F398762
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 306 | 211 | 301 | 155 |
Family's Representative Sequence
| Representative Sequence | 3300036401|Ga0373937_0142724|Ga0373937_0142724_398_931 |
| Length | 177 |
| Sequence | MREQARAGAGAGYREKVRNNEMKKKRAPPTIRAVRPDDYDGWKPLWDEYNAFYERTGPTALPDEVTQTTWRRFFDSGEPVHCIVAERDGKLVGICHYIFHRSTTRIEPVCYLNDLLTAPDERGQGVGRALILAVYELAKEHGCKRVYWMTHTTNTPGRTLYDKVAKHIGFIQYMKDV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 2 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 3 | 2772190666 | Serratia surfactantfaciens YD25 | Isolate | Unclassified |
| 4 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 5 | 2937967321 | Serratia sp. YC16 | Isolate | Unclassified |
| 6 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 7 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 8 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 71 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 92 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 93 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 95 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 136 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 137 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 138 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 139 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 140 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 141 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 142 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 143 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 144 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 145 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 146 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 147 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 148 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 149 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 150 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 151 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 152 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 153 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 154 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 155 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 156 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 157 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 158 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 159 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 160 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 161 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 162 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 163 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 174 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 175 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 176 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 177 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 178 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 179 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 180 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 181 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 182 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 183 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 184 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 192 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 196 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 201 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 202 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 203 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 204 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 205 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 206 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 207 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 208 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 209 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.37 |
| Metatranscriptomes | 0 |
| Isolates | 1.63 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.9 |
| Nodule | 0.33 |
| Rhizoplane | 3.27 |
| Rhizosphere | 82.35 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25156J39149_1000042 | 3300002705 | Bacteria | 105742 |
| 2 | JGI25154J39366_1001068 | 3300002738 | Bacteria | 10824 |
| 3 | JGI25157J39369_1000033 | 3300002741 | Bacteria | 139508 |
| 4 | rootH2_10006889 | 3300003320 | Bacteria | 6585 |
| 5 | rootL2_10004273 | 3300003322 | Bacteria | 5907 |
| 6 | rootL2_10063517 | 3300003322 | Bacteria | 1363 |
| 7 | rootH1_10072313 | 3300003323 | Bacteria | 2704 |
| 8 | rootH1_10077766 | 3300003323 | Bacteria | 2283 |
| 9 | Ga0055539_1000318 | 3300003752 | Bacteria | 24954 |
| 10 | Ga0070658_10027144 | 3300005327 | Bacteria | 4597 |
| 11 | Ga0070676_10086002 | 3300005328 | Bacteria | 1917 |
| 12 | Ga0070683_101422372 | 3300005329 | Unclassified | 666 |
| 13 | Ga0070690_100049189 | 3300005330 | Bacteria | 2686 |
| 14 | Ga0070670_100599048 | 3300005331 | Unclassified | 986 |
| 15 | Ga0070677_10238328 | 3300005333 | Unclassified | 897 |
| 16 | Ga0068869_100216567 | 3300005334 | Bacteria | 1516 |
| 17 | Ga0068869_100290565 | 3300005334 | Bacteria | 1317 |
| 18 | Ga0070682_100734905 | 3300005337 | Unclassified | 795 |
| 19 | Ga0070682_101251470 | 3300005337 | Bacteria | 628 |
| 20 | Ga0068868_100292687 | 3300005338 | Bacteria | 1381 |
| 21 | Ga0070660_101379071 | 3300005339 | Bacteria | 599 |
| 22 | Ga0070689_100002161 | 3300005340 | Bacteria | 12747 |
| 23 | Ga0070691_10513003 | 3300005341 | Bacteria | 695 |
| 24 | Ga0070687_100603912 | 3300005343 | Unclassified | 754 |
| 25 | Ga0070661_100172286 | 3300005344 | Bacteria | 1644 |
