F398762

General Info

Members Datasets Scaffolds Average Seq Length
306 211 301 155

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0142724|Ga0373937_0142724_398_931
Length 177
Sequence MREQARAGAGAGYREKVRNNEMKKKRAPPTIRAVRPDDYDGWKPLWDEYNAFYERTGPTALPDEVTQTTWRRFFDSGEPVHCIVAERDGKLVGICHYIFHRSTTRIEPVCYLNDLLTAPDERGQGVGRALILAVYELAKEHGCKRVYWMTHTTNTPGRTLYDKVAKHIGFIQYMKDV

Samples

Sample ID Description Type Environment
1 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
2 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
3 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
4 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
5 2937967321 Serratia sp. YC16 Isolate Unclassified
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
92 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
93 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
136 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
139 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
140 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
141 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
142 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
147 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
148 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
152 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
155 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
156 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
157 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
158 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
159 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
160 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
161 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
162 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
163 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
164 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
165 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
166 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
167 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
168 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
169 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
170 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
171 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
172 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
179 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
180 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
181 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
182 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
183 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
184 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
189 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
190 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
191 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
192 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
193 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
194 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
195 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
196 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
197 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
198 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
200 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
201 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
202 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
203 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
204 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
205 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
206 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
207 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
208 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
209 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
210 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
211 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.37
Metatranscriptomes 0
Isolates 1.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.9
Nodule 0.33
Rhizoplane 3.27
Rhizosphere 82.35
Stem 0
Stem Tuber 0
Unclassified 9.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000042 3300002705 Bacteria 105742
2 JGI25154J39366_1001068 3300002738 Bacteria 10824
3 JGI25157J39369_1000033 3300002741 Bacteria 139508
4 rootH2_10006889 3300003320 Bacteria 6585
5 rootL2_10004273 3300003322 Bacteria 5907
6 rootL2_10063517 3300003322 Bacteria 1363
7 rootH1_10072313 3300003323 Bacteria 2704
8 rootH1_10077766 3300003323 Bacteria 2283
9 Ga0055539_1000318 3300003752 Bacteria 24954
10 Ga0070658_10027144 3300005327 Bacteria 4597
11 Ga0070676_10086002 3300005328 Bacteria 1917
12 Ga0070683_101422372 3300005329 Unclassified 666
13 Ga0070690_100049189 3300005330 Bacteria 2686
14 Ga0070670_100599048 3300005331 Unclassified 986
15 Ga0070677_10238328 3300005333 Unclassified 897
16 Ga0068869_100216567 3300005334 Bacteria 1516
17 Ga0068869_100290565 3300005334 Bacteria 1317
18 Ga0070682_100734905 3300005337 Unclassified 795
19 Ga0070682_101251470 3300005337 Bacteria 628
20 Ga0068868_100292687 3300005338 Bacteria 1381
21 Ga0070660_101379071 3300005339 Bacteria 599
22 Ga0070689_100002161 3300005340 Bacteria 12747
23 Ga0070691_10513003 3300005341 Bacteria 695
24 Ga0070687_100603912 3300005343 Unclassified 754
25 Ga0070661_100172286 3300005344 Bacteria 1644
26 Ga0070675_100049485 3300005354 Bacteria 3450
27 Ga0070675_100305649 3300005354 Bacteria 1402
28 Ga0070671_100140985 3300005355 Bacteria 2034
29 Ga0070674_100978303 3300005356 Bacteria 741
30 Ga0070673_100092369 3300005364 Bacteria 2475
31 Ga0070688_100560171 3300005365 Bacteria 870
32 Ga0070667_100000235 3300005367 Bacteria 63272
33 Ga0070709_10368863 3300005434 Bacteria 1065
34 Ga0070714_100003545 3300005435 Bacteria 11669
35 Ga0070701_10003576 3300005438 Bacteria 6170
36 Ga0070701_10087864 3300005438 Bacteria 1697
37 Ga0070705_100216837 3300005440 Bacteria 1323
38 Ga0070700_100004456 3300005441 Bacteria 7315
39 Ga0070700_100006396 3300005441 Bacteria 6296
40 Ga0070694_100009791 3300005444 Bacteria 5887
41 Ga0070663_100000583 3300005455 Bacteria 19478
42 Ga0070663_101281498 3300005455 Unclassified 646
43 Ga0068867_100117332 3300005459 Unclassified 2052
