060353 Bacteria 6908
307 Ga0495638_0035842
308 ARcpr5yngRDRAFT_c002579
309 JGI25407J50210_10004534
310 Ga0070683_100051181
311 Ga0070670_100144802
312 Ga0070670_100279902
313 Ga0070680_100045784
314 Ga0070682_100004449
315 Ga0070682_100046743
316 Ga0070682_100053371
317 Ga0070682_100128046
318 Ga0068868_100056865
319 Ga0070660_100006426
320 Ga0070660_100065830
321 Ga0070689_100054456
322 Ga0070691_10005665
323 Ga0070661_100013401
324 Ga0070661_100032533
325 Ga0070692_10001978
326 Ga0070692_10006512
327 Ga0070668_100038990
328 Ga0070668_100072396
329 Ga0070675_100005503
330 Ga0070671_100063883
331 Ga0070674_100039071
332 Ga0070674_100044679
333 Ga0070673_100003272
334 Ga0070673_100039159
335 Ga0070688_100001684
336 Ga0070659_100018493
337 Ga0070659_100019949
338 Ga0070659_100029752
339 Ga0070667_100176265
340 Ga0070701_10034878
341 Ga0070701_10046570
342 Ga0070694_100076545
343 Ga0070708_100164547
344 Ga0070663_100021470
345 Ga0070678_100020731
346 Ga0070662_100022055
347 Ga0070662_100121944
348 Ga0070681_10001960
349 Ga0068867_100083330
350 Ga0068867_100108237
351 Ga0070706_100046263
352 Ga0070706_100093847
353 Ga0070698_100001207
354 Ga0070698_100027626
355 Ga0070679_100006758
356 Ga0070684_100028982
357 Ga0070684_100037211
358 Ga0070684_100057540
359 Ga0070684_100065955
360 Ga0070684_100347173
361 Ga0068853_100008648
362 Ga0070672_100004142
363 Ga0070672_100019912
364 Ga0070686_100074751
365 Ga0070696_100142232
366 Ga0070665_100169940
367 Ga0068855_100009917
368 Ga0070664_100051205
369 Ga0068857_100127205
370 Ga0068854_100014764
371 Ga0068856_100011442
372 Ga0068856_100077379
373 Ga0068856_100131667
374 Ga0068856_100289213
375 Ga0070702_100004598
376 Ga0070702_100027985
377 Ga0068852_100058500
378 Ga0068859_100199824
379 Ga0068864_100002446
380 Ga0068866_10022906
381 Ga0068866_10080758
382 Ga0068861_100016223
383 Ga0068851_10056645
384 Ga0068863_100038026
385 Ga0081455_10049149
386 Ga0081538_10000112
387 Ga0081538_10000723
388 Ga0081538_10001129
389 Ga0081538_10001237
390 Ga0081538_10004189
391 Ga0081538_10018613
392 Ga0081538_10024962
393 Ga0081539_10002754
394 Ga0075365_10020125
395 Ga0075432_10000256
396 Ga0075432_10032306
397 Ga0097621_100021889
398 Ga0068871_100038569
399 Ga0075428_100003661
400 Ga0075428_100007225
401 Ga0075430_100001581
402 Ga0075431_100266019
403 Ga0075433_10005757
404 Ga0075434_100004879
405 Ga0075429_100006112
406 Ga0075429_100033952
407 Ga0075429_100141647
408 Ga0068865_100012582
409 Ga0097620_100199822
410 Ga0075435_100010937
411 Ga0111539_10003999
412 Ga0111539_10010353
413 Ga0111539_10018070
414 Ga0111539_10043656
415 Ga0111539_10102498
416 Ga0111539_10175428
417 Ga0111539_10257954
418 Ga0105245_10021863
419 Ga0105245_10031671
420 Ga0105245_10238958
421 Ga0114129_10001306
422 Ga0114129_10007643
423 Ga0114129_10114978
424 Ga0105242_10064387
425 Ga0105248_10073663
426 Ga0105239_10012022
427 Ga0105239_10016925
428 Ga0105239_10085742
429 Ga0157371_10008776
430 Ga0157371_10220680
431 Ga0157369_10112428
432 Ga0157374_10145629
433 Ga0157378_10161308
434 Ga0163162_10101306
435 Ga0157372_10015578
436 Ga0157372_10115513
437 Ga0157375_10016171
438 Ga0163163_10240519
439 Ga0157380_10018270
440 Ga0157377_10033865
441 Ga0157379_10082850
442 Ga0207710_10015238
443 Ga0207688_10024238
444 Ga0207643_10010659
445 Ga0207707_10214172
446 Ga0207660_10041598
447 Ga0207657_10006924
448 Ga0207657_10059931
449 Ga0207649_10037756
450 Ga0207649_10053062
451 Ga0207652_10014730
452 Ga0207694_10039589
453 Ga0207687_10006499
454 Ga0207690_10006808
455 Ga0207690_10122354
456 Ga0207706_10002917