| 26 | Ga0070675_100049485 | 3300005354 | Bacteria | 3450 |
| 27 | Ga0070675_100305649 | 3300005354 | Bacteria | 1402 |
| 28 | Ga0070671_100140985 | 3300005355 | Bacteria | 2034 |
| 29 | Ga0070674_100978303 | 3300005356 | Bacteria | 741 |
| 30 | Ga0070673_100092369 | 3300005364 | Bacteria | 2475 |
| 31 | Ga0070688_100560171 | 3300005365 | Bacteria | 870 |
| 32 | Ga0070667_100000235 | 3300005367 | Bacteria | 63272 |
| 33 | Ga0070709_10368863 | 3300005434 | Bacteria | 1065 |
| 34 | Ga0070714_100003545 | 3300005435 | Bacteria | 11669 |
| 35 | Ga0070701_10003576 | 3300005438 | Bacteria | 6170 |
| 36 | Ga0070701_10087864 | 3300005438 | Bacteria | 1697 |
| 37 | Ga0070705_100216837 | 3300005440 | Bacteria | 1323 |
| 38 | Ga0070700_100004456 | 3300005441 | Bacteria | 7315 |
| 39 | Ga0070700_100006396 | 3300005441 | Bacteria | 6296 |
| 40 | Ga0070694_100009791 | 3300005444 | Bacteria | 5887 |
| 41 | Ga0070663_100000583 | 3300005455 | Bacteria | 19478 |
| 42 | Ga0070663_101281498 | 3300005455 | Unclassified | 646 |
| 43 | Ga0068867_100117332 | 3300005459 | Unclassified | 2052 |
| 44 | Ga0068867_100216774 | 3300005459 | Bacteria | 1540 |
| 45 | Ga0068867_101152881 | 3300005459 | Bacteria | 710 |
| 46 | Ga0070685_10068076 | 3300005466 | Bacteria | 2102 |
| 47 | Ga0070685_10152130 | 3300005466 | Bacteria | 1467 |
| 48 | Ga0070685_11048222 | 3300005466 | Bacteria | 614 |
| 49 | Ga0070706_100466972 | 3300005467 | Bacteria | 1174 |
| 50 | Ga0070707_100132767 | 3300005468 | Bacteria | 2422 |
| 51 | Ga0070698_101304156 | 3300005471 | Unclassified | 676 |
| 52 | Ga0068853_100019259 | 3300005539 | Bacteria | 5657 |
| 53 | Ga0068853_100117822 | 3300005539 | Bacteria | 2366 |
| 54 | Ga0068853_100602853 | 3300005539 | Bacteria | 1043 |
| 55 | Ga0070672_100005369 | 3300005543 | Bacteria | 8491 |
| 56 | Ga0070672_100503361 | 3300005543 | Bacteria | 1048 |
| 57 | Ga0070686_100026779 | 3300005544 | Bacteria | 3483 |
| 58 | Ga0070686_100065326 | 3300005544 | Bacteria | 2363 |
| 59 | Ga0070695_100364943 | 3300005545 | Bacteria | 1085 |
| 60 | Ga0070696_100647974 | 3300005546 | Bacteria | 856 |
| 61 | Ga0070693_100274673 | 3300005547 | Unclassified | 1126 |
| 62 | Ga0070665_100031629 | 3300005548 | Bacteria | 5327 |
| 63 | Ga0070665_100539704 | 3300005548 | Bacteria | 1178 |
| 64 | Ga0070704_101005429 | 3300005549 | Bacteria | 754 |
| 65 | Ga0068855_100142598 | 3300005563 | Bacteria | 2729 |
| 66 | Ga0068857_100020149 | 3300005577 | Bacteria | 5862 |
| 67 | Ga0068857_100195205 | 3300005577 | Bacteria | 1844 |
| 68 | Ga0068854_100002235 | 3300005578 | Bacteria | 11915 |
| 69 | Ga0068854_101687905 | 3300005578 | Unclassified | 579 |
| 70 | Ga0068856_100001296 | 3300005614 | Bacteria | 26308 |
| 71 | Ga0070702_100310588 | 3300005615 | Bacteria | 1094 |
| 72 | Ga0068852_100463284 | 3300005616 | Bacteria | 1257 |
| 73 | Ga0068852_101191264 | 3300005616 | Bacteria | 783 |
| 74 | Ga0068859_100021265 | 3300005617 | Bacteria | 6511 |
| 75 | Ga0068859_100348297 | 3300005617 | Bacteria | 1576 |
| 76 | Ga0068859_100393712 | 3300005617 | Bacteria | 1481 |
| 77 | Ga0068859_101593084 | 3300005617 | Unclassified | 721 |
| 78 | Ga0068864_100209780 | 3300005618 | Bacteria | 1793 |
| 79 | Ga0068866_10299970 | 3300005718 | Unclassified | 1003 |
| 80 | Ga0068861_100001424 | 3300005719 | Bacteria | 15075 |
| 81 | Ga0068861_100014072 | 3300005719 | Bacteria | 5611 |
| 82 | Ga0068861_100046408 | 3300005719 | Bacteria | 3275 |
| 83 | Ga0068851_10373241 | 3300005834 | Bacteria | 834 |
| 84 | Ga0068863_100017581 | 3300005841 | Bacteria | 6851 |
| 85 | Ga0068863_100019457 | 3300005841 | Bacteria | 6495 |
| 86 | Ga0068858_100257174 | 3300005842 | Bacteria | 1659 |
| 87 | Ga0068858_100871650 | 3300005842 | Bacteria | 880 |
| 88 | Ga0068860_100063996 | 3300005843 | Bacteria | 3493 |
| 89 | Ga0068862_100062094 | 3300005844 | Unclassified | 3213 |
| 90 | Ga0068862_100210919 | 3300005844 | Bacteria | 1755 |
| 91 | Ga0068862_100810127 | 3300005844 | Bacteria | 915 |
| 92 | Ga0068862_100948648 | 3300005844 | Unclassified | 848 |
| 93 | Ga0075366_10573724 | 3300006195 | Bacteria | 699 |
| 94 | Ga0097621_100008658 | 3300006237 | Bacteria | 7343 |
| 95 | Ga0075370_10018325 | 3300006353 | Bacteria | 3799 |
| 96 | Ga0068871_100827935 | 3300006358 | Bacteria | 854 |
| 97 | Ga0068865_100138150 | 3300006881 | Bacteria | 1834 |
| 98 | Ga0068865_100164769 | 3300006881 | Unclassified | 1694 |
| 99 | Ga0097620_100021265 | 3300006931 | Bacteria | 6511 |
| 100 | Ga0097620_100348309 | 3300006931 | Bacteria | 1576 |
| 101 | Ga0097620_100393707 | 3300006931 | Bacteria | 1481 |
| 102 | Ga0097620_101593324 | 3300006931 | Unclassified | 721 |
| 103 | Ga0105240_10125177 | 3300009093 | Bacteria | 3090 |
| 104 | Ga0105240_10470185 | 3300009093 | Bacteria | 1403 |
| 105 | Ga0105240_10484377 | 3300009093 | Bacteria | 1378 |
| 106 | Ga0105240_10484698 | 3300009093 | Bacteria | 1378 |
| 107 | Ga0111539_10022311 | 3300009094 | Bacteria | 7779 |
| 108 | Ga0111539_10334997 | 3300009094 | Bacteria | 1761 |
| 109 | Ga0105243_12158921 | 3300009148 | Unclassified | 593 |
| 110 | Ga0105237_10002091 | 3300009545 | Bacteria | 25231 |
| 111 | Ga0105237_10064442 | 3300009545 | Bacteria | 3661 |
| 112 | Ga0105238_10031452 | 3300009551 | Bacteria | 5403 |
| 113 | Ga0105238_10084830 | 3300009551 | Bacteria | 3157 |
| 114 | Ga0105249_10000271 | 3300009553 | Bacteria | 54577 |
| 115 | Ga0105239_10148746 | 3300010375 | Bacteria | 2613 |
| 116 | Ga0105239_10449921 | 3300010375 | Bacteria | 1461 |
| 117 | Ga0157369_10018565 | 3300013105 | Bacteria | 7795 |
| 118 | Ga0157378_11340246 | 3300013297 | Unclassified | 757 |
| 119 | Ga0157372_10073773 | 3300013307 | Bacteria | 3847 |