44 Ga0068867_100216774 3300005459 Bacteria 1540
45 Ga0068867_101152881 3300005459 Bacteria 710
46 Ga0070685_10068076 3300005466 Bacteria 2102
47 Ga0070685_10152130 3300005466 Bacteria 1467
48 Ga0070685_11048222 3300005466 Bacteria 614
49 Ga0070706_100466972 3300005467 Bacteria 1174
50 Ga0070707_100132767 3300005468 Bacteria 2422
51 Ga0070698_101304156 3300005471 Unclassified 676
52 Ga0068853_100019259 3300005539 Bacteria 5657
53 Ga0068853_100117822 3300005539 Bacteria 2366
54 Ga0068853_100602853 3300005539 Bacteria 1043
55 Ga0070672_100005369 3300005543 Bacteria 8491
56 Ga0070672_100503361 3300005543 Bacteria 1048
57 Ga0070686_100026779 3300005544 Bacteria 3483
58 Ga0070686_100065326 3300005544 Bacteria 2363
59 Ga0070695_100364943 3300005545 Bacteria 1085
60 Ga0070696_100647974 3300005546 Bacteria 856
61 Ga0070693_100274673 3300005547 Unclassified 1126
62 Ga0070665_100031629 3300005548 Bacteria 5327
63 Ga0070665_100539704 3300005548 Bacteria 1178
64 Ga0070704_101005429 3300005549 Bacteria 754
65 Ga0068855_100142598 3300005563 Bacteria 2729
66 Ga0068857_100020149 3300005577 Bacteria 5862
67 Ga0068857_100195205 3300005577 Bacteria 1844
68 Ga0068854_100002235 3300005578 Bacteria 11915
69 Ga0068854_101687905 3300005578 Unclassified 579
70 Ga0068856_100001296 3300005614 Bacteria 26308
71 Ga0070702_100310588 3300005615 Bacteria 1094
72 Ga0068852_100463284 3300005616 Bacteria 1257
73 Ga0068852_101191264 3300005616 Bacteria 783
74 Ga0068859_100021265 3300005617 Bacteria 6511
75 Ga0068859_100348297 3300005617 Bacteria 1576
76 Ga0068859_100393712 3300005617 Bacteria 1481
77 Ga0068859_101593084 3300005617 Unclassified 721
78 Ga0068864_100209780 3300005618 Bacteria 1793
79 Ga0068866_10299970 3300005718 Unclassified 1003
80 Ga0068861_100001424 3300005719 Bacteria 15075
81 Ga0068861_100014072 3300005719 Bacteria 5611
82 Ga0068861_100046408 3300005719 Bacteria 3275
83 Ga0068851_10373241 3300005834 Bacteria 834
84 Ga0068863_100017581 3300005841 Bacteria 6851
85 Ga0068863_100019457 3300005841 Bacteria 6495
86 Ga0068858_100257174 3300005842 Bacteria 1659
87 Ga0068858_100871650 3300005842 Bacteria 880
88 Ga0068860_100063996 3300005843 Bacteria 3493
89 Ga0068862_100062094 3300005844 Unclassified 3213
90 Ga0068862_100210919 3300005844 Bacteria 1755
91 Ga0068862_100810127 3300005844 Bacteria 915
92 Ga0068862_100948648 3300005844 Unclassified 848
93 Ga0075366_10573724 3300006195 Bacteria 699
94 Ga0097621_100008658 3300006237 Bacteria 7343
95 Ga0075370_10018325 3300006353 Bacteria 3799
96 Ga0068871_100827935 3300006358 Bacteria 854
97 Ga0068865_100138150 3300006881 Bacteria 1834
98 Ga0068865_100164769 3300006881 Unclassified 1694
99 Ga0097620_100021265 3300006931 Bacteria 6511
100 Ga0097620_100348309 3300006931 Bacteria 1576
101 Ga0097620_100393707 3300006931 Bacteria 1481
102 Ga0097620_101593324 3300006931 Unclassified 721
103 Ga0105240_10125177 3300009093 Bacteria 3090
104 Ga0105240_10470185 3300009093 Bacteria 1403
105 Ga0105240_10484377 3300009093 Bacteria 1378
106 Ga0105240_10484698 3300009093 Bacteria 1378
107 Ga0111539_10022311 3300009094 Bacteria 7779
108 Ga0111539_10334997 3300009094 Bacteria 1761
109 Ga0105243_12158921 3300009148 Unclassified 593
110 Ga0105237_10002091 3300009545 Bacteria 25231
111 Ga0105237_10064442 3300009545 Bacteria 3661
112 Ga0105238_10031452 3300009551 Bacteria 5403
113 Ga0105238_10084830 3300009551 Bacteria 3157
114 Ga0105249_10000271 3300009553 Bacteria 54577
115 Ga0105239_10148746 3300010375 Bacteria 2613
116 Ga0105239_10449921 3300010375 Bacteria 1461
117 Ga0157369_10018565 3300013105 Bacteria 7795
118 Ga0157378_11340246 3300013297 Unclassified 757
119 Ga0157372_10073773 3300013307 Bacteria 3847
120 Ga0157372_10362454 3300013307 Bacteria 1689
121 Ga0163163_10015801 3300014325 Bacteria 6992
122 Ga0157380_10004304 3300014326 Bacteria 9870
123 Ga0157380_10956235 3300014326 Bacteria 887
124 Ga0157380_11844823 3300014326 Unclassified 664
125 Ga0157377_10190085 3300014745 Bacteria 1297
126 Ga0157376_10625479 3300014969 Bacteria 1074
127 Ga0163161_10249508 3300017792 Unclassified 1383
128 Ga0209674_115121 3300025226 Bacteria 672
129 Ga0209258_100956 3300025242 Bacteria 13831
130 Ga0209646_1000089 3300025246 Bacteria 189974
131 Ga0209026_1000028 3300025250 Bacteria 341399
132 Ga0209677_100066 3300025253 Bacteria 149370
133 Ga0209759_1000021 3300025256 Bacteria 341399
134 Ga0209759_1003028 3300025256 Bacteria 6932
135 Ga0207682_10078784 3300025893 Bacteria 1408
136 Ga0207699_10158384 3300025906 Bacteria 1505
137 Ga0207645_10068801 3300025907 Bacteria 2264
138 Ga0207645_10270772 3300025907 Bacteria 1126
139 Ga0207705_10150383 3300025909 Bacteria 1744
140 Ga0207695_10002511 3300025913 Bacteria 26961
141 Ga0207695_10102063 3300025913 Bacteria 2862
142 Ga0207695_10170504 3300025913 Bacteria 2102
143 Ga0207671_10008618 3300025914 Bacteria 8617
144 Ga0207671_10712820 3300025914 Bacteria 798
145 Ga0207649_10672156 3300025920 Bacteria 802
146 Ga0207649_11069180 3300025920 Bacteria 636
147 Ga0207646_10193510 3300025922 Bacteria 1837
148 Ga0207681_10016723 3300025923 Bacteria 4596
149 Ga0207694_10078534 3300025924 Bacteria 2587
150 Ga0207650_10534499 3300025925 Unclassified 982
151 Ga0207659_10052184 3300025926 Bacteria 2912
152 Ga0207687_10109965 3300025927 Bacteria 2043
153 Ga0207664_10080666 3300025929 Bacteria 2645
154 Ga0207644_10395970 3300025931 Unclassified 1128
155 Ga0207644_10520235 3300025931 Bacteria 983
156 Ga0207644_10823842 3300025931 Bacteria 777
157 Ga0207706_10345682 3300025933 Bacteria 1293
158 Ga0207706_10839646 3300025933 Bacteria 778
159 Ga0207670_10003832 3300025936 Bacteria 8007
160 Ga0207704_10191380 3300025938 Unclassified 1489
161 Ga0207691_10438761 3300025940 Bacteria 1112
162 Ga0207689_10308099 3300025942 Bacteria 1313
163 Ga0207689_10611467 3300025942 Bacteria 917
164 Ga0207689_10853239 3300025942 Unclassified 768
165 Ga0207679_10286454 3300025945 Bacteria 1415
166 Ga0207679_10934108 3300025945 Unclassified 794
167 Ga0207667_10163269 3300025949 Bacteria 2290
168 Ga0207651_10505637 3300025960 Unclassified 1045
169 Ga0207712_10000301 3300025961 Bacteria 46175
170 Ga0207712_11868689 3300025961 Bacteria 538
171 Ga0207668_10195696 3300025972 Bacteria 1606
172 Ga0207640_10050219 3300025981 Bacteria 2704