457 Ga0207686_10006569
458 Ga0207669_10013964
459 Ga0207669_10015953
460 Ga0207691_10004695
461 Ga0207691_10010964
462 Ga0207711_10277397
463 Ga0207661_10000559
464 Ga0207661_10071558
465 Ga0207651_10090591
466 Ga0207668_10090766
467 Ga0207640_10015684
468 Ga0207658_10247868
469 Ga0207677_10029694
470 Ga0207703_10031467
471 Ga0207639_10094303
472 Ga0207678_10040053
473 Ga0207678_10063597
474 Ga0207708_10039650
475 Ga0207702_10087785
476 Ga0207648_10024835
477 Ga0207648_10047368
478 Ga0207648_10122523
479 Ga0207674_10061148
480 Ga0207674_10174124
481 Ga0207675_100054500
482 Ga0207683_10010150
483 Ga0207683_10024814
484 Ga0207698_10006255
485 Ga0207428_10000536
486 Ga0207428_10041233
487 Ga0207428_10069279
488 Ga0268266_10215317
489 Ga0373932_0010199
490 Ga0373941_0009412
491 Ga0373961_0009456
492 Ga0373931_0045355
493 Ga0373947_0001154
494 Ga0395900_0001791
495 Ga0395900_0001810
496 Ga0395900_0009064
497 Ga0395900_0014893
498 Ga0395900_0069947
499 Ga0395900_0097030
500 Ga0395900_0132684
501 Ga0395900_0136868
502 Ga0395900_0290593
503 Ga0395898_0000824
504 Ga0395898_0003652
505 Ga0395898_0009894
506 Ga0395898_0022401
507 Ga0395898_0041850
508 Ga0395898_0058980
509 Ga0395898_0078337
510 Ga0395905_0007732
511 Ga0395905_0039995
512 Ga0395905_0061421
513 Ga0395905_0101943
514 Ga0395905_0167920
515 Ga0395905_0216497
516 Ga0395901_0001584
517 Ga0395901_0003623
518 Ga0395901_0008618
519 Ga0395901_0018615
520 Ga0395901_0021222
521 Ga0395901_0029855
522 Ga0395901_0039101
523 Ga0395901_0104894
524 Ga0395901_0114617
525 Ga0395901_0277298
526 Ga0466964_0014291
527 Ga0466958_0036705
528 Ga0466967_0173141
529 Ga0495630_0109629
530 Ga0495631_0032831
531 Ga0495634_0131226
532 Ga0495589_0096193
533 Ga0495676_0073637
534 Ga0495676_0168695
535 Ga0496106_0015438
536 Ga0496106_0063570
537 Ga0496107_0007203
538 Ga0496108_0011624
539 Ga0496108_0096885
540 Ga0496109_0005697
541 Ga0496110_0020011
542 Ga0496110_0039410
543 Ga0496110_0057578
544 Ga0496111_0002529
545 Ga0496111_0097129
546 Ga0496112_0030813
547 Ga0496112_0162963
548 Ga0496112_0374183
549 Ga0496114_0089619
550 Ga0501032_0016957
551 Ga0501033_0025189
552 Ga0501036_0021230
553 Ga0501036_0033721
554 Ga0501038_0044240
555 Ga0501039_0011391
556 Ga0501040_0006340
557 Ga0501040_0006615
558 Ga0501040_0019795
559 Ga0501041_0006618
560 Ga0501041_0012244
561 Ga0501041_0021822
562 Ga0501042_0006630
563 Ga0501043_0020562
564 Ga0501048_0044417
565 Ga0501068_0039089
566 Ga0501069_0014025
567 Ga0501069_0053420
568 Ga0501070_0121003
569 Ga0501071_0003019
570 Ga0501072_0002298
571 Ga0501072_0010887
572 Ga0501072_0033603
573 Ga0501075_0012937
574 Ga0501076_0036450
575 Ga0501076_0196311
576 Ga0501077_0018389
577 Ga0501079_0005613
578 Ga0501079_0012703
579 Ga0501079_0098092
580 Ga0501079_0130819
581 Ga0501080_0051940
582 Ga0501081_0067059
583 Ga0501035_0054272
584 Ga0501044_0085569
585 Ga0501045_0006588
586 nmdc:mga00v17_26161_c1
587 nmdc:mga0yw44_10313_c1
588 nmdc:mga05p37_2685_c1
589 nmdc:mga05p37_52133_c1
590 nmdc:mga05p37_922_c1
591 nmdc:mga09592_132776_c1
592 nmdc:mga09592_154_c1
593 nmdc:mga09592_8889_c1
594 nmdc:mga0qj67_2167_c1
595 nmdc:mga0qj67_94008_c1
596 nmdc:mga06r32_130_c1
597 nmdc:mga06r32_5698_c1
598 nmdc:mga08y16_141163_c1
599 nmdc:mga08y16_159200_c1
600 nmdc:mga08y16_42502_c1
601 nmdc:mga08y16_88261_c1
602 nmdc:mga0n895_19505_c1
603 nmdc:mga0n895_6064_c1
604 nmdc:mga0rr50_159026_c1
605 nmdc:mga0rr50_39899_c1
606 nmdc:mga0a205_16745_c1
607 nmdc:mga0a205_3354_c1
608 Ga0501084_0001632
609 Ga0501084_0043700
610 Ga0501084_0070103
611 Ga0501084_0230418
612 Ga0501082_0013960