| 120 | Ga0157372_10362454 | 3300013307 | Bacteria | 1689 |
| 121 | Ga0163163_10015801 | 3300014325 | Bacteria | 6992 |
| 122 | Ga0157380_10004304 | 3300014326 | Bacteria | 9870 |
| 123 | Ga0157380_10956235 | 3300014326 | Bacteria | 887 |
| 124 | Ga0157380_11844823 | 3300014326 | Unclassified | 664 |
| 125 | Ga0157377_10190085 | 3300014745 | Bacteria | 1297 |
| 126 | Ga0157376_10625479 | 3300014969 | Bacteria | 1074 |
| 127 | Ga0163161_10249508 | 3300017792 | Unclassified | 1383 |
| 128 | Ga0209674_115121 | 3300025226 | Bacteria | 672 |
| 129 | Ga0209258_100956 | 3300025242 | Bacteria | 13831 |
| 130 | Ga0209646_1000089 | 3300025246 | Bacteria | 189974 |
| 131 | Ga0209026_1000028 | 3300025250 | Bacteria | 341399 |
| 132 | Ga0209677_100066 | 3300025253 | Bacteria | 149370 |
| 133 | Ga0209759_1000021 | 3300025256 | Bacteria | 341399 |
| 134 | Ga0209759_1003028 | 3300025256 | Bacteria | 6932 |
| 135 | Ga0207682_10078784 | 3300025893 | Bacteria | 1408 |
| 136 | Ga0207699_10158384 | 3300025906 | Bacteria | 1505 |
| 137 | Ga0207645_10068801 | 3300025907 | Bacteria | 2264 |
| 138 | Ga0207645_10270772 | 3300025907 | Bacteria | 1126 |
| 139 | Ga0207705_10150383 | 3300025909 | Bacteria | 1744 |
| 140 | Ga0207695_10002511 | 3300025913 | Bacteria | 26961 |
| 141 | Ga0207695_10102063 | 3300025913 | Bacteria | 2862 |
| 142 | Ga0207695_10170504 | 3300025913 | Bacteria | 2102 |
| 143 | Ga0207671_10008618 | 3300025914 | Bacteria | 8617 |
| 144 | Ga0207671_10712820 | 3300025914 | Bacteria | 798 |
| 145 | Ga0207649_10672156 | 3300025920 | Bacteria | 802 |
| 146 | Ga0207649_11069180 | 3300025920 | Bacteria | 636 |
| 147 | Ga0207646_10193510 | 3300025922 | Bacteria | 1837 |
| 148 | Ga0207681_10016723 | 3300025923 | Bacteria | 4596 |
| 149 | Ga0207694_10078534 | 3300025924 | Bacteria | 2587 |
| 150 | Ga0207650_10534499 | 3300025925 | Unclassified | 982 |
| 151 | Ga0207659_10052184 | 3300025926 | Bacteria | 2912 |
| 152 | Ga0207687_10109965 | 3300025927 | Bacteria | 2043 |
| 153 | Ga0207664_10080666 | 3300025929 | Bacteria | 2645 |
| 154 | Ga0207644_10395970 | 3300025931 | Unclassified | 1128 |
| 155 | Ga0207644_10520235 | 3300025931 | Bacteria | 983 |
| 156 | Ga0207644_10823842 | 3300025931 | Bacteria | 777 |
| 157 | Ga0207706_10345682 | 3300025933 | Bacteria | 1293 |
| 158 | Ga0207706_10839646 | 3300025933 | Bacteria | 778 |
| 159 | Ga0207670_10003832 | 3300025936 | Bacteria | 8007 |
| 160 | Ga0207704_10191380 | 3300025938 | Unclassified | 1489 |
| 161 | Ga0207691_10438761 | 3300025940 | Bacteria | 1112 |
| 162 | Ga0207689_10308099 | 3300025942 | Bacteria | 1313 |
| 163 | Ga0207689_10611467 | 3300025942 | Bacteria | 917 |
| 164 | Ga0207689_10853239 | 3300025942 | Unclassified | 768 |
| 165 | Ga0207679_10286454 | 3300025945 | Bacteria | 1415 |
| 166 | Ga0207679_10934108 | 3300025945 | Unclassified | 794 |
| 167 | Ga0207667_10163269 | 3300025949 | Bacteria | 2290 |
| 168 | Ga0207651_10505637 | 3300025960 | Unclassified | 1045 |
| 169 | Ga0207712_10000301 | 3300025961 | Bacteria | 46175 |
| 170 | Ga0207712_11868689 | 3300025961 | Bacteria | 538 |
| 171 | Ga0207668_10195696 | 3300025972 | Bacteria | 1606 |
| 172 | Ga0207640_10050219 | 3300025981 | Bacteria | 2704 |
| 173 | Ga0207640_11474791 | 3300025981 | Unclassified | 611 |
| 174 | Ga0207658_10000056 | 3300025986 | Bacteria | 124846 |
| 175 | Ga0207703_10382125 | 3300026035 | Bacteria | 1303 |
| 176 | Ga0207639_10016763 | 3300026041 | Bacteria | 5189 |
| 177 | Ga0207639_10387218 | 3300026041 | Bacteria | 1257 |
| 178 | Ga0207678_10000389 | 3300026067 | Bacteria | 39987 |
| 179 | Ga0207678_11231624 | 3300026067 | Unclassified | 662 |
| 180 | Ga0207708_10013255 | 3300026075 | Bacteria | 6155 |
| 181 | Ga0207708_10037540 | 3300026075 | Bacteria | 3690 |
| 182 | Ga0207702_10000200 | 3300026078 | Bacteria | 70607 |
| 183 | Ga0207641_10147220 | 3300026088 | Bacteria | 2130 |
| 184 | Ga0207648_10342525 | 3300026089 | Bacteria | 1346 |
| 185 | Ga0207648_11444432 | 3300026089 | Bacteria | 647 |
| 186 | Ga0207676_10390738 | 3300026095 | Bacteria | 1297 |
| 187 | Ga0207674_10002598 | 3300026116 | Bacteria | 22710 |
| 188 | Ga0207674_10084136 | 3300026116 | Bacteria | 3180 |
| 189 | Ga0207674_10475398 | 3300026116 | Bacteria | 1208 |
| 190 | Ga0207675_100001730 | 3300026118 | Bacteria | 21862 |
| 191 | Ga0207675_100003384 | 3300026118 | Bacteria | 15582 |
| 192 | Ga0207675_100049787 | 3300026118 | Bacteria | 3909 |
| 193 | Ga0207675_100074216 | 3300026118 | Bacteria | 3183 |
| 194 | Ga0207675_100363101 | 3300026118 | Bacteria | 1421 |
| 195 | Ga0207698_10081377 | 3300026142 | Bacteria | 2614 |
| 196 | Ga0207698_10280980 | 3300026142 | Bacteria | 1540 |
| 197 | Ga0268265_10009358 | 3300028380 | Bacteria | 6622 |
| 198 | Ga0268265_10043460 | 3300028380 | Unclassified | 3341 |
| 199 | Ga0268265_10080128 | 3300028380 | Bacteria | 2574 |
| 200 | Ga0268264_10715753 | 3300028381 | Bacteria | 995 |
| 201 | Ga0307513_10022541 | 3300031456 | Bacteria | 7396 |
| 202 | Ga0307516_10000107 | 3300031730 | Bacteria | 95288 |
| 203 | Ga0307405_10143790 | 3300031731 | Bacteria | 1667 |
| 204 | Ga0307405_11331853 | 3300031731 | Unclassified | 626 |
| 205 | Ga0307413_10092553 | 3300031824 | Unclassified | 1973 |
| 206 | Ga0307413_10156378 | 3300031824 | Unclassified | 1595 |
| 207 | Ga0307410_10135187 | 3300031852 | Bacteria | 1816 |
| 208 | Ga0307410_10855697 | 3300031852 | Unclassified | 776 |
| 209 | Ga0307406_10009808 | 3300031901 | Bacteria | 5389 |
| 210 | Ga0307406_10226720 | 3300031901 | Unclassified | 1393 |
| 211 | Ga0307406_10639611 | 3300031901 | Unclassified | 882 |
| 212 | Ga0307407_10008692 | 3300031903 | Bacteria | 4678 |
| 213 | Ga0307407_10047729 | 3300031903 | Unclassified | 2432 |
| 214 | Ga0307409_100001730 | 3300031995 | Bacteria | 11010 |