173 Ga0207640_11474791 3300025981 Unclassified 611
174 Ga0207658_10000056 3300025986 Bacteria 124846
175 Ga0207703_10382125 3300026035 Bacteria 1303
176 Ga0207639_10016763 3300026041 Bacteria 5189
177 Ga0207639_10387218 3300026041 Bacteria 1257
178 Ga0207678_10000389 3300026067 Bacteria 39987
179 Ga0207678_11231624 3300026067 Unclassified 662
180 Ga0207708_10013255 3300026075 Bacteria 6155
181 Ga0207708_10037540 3300026075 Bacteria 3690
182 Ga0207702_10000200 3300026078 Bacteria 70607
183 Ga0207641_10147220 3300026088 Bacteria 2130
184 Ga0207648_10342525 3300026089 Bacteria 1346
185 Ga0207648_11444432 3300026089 Bacteria 647
186 Ga0207676_10390738 3300026095 Bacteria 1297
187 Ga0207674_10002598 3300026116 Bacteria 22710
188 Ga0207674_10084136 3300026116 Bacteria 3180
189 Ga0207674_10475398 3300026116 Bacteria 1208
190 Ga0207675_100001730 3300026118 Bacteria 21862
191 Ga0207675_100003384 3300026118 Bacteria 15582
192 Ga0207675_100049787 3300026118 Bacteria 3909
193 Ga0207675_100074216 3300026118 Bacteria 3183
194 Ga0207675_100363101 3300026118 Bacteria 1421
195 Ga0207698_10081377 3300026142 Bacteria 2614
196 Ga0207698_10280980 3300026142 Bacteria 1540
197 Ga0268265_10009358 3300028380 Bacteria 6622
198 Ga0268265_10043460 3300028380 Unclassified 3341
199 Ga0268265_10080128 3300028380 Bacteria 2574
200 Ga0268264_10715753 3300028381 Bacteria 995
201 Ga0307513_10022541 3300031456 Bacteria 7396
202 Ga0307516_10000107 3300031730 Bacteria 95288
203 Ga0307405_10143790 3300031731 Bacteria 1667
204 Ga0307405_11331853 3300031731 Unclassified 626
205 Ga0307413_10092553 3300031824 Unclassified 1973
206 Ga0307413_10156378 3300031824 Unclassified 1595
207 Ga0307410_10135187 3300031852 Bacteria 1816
208 Ga0307410_10855697 3300031852 Unclassified 776
209 Ga0307406_10009808 3300031901 Bacteria 5389
210 Ga0307406_10226720 3300031901 Unclassified 1393
211 Ga0307406_10639611 3300031901 Unclassified 882
212 Ga0307407_10008692 3300031903 Bacteria 4678
213 Ga0307407_10047729 3300031903 Unclassified 2432
214 Ga0307409_100001730 3300031995 Bacteria 11010
215 Ga0307409_100012747 3300031995 Bacteria 5371
216 Ga0307409_100276892 3300031995 Unclassified 1548
217 Ga0307416_100069791 3300032002 Bacteria 2910
218 Ga0307416_100556724 3300032002 Bacteria 1221
219 Ga0307414_10406311 3300032004 Unclassified 1184
220 Ga0307411_10015823 3300032005 Bacteria 4250
221 Ga0307411_10429468 3300032005 Bacteria 1100
222 Ga0307415_100081904 3300032126 Bacteria 2307
223 Ga0307415_100172096 3300032126 Unclassified 1690
224 Ga0307415_100474600 3300032126 Unclassified 1087
225 Ga0307415_100816184 3300032126 Bacteria 853
226 Ga0373934_0077180 3300035086 Bacteria 1336
227 Ga0373957_0313209 3300035120 Unclassified 667
228 Ga0373937_0142724 3300036401 Bacteria 2241
229 Ga0395898_0024484 3300037466 Bacteria 6089
230 Ga0395905_0241794 3300037471 Bacteria 1687
231 Ga0395905_0509670 3300037471 Bacteria 1103
232 Ga0436364_0832650 3300037853 Bacteria 1573
233 Ga0395901_0002128 3300038443 Bacteria 20288
234 Ga0451789_1232859 3300041443 Bacteria 588
235 Ga0451791_1624986 3300041451 Bacteria 2931
236 Ga0451802_0724312 3300041460 Bacteria 1759
237 Ga0451807_0207673 3300041486 Unclassified 1303
238 Ga0451807_2339569 3300041486 Bacteria 1259
239 Ga0451833_1067120 3300041491 Bacteria 1406
240 Ga0451837_1475514 3300041494 Bacteria 1462
241 Ga0451849_0175001 3300041505 Bacteria 755
242 Ga0451577_0197345 3300042876 Bacteria 1816
243 Ga0466967_0752368 3300045976 Bacteria 967
244 Ga0495590_0029645 3300046457 Unclassified 1917
245 Ga0495638_0082565 3300046460 Unclassified 1949
246 Ga0495650_0007657 3300046471 Bacteria 6442
247 Ga0495639_0059824 3300046475 Bacteria 1744
248 Ga0495652_0774737 3300046529 Bacteria 640
249 Ga0495668_0325306 3300046616 Unclassified 843
250 Ga0495625_0006350 3300046660 Bacteria 10559
251 Ga0495625_0279606 3300046660 Bacteria 1074
252 Ga0495671_0195027 3300046692 Bacteria 983
253 Ga0495589_0514176 3300046794 Unclassified 546
254 Ga0495686_0004347 3300047472 Bacteria 11705
255 Ga0496104_0219006 3300048907 Bacteria 1816
256 Ga0496105_0319395 3300048908 Bacteria 1245
257 Ga0496108_0510300 3300048911 Bacteria 1050
258 Ga0496114_0827729 3300048917 Bacteria 805
259 Ga0496115_0913800 3300048918 Bacteria 676
260 Ga0496119_0000909 3300048922 Bacteria 38357
261 Ga0496120_0000159 3300048923 Bacteria 112577
262 Ga0496120_0000233 3300048923 Bacteria 95589
263 Ga0496121_0055497 3300048924 Bacteria 3300
264 Ga0496122_0005693 3300048925 Bacteria 14708
265 Ga0496123_0004026 3300048926 Bacteria 15858
266 Ga0496124_0000008 3300048927 Bacteria 864372
267 Ga0501033_0009951 3300049570 Bacteria 7300
268 Ga0501036_0859187 3300049572 Unclassified 746
269 Ga0501037_0126589 3300049573 Bacteria 1834
270 Ga0501042_0112856 3300049578 Bacteria 1957
271 Ga0501042_0574117 3300049578 Unclassified 820
272 Ga0501042_0593559 3300049578 Bacteria 805
273 Ga0501067_0006895 3300049583 Bacteria 6303
274 Ga0501068_0003491 3300049584 Bacteria 8476
275 Ga0501068_0326143 3300049584 Bacteria 985
276 Ga0501071_0004758 3300049587 Bacteria 8643
277 Ga0501072_0517422 3300049588 Bacteria 943
278 Ga0501073_0012636 3300049589 Bacteria 6159
279 Ga0501074_0016530 3300049590 Bacteria 5356
280 Ga0501076_0109987 3300049592 Unclassified 2227
281 Ga0501079_0000501 3300049741 Bacteria 25528
282 Ga0501080_0001374 3300049742 Bacteria 20358
283 Ga0501080_0706544 3300049742 Unclassified 889
284 Ga0501083_0030071 3300049744 Bacteria 3732
285 Ga0501035_0097372 3300049822 Bacteria 2584
286 Ga0501035_0728320 3300049822 Unclassified 798
287 Ga0501044_0298211 3300049823 Bacteria 1541
288 nmdc:mga0k408_126741_c1 3300050493 Bacteria 1514
289 nmdc:mga07m45_1213_c1 3300050496 Bacteria 11680
290 nmdc:mga08y16_30591_c1 3300050511 Bacteria 5665
291 nmdc:mga08y16_584340_c1 3300050511 Unclassified 1127
292 Ga0500643_000450 3300053087 Bacteria 30395
293 Ga0500641_0001571 3300053096 Bacteria 8138
294 Ga0500597_000432 3300053120 Bacteria 8806
295 Ga0500618_132838 3300053125 Bacteria 565
296 Ga0500559_0021509 3300053136 Bacteria 2734
297 Ga0500559_0022881 3300053136 Bacteria 2651
298 Ga0500624_016891 3300053157 Bacteria 1132
299 Ga0501084_0025257 3300054114 Bacteria 4955
300 Ga0501082_0027589 3300060353 Bacteria 4888
301 Ga0530510_0820180 3300061734 Unclassified 710