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08281

Sigma70_r4_2

Sigma-70, region 4

96

149

0.95

PF20239

DUF6596

Family of unknown function (DUF6596)

167

260

0.95

PF04542

Sigma70_r2

Sigma-70 region 2

1

60

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3vep-assembly4.cif.gz_H crystal structure of sigd4 in complex with its negative regulator rsda 0.9563 114 162
2kcl-assembly1.cif.gz_A solution nmr structure of tetratricopeptide repeat domain protein sru_0103 from salinibacter ruber, northeast structural genomics consortium (nesg) target srr115c 0.895 309 388
3kd7-assembly2.cif.gz_B designed tpr module (ctpr390) in complex with its peptide-ligand (hsp90 peptide) 0.8917 292 372
2kcv-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8917 308 388
3ma5-assembly1.cif.gz_A crystal structure of the tetratricopeptide repeat domain protein q2s6c5_salrd from salinibacter ruber. northeast structural genomics consortium target srr115c. 0.883 309 389
ID Description Score Start End Superfamily
af_F1QF84_463_525_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9165 338 388 1.25.40.10
af_Q3UV71_525_588_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8962 338 390 1.25.40.10
af_A0A1D6HKP2_180_283_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8929 309 388 1.25.40.10
af_K7KUY6_39_195_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8889 289 388 1.25.40.10
af_F1RD24_532_610_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8824 320 388 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A7W1M2D5-F1-model_v4 DUF6596 domain-containing protein 0.974 213 387
AF-A0A5R8MEV5-F1-model_v4 RNA polymerase subunit sigma-24 0.973 278 388
AF-A0A2R7Z2X7-F1-model_v4 DUF6596 domain-containing protein 0.9637 216 385
AF-A0A7W0UF64-F1-model_v4 RNA polymerase subunit sigma-24 0.9628 239 388
AF-W2EU92-F1-model_v4 RNA polymerase subunit sigma-24 0.9619 264 387

Map