| 215 | Ga0307409_100012747 | 3300031995 | Bacteria | 5371 |
| 216 | Ga0307409_100276892 | 3300031995 | Unclassified | 1548 |
| 217 | Ga0307416_100069791 | 3300032002 | Bacteria | 2910 |
| 218 | Ga0307416_100556724 | 3300032002 | Bacteria | 1221 |
| 219 | Ga0307414_10406311 | 3300032004 | Unclassified | 1184 |
| 220 | Ga0307411_10015823 | 3300032005 | Bacteria | 4250 |
| 221 | Ga0307411_10429468 | 3300032005 | Bacteria | 1100 |
| 222 | Ga0307415_100081904 | 3300032126 | Bacteria | 2307 |
| 223 | Ga0307415_100172096 | 3300032126 | Unclassified | 1690 |
| 224 | Ga0307415_100474600 | 3300032126 | Unclassified | 1087 |
| 225 | Ga0307415_100816184 | 3300032126 | Bacteria | 853 |
| 226 | Ga0373934_0077180 | 3300035086 | Bacteria | 1336 |
| 227 | Ga0373957_0313209 | 3300035120 | Unclassified | 667 |
| 228 | Ga0373937_0142724 | 3300036401 | Bacteria | 2241 |
| 229 | Ga0395898_0024484 | 3300037466 | Bacteria | 6089 |
| 230 | Ga0395905_0241794 | 3300037471 | Bacteria | 1687 |
| 231 | Ga0395905_0509670 | 3300037471 | Bacteria | 1103 |
| 232 | Ga0436364_0832650 | 3300037853 | Bacteria | 1573 |
| 233 | Ga0395901_0002128 | 3300038443 | Bacteria | 20288 |
| 234 | Ga0451789_1232859 | 3300041443 | Bacteria | 588 |
| 235 | Ga0451791_1624986 | 3300041451 | Bacteria | 2931 |
| 236 | Ga0451802_0724312 | 3300041460 | Bacteria | 1759 |
| 237 | Ga0451807_0207673 | 3300041486 | Unclassified | 1303 |
| 238 | Ga0451807_2339569 | 3300041486 | Bacteria | 1259 |
| 239 | Ga0451833_1067120 | 3300041491 | Bacteria | 1406 |
| 240 | Ga0451837_1475514 | 3300041494 | Bacteria | 1462 |
| 241 | Ga0451849_0175001 | 3300041505 | Bacteria | 755 |
| 242 | Ga0451577_0197345 | 3300042876 | Bacteria | 1816 |
| 243 | Ga0466967_0752368 | 3300045976 | Bacteria | 967 |
| 244 | Ga0495590_0029645 | 3300046457 | Unclassified | 1917 |
| 245 | Ga0495638_0082565 | 3300046460 | Unclassified | 1949 |
| 246 | Ga0495650_0007657 | 3300046471 | Bacteria | 6442 |
| 247 | Ga0495639_0059824 | 3300046475 | Bacteria | 1744 |
| 248 | Ga0495652_0774737 | 3300046529 | Bacteria | 640 |
| 249 | Ga0495668_0325306 | 3300046616 | Unclassified | 843 |
| 250 | Ga0495625_0006350 | 3300046660 | Bacteria | 10559 |
| 251 | Ga0495625_0279606 | 3300046660 | Bacteria | 1074 |
| 252 | Ga0495671_0195027 | 3300046692 | Bacteria | 983 |
| 253 | Ga0495589_0514176 | 3300046794 | Unclassified | 546 |
| 254 | Ga0495686_0004347 | 3300047472 | Bacteria | 11705 |
| 255 | Ga0496104_0219006 | 3300048907 | Bacteria | 1816 |
| 256 | Ga0496105_0319395 | 3300048908 | Bacteria | 1245 |
| 257 | Ga0496108_0510300 | 3300048911 | Bacteria | 1050 |
| 258 | Ga0496114_0827729 | 3300048917 | Bacteria | 805 |
| 259 | Ga0496115_0913800 | 3300048918 | Bacteria | 676 |
| 260 | Ga0496119_0000909 | 3300048922 | Bacteria | 38357 |
| 261 | Ga0496120_0000159 | 3300048923 | Bacteria | 112577 |
| 262 | Ga0496120_0000233 | 3300048923 | Bacteria | 95589 |
| 263 | Ga0496121_0055497 | 3300048924 | Bacteria | 3300 |
| 264 | Ga0496122_0005693 | 3300048925 | Bacteria | 14708 |
| 265 | Ga0496123_0004026 | 3300048926 | Bacteria | 15858 |
| 266 | Ga0496124_0000008 | 3300048927 | Bacteria | 864372 |
| 267 | Ga0501033_0009951 | 3300049570 | Bacteria | 7300 |
| 268 | Ga0501036_0859187 | 3300049572 | Unclassified | 746 |
| 269 | Ga0501037_0126589 | 3300049573 | Bacteria | 1834 |
| 270 | Ga0501042_0112856 | 3300049578 | Bacteria | 1957 |
| 271 | Ga0501042_0574117 | 3300049578 | Unclassified | 820 |
| 272 | Ga0501042_0593559 | 3300049578 | Bacteria | 805 |
| 273 | Ga0501067_0006895 | 3300049583 | Bacteria | 6303 |
| 274 | Ga0501068_0003491 | 3300049584 | Bacteria | 8476 |
| 275 | Ga0501068_0326143 | 3300049584 | Bacteria | 985 |
| 276 | Ga0501071_0004758 | 3300049587 | Bacteria | 8643 |
| 277 | Ga0501072_0517422 | 3300049588 | Bacteria | 943 |
| 278 | Ga0501073_0012636 | 3300049589 | Bacteria | 6159 |
| 279 | Ga0501074_0016530 | 3300049590 | Bacteria | 5356 |
| 280 | Ga0501076_0109987 | 3300049592 | Unclassified | 2227 |
| 281 | Ga0501079_0000501 | 3300049741 | Bacteria | 25528 |
| 282 | Ga0501080_0001374 | 3300049742 | Bacteria | 20358 |
| 283 | Ga0501080_0706544 | 3300049742 | Unclassified | 889 |
| 284 | Ga0501083_0030071 | 3300049744 | Bacteria | 3732 |
| 285 | Ga0501035_0097372 | 3300049822 | Bacteria | 2584 |
| 286 | Ga0501035_0728320 | 3300049822 | Unclassified | 798 |
| 287 | Ga0501044_0298211 | 3300049823 | Bacteria | 1541 |
| 288 | nmdc:mga0k408_126741_c1 | 3300050493 | Bacteria | 1514 |
| 289 | nmdc:mga07m45_1213_c1 | 3300050496 | Bacteria | 11680 |
| 290 | nmdc:mga08y16_30591_c1 | 3300050511 | Bacteria | 5665 |
| 291 | nmdc:mga08y16_584340_c1 | 3300050511 | Unclassified | 1127 |
| 292 | Ga0500643_000450 | 3300053087 | Bacteria | 30395 |
| 293 | Ga0500641_0001571 | 3300053096 | Bacteria | 8138 |
| 294 | Ga0500597_000432 | 3300053120 | Bacteria | 8806 |
| 295 | Ga0500618_132838 | 3300053125 | Bacteria | 565 |
| 296 | Ga0500559_0021509 | 3300053136 | Bacteria | 2734 |
| 297 | Ga0500559_0022881 | 3300053136 | Bacteria | 2651 |
| 298 | Ga0500624_016891 | 3300053157 | Bacteria | 1132 |
| 299 | Ga0501084_0025257 | 3300054114 | Bacteria | 4955 |
| 300 | Ga0501082_0027589 | 3300060353 | Bacteria | 4888 |
| 301 | Ga0530510_0820180 | 3300061734 | Unclassified | 710 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041443 | Ga0451789_1232859 | Ga0451789_1232859_125_562 | 144 |
| 2 | 3300046692 | Ga0495671_0195027 | Ga0495671_0195027_12_446 | 144 |
| 3 | 3300046794 | Ga0495589_0514176 | Ga0495589_0514176_22_456 | 144 |
| 4 | iso_pu_bacteria | 2894023352 | 2894024687 | 147 |
| 5 | 3300025961 | Ga0207712_11868689 | Ga0207712_118686891 | 148 |
| 6 | 3300049572 | Ga0501036_0859187 | Ga0501036_0859187_208_666 | 148 |