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041443 Ga0451789_1232859 Ga0451789_1232859_125_562 144
2 3300046692 Ga0495671_0195027 Ga0495671_0195027_12_446 144
3 3300046794 Ga0495589_0514176 Ga0495589_0514176_22_456 144
4 iso_pu_bacteria 2894023352 2894024687 147
5 3300025961 Ga0207712_11868689 Ga0207712_118686891 148
6 3300049572 Ga0501036_0859187 Ga0501036_0859187_208_666 148
7 3300049578 Ga0501042_0574117 Ga0501042_0574117_94_552 148
8 3300049742 Ga0501080_0706544 Ga0501080_0706544_349_807 148
9 3300061734 Ga0530510_0820180 Ga0530510_0820180_22_534 148
10 3300005355 Ga0070671_100140985 Ga0070671_1001409853 149
11 3300025931 Ga0207644_10395970 Ga0207644_103959701 149
12 3300053096 Ga0500641_0001571 Ga0500641_0001571_96_545 149
13 iso_pu_bacteria 2721755763 2723877982 149
14 iso_pu_bacteria 2772190666 2772439080 149
15 iso_pu_bacteria 2937967321 2937967697 149
16 iso_pu_bacteria 2687453130 2687582629 150
17 3300005434 Ga0070709_10368863 Ga0070709_103688631 151
18 3300005435 Ga0070714_100003545 Ga0070714_10000354512 151
19 3300005455 Ga0070663_101281498 Ga0070663_1012814981 151
20 3300005578 Ga0068854_101687905 Ga0068854_1016879051 151
21 3300025929 Ga0207664_10080666 Ga0207664_100806665 151
22 3300025931 Ga0207644_10520235 Ga0207644_105202352 151
23 3300025981 Ga0207640_11474791 Ga0207640_114747911 151
24 3300026067 Ga0207678_11231624 Ga0207678_112316242 151
25 3300048907 Ga0496104_0219006 Ga0496104_0219006_1002_1469 151
26 3300002705 JGI25156J39149_1000042 JGI25156J39149_100004217 152
27 3300002738 JGI25154J39366_1001068 JGI25154J39366_10010688 152
28 3300002741 JGI25157J39369_1000033 JGI25157J39369_100003312 152
29 3300003320 rootH2_10006889 rootH2_100068895 152
30 3300003322 rootL2_10004273 rootL2_100042736 152
31 3300003322 rootL2_10063517 rootL2_100635172 152
32 3300003323 rootH1_10072313 rootH1_100723132 152
33 3300003323 rootH1_10077766 rootH1_100777662 152
34 3300003752 Ga0055539_1000318 Ga0055539_10003183 152
35 3300005327 Ga0070658_10027144 Ga0070658_100271444 152
36 3300005328 Ga0070676_10086002 Ga0070676_100860021 152
37 3300005329 Ga0070683_101422372 Ga0070683_1014223721 152
38 3300005330 Ga0070690_100049189 Ga0070690_1000491894 152
39 3300005331 Ga0070670_100599048 Ga0070670_1005990482 152
40 3300005333 Ga0070677_10238328 Ga0070677_102383282 152
41 3300005334 Ga0068869_100216567 Ga0068869_1002165672 152
42 3300005334 Ga0068869_100290565 Ga0068869_1002905653 152
43 3300005337 Ga0070682_100734905 Ga0070682_1007349051 152
44 3300005337 Ga0070682_101251470 Ga0070682_1012514701 152
45 3300005338 Ga0068868_100292687 Ga0068868_1002926872 152
46 3300005339 Ga0070660_101379071 Ga0070660_1013790711 152
47 3300005340 Ga0070689_100002161 Ga0070689_10000216111 152
48 3300005341 Ga0070691_10513003 Ga0070691_105130031 152
49 3300005343 Ga0070687_100603912 Ga0070687_1006039121 152
50 3300005344 Ga0070661_100172286 Ga0070661_1001722863 152
51 3300005354 Ga0070675_100049485 Ga0070675_1000494854 152
52 3300005354 Ga0070675_100305649 Ga0070675_1003056492 152
53 3300005356 Ga0070674_100978303 Ga0070674_1009783031 152
54 3300005364 Ga0070673_100092369 Ga0070673_1000923693 152
55 3300005365 Ga0070688_100560171 Ga0070688_1005601711 152
56 3300005367 Ga0070667_100000235 Ga0070667_10000023520 152
57 3300005438 Ga0070701_10003576 Ga0070701_100035763 152
58 3300005438 Ga0070701_10087864 Ga0070701_100878641 152
59 3300005440 Ga0070705_100216837 Ga0070705_1002168371 152
60 3300005441 Ga0070700_100004456 Ga0070700_1000044567 152
61 3300005441 Ga0070700_100006396 Ga0070700_1000063964 152
62 3300005444 Ga0070694_100009791 Ga0070694_1000097914 152
63 3300005455 Ga0070663_100000583 Ga0070663_10000058315 152
64 3300005459 Ga0068867_100117332 Ga0068867_1001173323 152
65 3300005459 Ga0068867_100216774 Ga0068867_1002167742 152
66 3300005459 Ga0068867_101152881 Ga0068867_1011528811 152
67 3300005466 Ga0070685_10068076 Ga0070685_100680761 152
68 3300005466 Ga0070685_10152130 Ga0070685_101521302 152
69 3300005466 Ga0070685_11048222 Ga0070685_110482221 152
70 3300005467 Ga0070706_100466972 Ga0070706_1004669722 152
71 3300005468 Ga0070707_100132767 Ga0070707_1001327672 152
72 3300005471 Ga0070698_101304156 Ga0070698_1013041561 152
73 3300005539 Ga0068853_100019259 Ga0068853_10001925910 152
74 3300005539 Ga0068853_100117822 Ga0068853_1001178223 152
75 3300005539 Ga0068853_100602853 Ga0068853_1006028531 152
76 3300005543 Ga0070672_100005369 Ga0070672_1000053694 152
77 3300005543 Ga0070672_100503361 Ga0070672_1005033612 152
78 3300005544 Ga0070686_100026779 Ga0070686_1000267793 152
79 3300005544 Ga0070686_100065326 Ga0070686_1000653264 152