| 7 | 3300049578 | Ga0501042_0574117 | Ga0501042_0574117_94_552 | 148 |
| 8 | 3300049742 | Ga0501080_0706544 | Ga0501080_0706544_349_807 | 148 |
| 9 | 3300061734 | Ga0530510_0820180 | Ga0530510_0820180_22_534 | 148 |
| 10 | 3300005355 | Ga0070671_100140985 | Ga0070671_1001409853 | 149 |
| 11 | 3300025931 | Ga0207644_10395970 | Ga0207644_103959701 | 149 |
| 12 | 3300053096 | Ga0500641_0001571 | Ga0500641_0001571_96_545 | 149 |
| 13 | iso_pu_bacteria | 2721755763 | 2723877982 | 149 |
| 14 | iso_pu_bacteria | 2772190666 | 2772439080 | 149 |
| 15 | iso_pu_bacteria | 2937967321 | 2937967697 | 149 |
| 16 | iso_pu_bacteria | 2687453130 | 2687582629 | 150 |
| 17 | 3300005434 | Ga0070709_10368863 | Ga0070709_103688631 | 151 |
| 18 | 3300005435 | Ga0070714_100003545 | Ga0070714_10000354512 | 151 |
| 19 | 3300005455 | Ga0070663_101281498 | Ga0070663_1012814981 | 151 |
| 20 | 3300005578 | Ga0068854_101687905 | Ga0068854_1016879051 | 151 |
| 21 | 3300025929 | Ga0207664_10080666 | Ga0207664_100806665 | 151 |
| 22 | 3300025931 | Ga0207644_10520235 | Ga0207644_105202352 | 151 |
| 23 | 3300025981 | Ga0207640_11474791 | Ga0207640_114747911 | 151 |
| 24 | 3300026067 | Ga0207678_11231624 | Ga0207678_112316242 | 151 |
| 25 | 3300048907 | Ga0496104_0219006 | Ga0496104_0219006_1002_1469 | 151 |
| 26 | 3300002705 | JGI25156J39149_1000042 | JGI25156J39149_100004217 | 152 |
| 27 | 3300002738 | JGI25154J39366_1001068 | JGI25154J39366_10010688 | 152 |
| 28 | 3300002741 | JGI25157J39369_1000033 | JGI25157J39369_100003312 | 152 |
| 29 | 3300003320 | rootH2_10006889 | rootH2_100068895 | 152 |
| 30 | 3300003322 | rootL2_10004273 | rootL2_100042736 | 152 |
| 31 | 3300003322 | rootL2_10063517 | rootL2_100635172 | 152 |
| 32 | 3300003323 | rootH1_10072313 | rootH1_100723132 | 152 |
| 33 | 3300003323 | rootH1_10077766 | rootH1_100777662 | 152 |
| 34 | 3300003752 | Ga0055539_1000318 | Ga0055539_10003183 | 152 |
| 35 | 3300005327 | Ga0070658_10027144 | Ga0070658_100271444 | 152 |
| 36 | 3300005328 | Ga0070676_10086002 | Ga0070676_100860021 | 152 |
| 37 | 3300005329 | Ga0070683_101422372 | Ga0070683_1014223721 | 152 |
| 38 | 3300005330 | Ga0070690_100049189 | Ga0070690_1000491894 | 152 |
| 39 | 3300005331 | Ga0070670_100599048 | Ga0070670_1005990482 | 152 |
| 40 | 3300005333 | Ga0070677_10238328 | Ga0070677_102383282 | 152 |
| 41 | 3300005334 | Ga0068869_100216567 | Ga0068869_1002165672 | 152 |
| 42 | 3300005334 | Ga0068869_100290565 | Ga0068869_1002905653 | 152 |
| 43 | 3300005337 | Ga0070682_100734905 | Ga0070682_1007349051 | 152 |
| 44 | 3300005337 | Ga0070682_101251470 | Ga0070682_1012514701 | 152 |
| 45 | 3300005338 | Ga0068868_100292687 | Ga0068868_1002926872 | 152 |
| 46 | 3300005339 | Ga0070660_101379071 | Ga0070660_1013790711 | 152 |
| 47 | 3300005340 | Ga0070689_100002161 | Ga0070689_10000216111 | 152 |
| 48 | 3300005341 | Ga0070691_10513003 | Ga0070691_105130031 | 152 |
| 49 | 3300005343 | Ga0070687_100603912 | Ga0070687_1006039121 | 152 |
| 50 | 3300005344 | Ga0070661_100172286 | Ga0070661_1001722863 | 152 |
| 51 | 3300005354 | Ga0070675_100049485 | Ga0070675_1000494854 | 152 |
| 52 | 3300005354 | Ga0070675_100305649 | Ga0070675_1003056492 | 152 |
| 53 | 3300005356 | Ga0070674_100978303 | Ga0070674_1009783031 | 152 |
| 54 | 3300005364 | Ga0070673_100092369 | Ga0070673_1000923693 | 152 |
| 55 | 3300005365 | Ga0070688_100560171 | Ga0070688_1005601711 | 152 |
| 56 | 3300005367 | Ga0070667_100000235 | Ga0070667_10000023520 | 152 |
| 57 | 3300005438 | Ga0070701_10003576 | Ga0070701_100035763 | 152 |
| 58 | 3300005438 | Ga0070701_10087864 | Ga0070701_100878641 | 152 |
| 59 | 3300005440 | Ga0070705_100216837 | Ga0070705_1002168371 | 152 |
| 60 | 3300005441 | Ga0070700_100004456 | Ga0070700_1000044567 | 152 |
| 61 | 3300005441 | Ga0070700_100006396 | Ga0070700_1000063964 | 152 |
| 62 | 3300005444 | Ga0070694_100009791 | Ga0070694_1000097914 | 152 |
| 63 | 3300005455 | Ga0070663_100000583 | Ga0070663_10000058315 | 152 |
| 64 | 3300005459 | Ga0068867_100117332 | Ga0068867_1001173323 | 152 |
| 65 | 3300005459 | Ga0068867_100216774 | Ga0068867_1002167742 | 152 |
| 66 | 3300005459 | Ga0068867_101152881 | Ga0068867_1011528811 | 152 |
| 67 | 3300005466 | Ga0070685_10068076 | Ga0070685_100680761 | 152 |
| 68 | 3300005466 | Ga0070685_10152130 | Ga0070685_101521302 | 152 |
| 69 | 3300005466 | Ga0070685_11048222 | Ga0070685_110482221 | 152 |
| 70 | 3300005467 | Ga0070706_100466972 | Ga0070706_1004669722 | 152 |
| 71 | 3300005468 | Ga0070707_100132767 | Ga0070707_1001327672 | 152 |
| 72 | 3300005471 | Ga0070698_101304156 | Ga0070698_1013041561 | 152 |
| 73 | 3300005539 | Ga0068853_100019259 | Ga0068853_10001925910 | 152 |
| 74 | 3300005539 | Ga0068853_100117822 | Ga0068853_1001178223 | 152 |
| 75 | 3300005539 | Ga0068853_100602853 | Ga0068853_1006028531 | 152 |
| 76 | 3300005543 | Ga0070672_100005369 | Ga0070672_1000053694 | 152 |
| 77 | 3300005543 | Ga0070672_100503361 | Ga0070672_1005033612 | 152 |
| 78 | 3300005544 | Ga0070686_100026779 | Ga0070686_1000267793 | 152 |
| 79 | 3300005544 | Ga0070686_100065326 | Ga0070686_1000653264 | 152 |
| 80 | 3300005545 | Ga0070695_100364943 | Ga0070695_1003649432 | 152 |
| 81 | 3300005546 | Ga0070696_100647974 | Ga0070696_1006479742 | 152 |
| 82 | 3300005547 | Ga0070693_100274673 | Ga0070693_1002746731 | 152 |
| 83 | 3300005548 | Ga0070665_100031629 | Ga0070665_1000316294 | 152 |
| 84 | 3300005548 | Ga0070665_100539704 | Ga0070665_1005397042 | 152 |
| 85 | 3300005549 | Ga0070704_101005429 | Ga0070704_1010054291 | 152 |
| 86 | 3300005563 | Ga0068855_100142598 | Ga0068855_1001425983 | 152 |
| 87 | 3300005577 | Ga0068857_100020149 | Ga0068857_1000201491 | 152 |
| 88 | 3300005577 | Ga0068857_100195205 | Ga0068857_1001952053 | 152 |