80 3300005545 Ga0070695_100364943 Ga0070695_1003649432 152
81 3300005546 Ga0070696_100647974 Ga0070696_1006479742 152
82 3300005547 Ga0070693_100274673 Ga0070693_1002746731 152
83 3300005548 Ga0070665_100031629 Ga0070665_1000316294 152
84 3300005548 Ga0070665_100539704 Ga0070665_1005397042 152
85 3300005549 Ga0070704_101005429 Ga0070704_1010054291 152
86 3300005563 Ga0068855_100142598 Ga0068855_1001425983 152
87 3300005577 Ga0068857_100020149 Ga0068857_1000201491 152
88 3300005577 Ga0068857_100195205 Ga0068857_1001952053 152
89 3300005578 Ga0068854_100002235 Ga0068854_1000022357 152
90 3300005614 Ga0068856_100001296 Ga0068856_10000129615 152
91 3300005615 Ga0070702_100310588 Ga0070702_1003105881 152
92 3300005616 Ga0068852_100463284 Ga0068852_1004632842 152
93 3300005616 Ga0068852_101191264 Ga0068852_1011912642 152
94 3300005617 Ga0068859_100021265 Ga0068859_1000212659 152
95 3300005617 Ga0068859_100348297 Ga0068859_1003482972 152
96 3300005617 Ga0068859_100393712 Ga0068859_1003937122 152
97 3300005617 Ga0068859_101593084 Ga0068859_1015930842 152
98 3300005618 Ga0068864_100209780 Ga0068864_1002097803 152
99 3300005718 Ga0068866_10299970 Ga0068866_102999701 152
100 3300005719 Ga0068861_100001424 Ga0068861_1000014246 152
101 3300005719 Ga0068861_100014072 Ga0068861_1000140727 152
102 3300005719 Ga0068861_100046408 Ga0068861_1000464084 152
103 3300005834 Ga0068851_10373241 Ga0068851_103732411 152
104 3300005841 Ga0068863_100017581 Ga0068863_1000175819 152
105 3300005841 Ga0068863_100019457 Ga0068863_1000194572 152
106 3300005842 Ga0068858_100257174 Ga0068858_1002571743 152
107 3300005842 Ga0068858_100871650 Ga0068858_1008716501 152
108 3300005843 Ga0068860_100063996 Ga0068860_1000639963 152
109 3300005844 Ga0068862_100062094 Ga0068862_1000620943 152
110 3300005844 Ga0068862_100210919 Ga0068862_1002109193 152
111 3300005844 Ga0068862_100810127 Ga0068862_1008101272 152
112 3300005844 Ga0068862_100948648 Ga0068862_1009486482 152
113 3300006195 Ga0075366_10573724 Ga0075366_105737242 152
114 3300006237 Ga0097621_100008658 Ga0097621_1000086585 152
115 3300006353 Ga0075370_10018325 Ga0075370_100183254 152
116 3300006358 Ga0068871_100827935 Ga0068871_1008279352 152
117 3300006881 Ga0068865_100138150 Ga0068865_1001381503 152
118 3300006881 Ga0068865_100164769 Ga0068865_1001647692 152
119 3300006931 Ga0097620_100021265 Ga0097620_1000212659 152
120 3300006931 Ga0097620_100348309 Ga0097620_1003483092 152
121 3300006931 Ga0097620_100393707 Ga0097620_1003937072 152
122 3300006931 Ga0097620_101593324 Ga0097620_1015933242 152
123 3300009093 Ga0105240_10125177 Ga0105240_101251773 152
124 3300009093 Ga0105240_10470185 Ga0105240_104701852 152
125 3300009093 Ga0105240_10484377 Ga0105240_104843773 152
126 3300009093 Ga0105240_10484698 Ga0105240_104846982 152
127 3300009094 Ga0111539_10022311 Ga0111539_100223117 152
128 3300009094 Ga0111539_10334997 Ga0111539_103349972 152
129 3300009148 Ga0105243_12158921 Ga0105243_121589211 152
130 3300009545 Ga0105237_10002091 Ga0105237_100020915 152
131 3300009545 Ga0105237_10064442 Ga0105237_100644422 152
132 3300009551 Ga0105238_10031452 Ga0105238_100314527 152
133 3300009551 Ga0105238_10084830 Ga0105238_100848302 152
134 3300009553 Ga0105249_10000271 Ga0105249_1000027133 152
135 3300010375 Ga0105239_10148746 Ga0105239_101487462 152
136 3300010375 Ga0105239_10449921 Ga0105239_104499212 152
137 3300013105 Ga0157369_10018565 Ga0157369_100185656 152
138 3300013297 Ga0157378_11340246 Ga0157378_113402462 152
139 3300013307 Ga0157372_10073773 Ga0157372_100737733 152
140 3300013307 Ga0157372_10362454 Ga0157372_103624543 152
141 3300014325 Ga0163163_10015801 Ga0163163_100158017 152
142 3300014326 Ga0157380_10004304 Ga0157380_1000430410 152
143 3300014326 Ga0157380_10956235 Ga0157380_109562351 152
144 3300014326 Ga0157380_11844823 Ga0157380_118448231 152
145 3300014745 Ga0157377_10190085 Ga0157377_101900852 152
146 3300014969 Ga0157376_10625479 Ga0157376_106254791 152
147 3300017792 Ga0163161_10249508 Ga0163161_102495082 152
148 3300025226 Ga0209674_115121 Ga0209674_1151211 152
149 3300025242 Ga0209258_100956 Ga0209258_1009569 152
150 3300025246 Ga0209646_1000089 Ga0209646_1000089103 152
151 3300025250 Ga0209026_1000028 Ga0209026_1000028182 152
152 3300025253 Ga0209677_100066 Ga0209677_10006699 152
153 3300025256 Ga0209759_1000021 Ga0209759_1000021103 152
154 3300025256 Ga0209759_1003028 Ga0209759_10030286 152
155 3300025893 Ga0207682_10078784 Ga0207682_100787842 152
156 3300025906 Ga0207699_10158384 Ga0207699_101583842 152
157 3300025907 Ga0207645_10068801 Ga0207645_100688012 152
158 3300025907 Ga0207645_10270772 Ga0207645_102707722 152
159 3300025909 Ga0207705_10150383 Ga0207705_101503832 152
160 3300025913 Ga0207695_10002511 Ga0207695_100025112 152
161 3300025913 Ga0207695_10102063 Ga0207695_101020634 152
162 3300025913 Ga0207695_10170504 Ga0207695_101705041 152
163 3300025914 Ga0207671_10008618 Ga0207671_100086187 152
164 3300025914 Ga0207671_10712820 Ga0207671_107128202 152
165 3300025920 Ga0207649_10672156 Ga0207649_106721562 152
166 3300025920 Ga0207649_11069180 Ga0207649_110691802 152
167 3300025922 Ga0207646_10193510 Ga0207646_101935102 152
168 3300025923 Ga0207681_10016723 Ga0207681_100167235 152
169 3300025924 Ga0207694_10078534 Ga0207694_100785342 152
170 3300025925 Ga0207650_10534499 Ga0207650_105344991 152
171 3300025926 Ga0207659_10052184 Ga0207659_100521844 152
172 3300025927 Ga0207687_10109965 Ga0207687_101099652 152
173 3300025931 Ga0207644_10823842 Ga0207644_108238422 152
174 3300025933 Ga0207706_10345682 Ga0207706_103456822 152
175 3300025933 Ga0207706_10839646 Ga0207706_108396462 152
176 3300025936 Ga0207670_10003832 Ga0207670_1000383210 152
177 3300025938 Ga0207704_10191380 Ga0207704_101913802 152
178 3300025940 Ga0207691_10438761 Ga0207691_104387613 152
179 3300025942 Ga0207689_10308099 Ga0207689_103080993 152
180 3300025942 Ga0207689_10611467 Ga0207689_106114671 152
181 3300025942 Ga0207689_10853239 Ga0207689_108532392 152
182 3300025945 Ga0207679_10286454 Ga0207679_102864543 152
183 3300025945 Ga0207679_10934108 Ga0207679_109341082 152
184 3300025949 Ga0207667_10163269 Ga0207667_101632692 152
185 3300025960 Ga0207651_10505637 Ga0207651_105056372 152
186 3300025961 Ga0207712_10000301 Ga0207712_1000030121 152
187 3300025972 Ga0207668_10195696 Ga0207668_101956961 152
188 3300025981 Ga0207640_10050219 Ga0207640_100502192 152
189 3300025986 Ga0207658_10000056 Ga0207658_100000562 152
190 3300026035 Ga0207703_10382125 Ga0207703_103821252 152
191 3300026041 Ga0207639_10016763 Ga0207639_100167632 152
192 3300026041 Ga0207639_10387218 Ga0207639_103872183 152
193 3300026067 Ga0207678_10000389 Ga0207678_1000038938 152
194 3300026075 Ga0207708_10013255 Ga0207708_100132555 152
195 3300026075 Ga0207708_10037540 Ga0207708_100375404 152
196 3300026078 Ga0207702_10000200 Ga0207702_1000020036 152
197 3300026088 Ga0207641_10147220 Ga0207641_101472203 152
198 3300026089 Ga0207648_10342525 Ga0207648_103425253 152
199 3300026089 Ga0207648_11444432 Ga0207648_114444321 152
200 3300026095 Ga0207676_10390738 Ga0207676_103907382 152
201 3300026116 Ga0207674_10002598 Ga0207674_100025982 152
202 3300026116 Ga0207674_10084136 Ga0207674_100841363 152
203 3300026116 Ga0207674_10475398 Ga0207674_104753982 152
204 3300026118 Ga0207675_100001730 Ga0207675_1000017306 152
205 3300026118 Ga0207675_100003384 Ga0207675_1000033846 152
206 3300026118 Ga0207675_100049787 Ga0207675_1000497873 152
207 3300026118 Ga0207675_100074216 Ga0207675_1000742164 152
208 3300026118 Ga0207675_100363101 Ga0207675_1003631012 152
209 3300026142 Ga0207698_10081377 Ga0207698_100813773 152
210 3300026142 Ga0207698_10280980 Ga0207698_102809802 152
211 3300028380 Ga0268265_10009358 Ga0268265_100093587 152
212 3300028380 Ga0268265_10043460 Ga0268265_100434605 152
213 3300028380 Ga0268265_10080128 Ga0268265_100801283 152
214 3300028381 Ga0268264_10715753 Ga0268264_107157532 152
215 3300031456 Ga0307513_10022541 Ga0307513_100225417 152
216 3300031730 Ga0307516_10000107 Ga0307516_1000010710 152
217 3300031731 Ga0307405_10143790 Ga0307405_101437902 152
218 3300031731 Ga0307405_11331853 Ga0307405_113318532 152
219 3300031824 Ga0307413_10092553 Ga0307413_100925533 152
220 3300031824 Ga0307413_10156378 Ga0307413_101563782 152
221 3300031852 Ga0307410_10135187 Ga0307410_101351873 152
222 3300031852 Ga0307410_10855697 Ga0307410_108556972 152
223 3300031901 Ga0307406_10009808 Ga0307406_100098086 152
224 3300031901 Ga0307406_10226720 Ga0307406_102267203 152
225 3300031901 Ga0307406_10639611 Ga0307406_106396112 152
226 3300031903 Ga0307407_10008692 Ga0307407_100086926 152
227 3300031903 Ga0307407_10047729 Ga0307407_100477294 152
228 3300031995 Ga0307409_100001730 Ga0307409_1000017303 152
229 3300031995 Ga0307409_100012747 Ga0307409_1000127474 152
230 3300031995 Ga0307409_100276892 Ga0307409_1002768922 152
231 3300032002 Ga0307416_100069791 Ga0307416_1000697912 152
232 3300032002 Ga0307416_100556724 Ga0307416_1005567243 152
233 3300032004 Ga0307414_10406311 Ga0307414_104063112 152
234 3300032005 Ga0307411_10015823 Ga0307411_100158233 152
235 3300032005 Ga0307411_10429468 Ga0307411_104294681 152