| 89 | 3300005578 | Ga0068854_100002235 | Ga0068854_1000022357 | 152 |
| 90 | 3300005614 | Ga0068856_100001296 | Ga0068856_10000129615 | 152 |
| 91 | 3300005615 | Ga0070702_100310588 | Ga0070702_1003105881 | 152 |
| 92 | 3300005616 | Ga0068852_100463284 | Ga0068852_1004632842 | 152 |
| 93 | 3300005616 | Ga0068852_101191264 | Ga0068852_1011912642 | 152 |
| 94 | 3300005617 | Ga0068859_100021265 | Ga0068859_1000212659 | 152 |
| 95 | 3300005617 | Ga0068859_100348297 | Ga0068859_1003482972 | 152 |
| 96 | 3300005617 | Ga0068859_100393712 | Ga0068859_1003937122 | 152 |
| 97 | 3300005617 | Ga0068859_101593084 | Ga0068859_1015930842 | 152 |
| 98 | 3300005618 | Ga0068864_100209780 | Ga0068864_1002097803 | 152 |
| 99 | 3300005718 | Ga0068866_10299970 | Ga0068866_102999701 | 152 |
| 100 | 3300005719 | Ga0068861_100001424 | Ga0068861_1000014246 | 152 |
| 101 | 3300005719 | Ga0068861_100014072 | Ga0068861_1000140727 | 152 |
| 102 | 3300005719 | Ga0068861_100046408 | Ga0068861_1000464084 | 152 |
| 103 | 3300005834 | Ga0068851_10373241 | Ga0068851_103732411 | 152 |
| 104 | 3300005841 | Ga0068863_100017581 | Ga0068863_1000175819 | 152 |
| 105 | 3300005841 | Ga0068863_100019457 | Ga0068863_1000194572 | 152 |
| 106 | 3300005842 | Ga0068858_100257174 | Ga0068858_1002571743 | 152 |
| 107 | 3300005842 | Ga0068858_100871650 | Ga0068858_1008716501 | 152 |
| 108 | 3300005843 | Ga0068860_100063996 | Ga0068860_1000639963 | 152 |
| 109 | 3300005844 | Ga0068862_100062094 | Ga0068862_1000620943 | 152 |
| 110 | 3300005844 | Ga0068862_100210919 | Ga0068862_1002109193 | 152 |
| 111 | 3300005844 | Ga0068862_100810127 | Ga0068862_1008101272 | 152 |
| 112 | 3300005844 | Ga0068862_100948648 | Ga0068862_1009486482 | 152 |
| 113 | 3300006195 | Ga0075366_10573724 | Ga0075366_105737242 | 152 |
| 114 | 3300006237 | Ga0097621_100008658 | Ga0097621_1000086585 | 152 |
| 115 | 3300006353 | Ga0075370_10018325 | Ga0075370_100183254 | 152 |
| 116 | 3300006358 | Ga0068871_100827935 | Ga0068871_1008279352 | 152 |
| 117 | 3300006881 | Ga0068865_100138150 | Ga0068865_1001381503 | 152 |
| 118 | 3300006881 | Ga0068865_100164769 | Ga0068865_1001647692 | 152 |
| 119 | 3300006931 | Ga0097620_100021265 | Ga0097620_1000212659 | 152 |
| 120 | 3300006931 | Ga0097620_100348309 | Ga0097620_1003483092 | 152 |
| 121 | 3300006931 | Ga0097620_100393707 | Ga0097620_1003937072 | 152 |
| 122 | 3300006931 | Ga0097620_101593324 | Ga0097620_1015933242 | 152 |
| 123 | 3300009093 | Ga0105240_10125177 | Ga0105240_101251773 | 152 |
| 124 | 3300009093 | Ga0105240_10470185 | Ga0105240_104701852 | 152 |
| 125 | 3300009093 | Ga0105240_10484377 | Ga0105240_104843773 | 152 |
| 126 | 3300009093 | Ga0105240_10484698 | Ga0105240_104846982 | 152 |
| 127 | 3300009094 | Ga0111539_10022311 | Ga0111539_100223117 | 152 |
| 128 | 3300009094 | Ga0111539_10334997 | Ga0111539_103349972 | 152 |
| 129 | 3300009148 | Ga0105243_12158921 | Ga0105243_121589211 | 152 |
| 130 | 3300009545 | Ga0105237_10002091 | Ga0105237_100020915 | 152 |
| 131 | 3300009545 | Ga0105237_10064442 | Ga0105237_100644422 | 152 |
| 132 | 3300009551 | Ga0105238_10031452 | Ga0105238_100314527 | 152 |
| 133 | 3300009551 | Ga0105238_10084830 | Ga0105238_100848302 | 152 |
| 134 | 3300009553 | Ga0105249_10000271 | Ga0105249_1000027133 | 152 |
| 135 | 3300010375 | Ga0105239_10148746 | Ga0105239_101487462 | 152 |
| 136 | 3300010375 | Ga0105239_10449921 | Ga0105239_104499212 | 152 |
| 137 | 3300013105 | Ga0157369_10018565 | Ga0157369_100185656 | 152 |
| 138 | 3300013297 | Ga0157378_11340246 | Ga0157378_113402462 | 152 |
| 139 | 3300013307 | Ga0157372_10073773 | Ga0157372_100737733 | 152 |
| 140 | 3300013307 | Ga0157372_10362454 | Ga0157372_103624543 | 152 |
| 141 | 3300014325 | Ga0163163_10015801 | Ga0163163_100158017 | 152 |
| 142 | 3300014326 | Ga0157380_10004304 | Ga0157380_1000430410 | 152 |
| 143 | 3300014326 | Ga0157380_10956235 | Ga0157380_109562351 | 152 |
| 144 | 3300014326 | Ga0157380_11844823 | Ga0157380_118448231 | 152 |
| 145 | 3300014745 | Ga0157377_10190085 | Ga0157377_101900852 | 152 |
| 146 | 3300014969 | Ga0157376_10625479 | Ga0157376_106254791 | 152 |
| 147 | 3300017792 | Ga0163161_10249508 | Ga0163161_102495082 | 152 |
| 148 | 3300025226 | Ga0209674_115121 | Ga0209674_1151211 | 152 |
| 149 | 3300025242 | Ga0209258_100956 | Ga0209258_1009569 | 152 |
| 150 | 3300025246 | Ga0209646_1000089 | Ga0209646_1000089103 | 152 |
| 151 | 3300025250 | Ga0209026_1000028 | Ga0209026_1000028182 | 152 |
| 152 | 3300025253 | Ga0209677_100066 | Ga0209677_10006699 | 152 |
| 153 | 3300025256 | Ga0209759_1000021 | Ga0209759_1000021103 | 152 |
| 154 | 3300025256 | Ga0209759_1003028 | Ga0209759_10030286 | 152 |
| 155 | 3300025893 | Ga0207682_10078784 | Ga0207682_100787842 | 152 |
| 156 | 3300025906 | Ga0207699_10158384 | Ga0207699_101583842 | 152 |
| 157 | 3300025907 | Ga0207645_10068801 | Ga0207645_100688012 | 152 |
| 158 | 3300025907 | Ga0207645_10270772 | Ga0207645_102707722 | 152 |
| 159 | 3300025909 | Ga0207705_10150383 | Ga0207705_101503832 | 152 |
| 160 | 3300025913 | Ga0207695_10002511 | Ga0207695_100025112 | 152 |
| 161 | 3300025913 | Ga0207695_10102063 | Ga0207695_101020634 | 152 |
| 162 | 3300025913 | Ga0207695_10170504 | Ga0207695_101705041 | 152 |
| 163 | 3300025914 | Ga0207671_10008618 | Ga0207671_100086187 | 152 |
| 164 | 3300025914 | Ga0207671_10712820 | Ga0207671_107128202 | 152 |
| 165 | 3300025920 | Ga0207649_10672156 | Ga0207649_106721562 | 152 |
| 166 | 3300025920 | Ga0207649_11069180 | Ga0207649_110691802 | 152 |
| 167 | 3300025922 | Ga0207646_10193510 | Ga0207646_101935102 | 152 |
| 168 | 3300025923 | Ga0207681_10016723 | Ga0207681_100167235 | 152 |
| 169 | 3300025924 | Ga0207694_10078534 | Ga0207694_100785342 | 152 |