236 3300032126 Ga0307415_100081904 Ga0307415_1000819043 152
237 3300032126 Ga0307415_100172096 Ga0307415_1001720962 152
238 3300032126 Ga0307415_100474600 Ga0307415_1004746003 152
239 3300032126 Ga0307415_100816184 Ga0307415_1008161842 152
240 3300035086 Ga0373934_0077180 Ga0373934_0077180_673_1131 152
241 3300035120 Ga0373957_0313209 Ga0373957_0313209_34_504 152
242 3300036401 Ga0373937_0142724 Ga0373937_0142724_398_931 152
243 3300037466 Ga0395898_0024484 Ga0395898_0024484_3977_4435 152
244 3300037471 Ga0395905_0241794 Ga0395905_0241794_10_468 152
245 3300037471 Ga0395905_0509670 Ga0395905_0509670_187_660 152
246 3300037853 Ga0436364_0832650 Ga0436364_0832650_90_551 152
247 3300038443 Ga0395901_0002128 Ga0395901_0002128_19631_20089 152
248 3300041451 Ga0451791_1624986 Ga0451791_1624986_1298_1771 152
249 3300041460 Ga0451802_0724312 Ga0451802_0724312_982_1455 152
250 3300041486 Ga0451807_0207673 Ga0451807_0207673_403_873 152
251 3300041486 Ga0451807_2339569 Ga0451807_2339569_369_842 152
252 3300041491 Ga0451833_1067120 Ga0451833_1067120_516_989 152
253 3300041494 Ga0451837_1475514 Ga0451837_1475514_714_1187 152
254 3300041505 Ga0451849_0175001 Ga0451849_0175001_142_615 152
255 3300042876 Ga0451577_0197345 Ga0451577_0197345_365_829 152
256 3300045976 Ga0466967_0752368 Ga0466967_0752368_134_607 152
257 3300046457 Ga0495590_0029645 Ga0495590_0029645_216_686 152
258 3300046460 Ga0495638_0082565 Ga0495638_0082565_524_994 152
259 3300046471 Ga0495650_0007657 Ga0495650_0007657_5400_5879 152
260 3300046475 Ga0495639_0059824 Ga0495639_0059824_155_616 152
261 3300046529 Ga0495652_0774737 Ga0495652_0774737_73_534 152
262 3300046616 Ga0495668_0325306 Ga0495668_0325306_22_492 152
263 3300046660 Ga0495625_0006350 Ga0495625_0006350_162_632 152
264 3300046660 Ga0495625_0279606 Ga0495625_0279606_254_724 152
265 3300047472 Ga0495686_0004347 Ga0495686_0004347_6748_7209 152
266 3300048908 Ga0496105_0319395 Ga0496105_0319395_317_787 152
267 3300048911 Ga0496108_0510300 Ga0496108_0510300_118_576 152
268 3300048917 Ga0496114_0827729 Ga0496114_0827729_182_652 152
269 3300048918 Ga0496115_0913800 Ga0496115_0913800_102_572 152
270 3300048922 Ga0496119_0000909 Ga0496119_0000909_1849_2310 152
271 3300048923 Ga0496120_0000159 Ga0496120_0000159_103695_104156 152
272 3300048923 Ga0496120_0000233 Ga0496120_0000233_87568_88071 152
273 3300048924 Ga0496121_0055497 Ga0496121_0055497_1153_1614 152
274 3300048925 Ga0496122_0005693 Ga0496122_0005693_10815_11276 152
275 3300048926 Ga0496123_0004026 Ga0496123_0004026_4668_5129 152
276 3300048927 Ga0496124_0000008 Ga0496124_0000008_171307_171768 152
277 3300049570 Ga0501033_0009951 Ga0501033_0009951_3045_3506 152
278 3300049573 Ga0501037_0126589 Ga0501037_0126589_1177_1644 152
279 3300049578 Ga0501042_0112856 Ga0501042_0112856_1394_1867 152
280 3300049578 Ga0501042_0593559 Ga0501042_0593559_134_601 152
281 3300049583 Ga0501067_0006895 Ga0501067_0006895_338_805 152
282 3300049584 Ga0501068_0003491 Ga0501068_0003491_7815_8282 152
283 3300049584 Ga0501068_0326143 Ga0501068_0326143_347_820 152
284 3300049587 Ga0501071_0004758 Ga0501071_0004758_6994_7461 152
285 3300049588 Ga0501072_0517422 Ga0501072_0517422_393_860 152
286 3300049589 Ga0501073_0012636 Ga0501073_0012636_2796_3263 152
287 3300049590 Ga0501074_0016530 Ga0501074_0016530_3094_3561 152
288 3300049592 Ga0501076_0109987 Ga0501076_0109987_998_1465 152
289 3300049741 Ga0501079_0000501 Ga0501079_0000501_6043_6510 152
290 3300049742 Ga0501080_0001374 Ga0501080_0001374_7322_7789 152
291 3300049744 Ga0501083_0030071 Ga0501083_0030071_2505_2972 152
292 3300049822 Ga0501035_0097372 Ga0501035_0097372_1218_1679 152
293 3300049822 Ga0501035_0728320 Ga0501035_0728320_306_773 152
294 3300049823 Ga0501044_0298211 Ga0501044_0298211_1027_1488 152
295 3300050493 nmdc:mga0k408_126741_c1 nmdc:mga0k408_126741_c1_860_1318 152
296 3300050496 nmdc:mga07m45_1213_c1 nmdc:mga07m45_1213_c1_7130_7600 152
297 3300050511 nmdc:mga08y16_30591_c1 nmdc:mga08y16_30591_c1_2233_2703 152
298 3300050511 nmdc:mga08y16_584340_c1 nmdc:mga08y16_584340_c1_371_850 152
299 3300053087 Ga0500643_000450 Ga0500643_000450_2972_3433 152
300 3300053120 Ga0500597_000432 Ga0500597_000432_703_1164 152
301 3300053125 Ga0500618_132838 Ga0500618_132838_87_548 152
302 3300053136 Ga0500559_0021509 Ga0500559_0021509_160_621 152
303 3300053136 Ga0500559_0022881 Ga0500559_0022881_1201_1662 152
304 3300053157 Ga0500624_016891 Ga0500624_016891_585_1046 152
305 3300054114 Ga0501084_0025257 Ga0501084_0025257_4381_4848 152
306 3300060353 Ga0501082_0027589 Ga0501082_0027589_1795_2262 152