| 170 | 3300025925 | Ga0207650_10534499 | Ga0207650_105344991 | 152 |
| 171 | 3300025926 | Ga0207659_10052184 | Ga0207659_100521844 | 152 |
| 172 | 3300025927 | Ga0207687_10109965 | Ga0207687_101099652 | 152 |
| 173 | 3300025931 | Ga0207644_10823842 | Ga0207644_108238422 | 152 |
| 174 | 3300025933 | Ga0207706_10345682 | Ga0207706_103456822 | 152 |
| 175 | 3300025933 | Ga0207706_10839646 | Ga0207706_108396462 | 152 |
| 176 | 3300025936 | Ga0207670_10003832 | Ga0207670_1000383210 | 152 |
| 177 | 3300025938 | Ga0207704_10191380 | Ga0207704_101913802 | 152 |
| 178 | 3300025940 | Ga0207691_10438761 | Ga0207691_104387613 | 152 |
| 179 | 3300025942 | Ga0207689_10308099 | Ga0207689_103080993 | 152 |
| 180 | 3300025942 | Ga0207689_10611467 | Ga0207689_106114671 | 152 |
| 181 | 3300025942 | Ga0207689_10853239 | Ga0207689_108532392 | 152 |
| 182 | 3300025945 | Ga0207679_10286454 | Ga0207679_102864543 | 152 |
| 183 | 3300025945 | Ga0207679_10934108 | Ga0207679_109341082 | 152 |
| 184 | 3300025949 | Ga0207667_10163269 | Ga0207667_101632692 | 152 |
| 185 | 3300025960 | Ga0207651_10505637 | Ga0207651_105056372 | 152 |
| 186 | 3300025961 | Ga0207712_10000301 | Ga0207712_1000030121 | 152 |
| 187 | 3300025972 | Ga0207668_10195696 | Ga0207668_101956961 | 152 |
| 188 | 3300025981 | Ga0207640_10050219 | Ga0207640_100502192 | 152 |
| 189 | 3300025986 | Ga0207658_10000056 | Ga0207658_100000562 | 152 |
| 190 | 3300026035 | Ga0207703_10382125 | Ga0207703_103821252 | 152 |
| 191 | 3300026041 | Ga0207639_10016763 | Ga0207639_100167632 | 152 |
| 192 | 3300026041 | Ga0207639_10387218 | Ga0207639_103872183 | 152 |
| 193 | 3300026067 | Ga0207678_10000389 | Ga0207678_1000038938 | 152 |
| 194 | 3300026075 | Ga0207708_10013255 | Ga0207708_100132555 | 152 |
| 195 | 3300026075 | Ga0207708_10037540 | Ga0207708_100375404 | 152 |
| 196 | 3300026078 | Ga0207702_10000200 | Ga0207702_1000020036 | 152 |
| 197 | 3300026088 | Ga0207641_10147220 | Ga0207641_101472203 | 152 |
| 198 | 3300026089 | Ga0207648_10342525 | Ga0207648_103425253 | 152 |
| 199 | 3300026089 | Ga0207648_11444432 | Ga0207648_114444321 | 152 |
| 200 | 3300026095 | Ga0207676_10390738 | Ga0207676_103907382 | 152 |
| 201 | 3300026116 | Ga0207674_10002598 | Ga0207674_100025982 | 152 |
| 202 | 3300026116 | Ga0207674_10084136 | Ga0207674_100841363 | 152 |
| 203 | 3300026116 | Ga0207674_10475398 | Ga0207674_104753982 | 152 |
| 204 | 3300026118 | Ga0207675_100001730 | Ga0207675_1000017306 | 152 |
| 205 | 3300026118 | Ga0207675_100003384 | Ga0207675_1000033846 | 152 |
| 206 | 3300026118 | Ga0207675_100049787 | Ga0207675_1000497873 | 152 |
| 207 | 3300026118 | Ga0207675_100074216 | Ga0207675_1000742164 | 152 |
| 208 | 3300026118 | Ga0207675_100363101 | Ga0207675_1003631012 | 152 |
| 209 | 3300026142 | Ga0207698_10081377 | Ga0207698_100813773 | 152 |
| 210 | 3300026142 | Ga0207698_10280980 | Ga0207698_102809802 | 152 |
| 211 | 3300028380 | Ga0268265_10009358 | Ga0268265_100093587 | 152 |
| 212 | 3300028380 | Ga0268265_10043460 | Ga0268265_100434605 | 152 |
| 213 | 3300028380 | Ga0268265_10080128 | Ga0268265_100801283 | 152 |
| 214 | 3300028381 | Ga0268264_10715753 | Ga0268264_107157532 | 152 |
| 215 | 3300031456 | Ga0307513_10022541 | Ga0307513_100225417 | 152 |
| 216 | 3300031730 | Ga0307516_10000107 | Ga0307516_1000010710 | 152 |
| 217 | 3300031731 | Ga0307405_10143790 | Ga0307405_101437902 | 152 |
| 218 | 3300031731 | Ga0307405_11331853 | Ga0307405_113318532 | 152 |
| 219 | 3300031824 | Ga0307413_10092553 | Ga0307413_100925533 | 152 |
| 220 | 3300031824 | Ga0307413_10156378 | Ga0307413_101563782 | 152 |
| 221 | 3300031852 | Ga0307410_10135187 | Ga0307410_101351873 | 152 |
| 222 | 3300031852 | Ga0307410_10855697 | Ga0307410_108556972 | 152 |
| 223 | 3300031901 | Ga0307406_10009808 | Ga0307406_100098086 | 152 |
| 224 | 3300031901 | Ga0307406_10226720 | Ga0307406_102267203 | 152 |
| 225 | 3300031901 | Ga0307406_10639611 | Ga0307406_106396112 | 152 |
| 226 | 3300031903 | Ga0307407_10008692 | Ga0307407_100086926 | 152 |
| 227 | 3300031903 | Ga0307407_10047729 | Ga0307407_100477294 | 152 |
| 228 | 3300031995 | Ga0307409_100001730 | Ga0307409_1000017303 | 152 |
| 229 | 3300031995 | Ga0307409_100012747 | Ga0307409_1000127474 | 152 |
| 230 | 3300031995 | Ga0307409_100276892 | Ga0307409_1002768922 | 152 |
| 231 | 3300032002 | Ga0307416_100069791 | Ga0307416_1000697912 | 152 |
| 232 | 3300032002 | Ga0307416_100556724 | Ga0307416_1005567243 | 152 |
| 233 | 3300032004 | Ga0307414_10406311 | Ga0307414_104063112 | 152 |
| 234 | 3300032005 | Ga0307411_10015823 | Ga0307411_100158233 | 152 |
| 235 | 3300032005 | Ga0307411_10429468 | Ga0307411_104294681 | 152 |
| 236 | 3300032126 | Ga0307415_100081904 | Ga0307415_1000819043 | 152 |
| 237 | 3300032126 | Ga0307415_100172096 | Ga0307415_1001720962 | 152 |
| 238 | 3300032126 | Ga0307415_100474600 | Ga0307415_1004746003 | 152 |
| 239 | 3300032126 | Ga0307415_100816184 | Ga0307415_1008161842 | 152 |
| 240 | 3300035086 | Ga0373934_0077180 | Ga0373934_0077180_673_1131 | 152 |
| 241 | 3300035120 | Ga0373957_0313209 | Ga0373957_0313209_34_504 | 152 |
| 242 | 3300036401 | Ga0373937_0142724 | Ga0373937_0142724_398_931 | 152 |
| 243 | 3300037466 | Ga0395898_0024484 | Ga0395898_0024484_3977_4435 | 152 |
| 244 | 3300037471 | Ga0395905_0241794 | Ga0395905_0241794_10_468 | 152 |
| 245 | 3300037471 | Ga0395905_0509670 | Ga0395905_0509670_187_660 | 152 |
| 246 | 3300037853 | Ga0436364_0832650 | Ga0436364_0832650_90_551 | 152 |
| 247 | 3300038443 | Ga0395901_0002128 | Ga0395901_0002128_19631_20089 | 152 |
| 248 | 3300041451 | Ga0451791_1624986 | Ga0451791_1624986_1298_1771 | 152 |
| 249 | 3300041460 | Ga0451802_0724312 | Ga0451802_0724312_982_1455 | 152 |