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

42

166

0.84

PF13527

Acetyltransf_9

Acetyltransferase (GNAT) domain

30

156

0.83

PF13480

Acetyltransf_6

Acetyltransferase (GNAT) domain

11

161

0.81

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

78

172

0.8

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

30

171

0.78

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

50

173

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
1qsm-assembly1.cif.gz_D histone acetyltransferase hpa2 from saccharomyces cerevisiae in complex with acetyl coenzyme a 0.9544 2 150
7ypu-assembly4.cif.gz_G orfe-coa-glycylthricin complex 0.9403 55 139
7ypu-assembly4.cif.gz_H orfe-coa-glycylthricin complex 0.9361 54 139
8a9o-assembly1.cif.gz_A structure of the polyamine acetyltransferase dpa 0.9104 4 149
3fyn-assembly1.cif.gz_A-2 crystal structure from the mobile metagenome of cole harbour salt marsh: integron cassette protein hfx_cass3 0.9072 6 151
ID Description Score Start End Superfamily
af_Q06592_5_156_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9602 3 150 3.40.630.30
af_A0A1D8PP99_1_151_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9529 3 150 3.40.630.30
af_A0A1D8PP99_1_151_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9283 3 150 3.40.630.30
af_P16691_3_141_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8977 4 149 3.40.630.30
1y9wB01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8965 55 139 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A1S8FMT0-F1-model_v4 GNAT family N-acetyltransferase 1 4 152 GO:0016747
AF-A0A437MPY7-F1-model_v4 GNAT family N-acetyltransferase 0.999 4 152 GO:0016747
AF-A0A1H6QPB3-F1-model_v4 Ribosomal protein S18 acetylase RimI 0.9986 4 152 GO:0005840
GO:0016747
AF-A0A5S4YHB3-F1-model_v4 GNAT family N-acetyltransferase 0.9978 3 152 GO:0008080
AF-A0A3S0HDA6-F1-model_v4 deleted 0.9977 3 116

Feature Viewer

pLDDT pTM Quality
94.01 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map