| 250 | 3300041486 | Ga0451807_0207673 | Ga0451807_0207673_403_873 | 152 |
| 251 | 3300041486 | Ga0451807_2339569 | Ga0451807_2339569_369_842 | 152 |
| 252 | 3300041491 | Ga0451833_1067120 | Ga0451833_1067120_516_989 | 152 |
| 253 | 3300041494 | Ga0451837_1475514 | Ga0451837_1475514_714_1187 | 152 |
| 254 | 3300041505 | Ga0451849_0175001 | Ga0451849_0175001_142_615 | 152 |
| 255 | 3300042876 | Ga0451577_0197345 | Ga0451577_0197345_365_829 | 152 |
| 256 | 3300045976 | Ga0466967_0752368 | Ga0466967_0752368_134_607 | 152 |
| 257 | 3300046457 | Ga0495590_0029645 | Ga0495590_0029645_216_686 | 152 |
| 258 | 3300046460 | Ga0495638_0082565 | Ga0495638_0082565_524_994 | 152 |
| 259 | 3300046471 | Ga0495650_0007657 | Ga0495650_0007657_5400_5879 | 152 |
| 260 | 3300046475 | Ga0495639_0059824 | Ga0495639_0059824_155_616 | 152 |
| 261 | 3300046529 | Ga0495652_0774737 | Ga0495652_0774737_73_534 | 152 |
| 262 | 3300046616 | Ga0495668_0325306 | Ga0495668_0325306_22_492 | 152 |
| 263 | 3300046660 | Ga0495625_0006350 | Ga0495625_0006350_162_632 | 152 |
| 264 | 3300046660 | Ga0495625_0279606 | Ga0495625_0279606_254_724 | 152 |
| 265 | 3300047472 | Ga0495686_0004347 | Ga0495686_0004347_6748_7209 | 152 |
| 266 | 3300048908 | Ga0496105_0319395 | Ga0496105_0319395_317_787 | 152 |
| 267 | 3300048911 | Ga0496108_0510300 | Ga0496108_0510300_118_576 | 152 |
| 268 | 3300048917 | Ga0496114_0827729 | Ga0496114_0827729_182_652 | 152 |
| 269 | 3300048918 | Ga0496115_0913800 | Ga0496115_0913800_102_572 | 152 |
| 270 | 3300048922 | Ga0496119_0000909 | Ga0496119_0000909_1849_2310 | 152 |
| 271 | 3300048923 | Ga0496120_0000159 | Ga0496120_0000159_103695_104156 | 152 |
| 272 | 3300048923 | Ga0496120_0000233 | Ga0496120_0000233_87568_88071 | 152 |
| 273 | 3300048924 | Ga0496121_0055497 | Ga0496121_0055497_1153_1614 | 152 |
| 274 | 3300048925 | Ga0496122_0005693 | Ga0496122_0005693_10815_11276 | 152 |
| 275 | 3300048926 | Ga0496123_0004026 | Ga0496123_0004026_4668_5129 | 152 |
| 276 | 3300048927 | Ga0496124_0000008 | Ga0496124_0000008_171307_171768 | 152 |
| 277 | 3300049570 | Ga0501033_0009951 | Ga0501033_0009951_3045_3506 | 152 |
| 278 | 3300049573 | Ga0501037_0126589 | Ga0501037_0126589_1177_1644 | 152 |
| 279 | 3300049578 | Ga0501042_0112856 | Ga0501042_0112856_1394_1867 | 152 |
| 280 | 3300049578 | Ga0501042_0593559 | Ga0501042_0593559_134_601 | 152 |
| 281 | 3300049583 | Ga0501067_0006895 | Ga0501067_0006895_338_805 | 152 |
| 282 | 3300049584 | Ga0501068_0003491 | Ga0501068_0003491_7815_8282 | 152 |
| 283 | 3300049584 | Ga0501068_0326143 | Ga0501068_0326143_347_820 | 152 |
| 284 | 3300049587 | Ga0501071_0004758 | Ga0501071_0004758_6994_7461 | 152 |
| 285 | 3300049588 | Ga0501072_0517422 | Ga0501072_0517422_393_860 | 152 |
| 286 | 3300049589 | Ga0501073_0012636 | Ga0501073_0012636_2796_3263 | 152 |
| 287 | 3300049590 | Ga0501074_0016530 | Ga0501074_0016530_3094_3561 | 152 |
| 288 | 3300049592 | Ga0501076_0109987 | Ga0501076_0109987_998_1465 | 152 |
| 289 | 3300049741 | Ga0501079_0000501 | Ga0501079_0000501_6043_6510 | 152 |
| 290 | 3300049742 | Ga0501080_0001374 | Ga0501080_0001374_7322_7789 | 152 |
| 291 | 3300049744 | Ga0501083_0030071 | Ga0501083_0030071_2505_2972 | 152 |
| 292 | 3300049822 | Ga0501035_0097372 | Ga0501035_0097372_1218_1679 | 152 |
| 293 | 3300049822 | Ga0501035_0728320 | Ga0501035_0728320_306_773 | 152 |
| 294 | 3300049823 | Ga0501044_0298211 | Ga0501044_0298211_1027_1488 | 152 |
| 295 | 3300050493 | nmdc:mga0k408_126741_c1 | nmdc:mga0k408_126741_c1_860_1318 | 152 |
| 296 | 3300050496 | nmdc:mga07m45_1213_c1 | nmdc:mga07m45_1213_c1_7130_7600 | 152 |
| 297 | 3300050511 | nmdc:mga08y16_30591_c1 | nmdc:mga08y16_30591_c1_2233_2703 | 152 |
| 298 | 3300050511 | nmdc:mga08y16_584340_c1 | nmdc:mga08y16_584340_c1_371_850 | 152 |
| 299 | 3300053087 | Ga0500643_000450 | Ga0500643_000450_2972_3433 | 152 |
| 300 | 3300053120 | Ga0500597_000432 | Ga0500597_000432_703_1164 | 152 |
| 301 | 3300053125 | Ga0500618_132838 | Ga0500618_132838_87_548 | 152 |
| 302 | 3300053136 | Ga0500559_0021509 | Ga0500559_0021509_160_621 | 152 |
| 303 | 3300053136 | Ga0500559_0022881 | Ga0500559_0022881_1201_1662 | 152 |
| 304 | 3300053157 | Ga0500624_016891 | Ga0500624_016891_585_1046 | 152 |
| 305 | 3300054114 | Ga0501084_0025257 | Ga0501084_0025257_4381_4848 | 152 |
| 306 | 3300060353 | Ga0501082_0027589 | Ga0501082_0027589_1795_2262 | 152 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1qsm-assembly1.cif.gz_D | histone acetyltransferase hpa2 from saccharomyces cerevisiae in complex with acetyl coenzyme a | 0.9544 | 2 | 150 |
| 7ypu-assembly4.cif.gz_G | orfe-coa-glycylthricin complex | 0.9403 | 55 | 139 |
| 7ypu-assembly4.cif.gz_H | orfe-coa-glycylthricin complex | 0.9361 | 54 | 139 |
| 8a9o-assembly1.cif.gz_A | structure of the polyamine acetyltransferase dpa | 0.9104 | 4 | 149 |
| 3fyn-assembly1.cif.gz_A-2 | crystal structure from the mobile metagenome of cole harbour salt marsh: integron cassette protein hfx_cass3 | 0.9072 | 6 | 151 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q06592_5_156_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.9602 | 3 | 150 | 3.40.630.30 |
| af_A0A1D8PP99_1_151_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.9529 | 3 | 150 | 3.40.630.30 |
| af_A0A1D8PP99_1_151_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.9283 | 3 | 150 | 3.40.630.30 |
| af_P16691_3_141_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.8977 | 4 | 149 | 3.40.630.30 |
| 1y9wB01 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.8965 | 55 | 139 | 3.40.630.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1S8FMT0-F1-model_v4 | GNAT family N-acetyltransferase | 1 | 4 | 152 |
GO:0016747
|
| AF-A0A437MPY7-F1-model_v4 | GNAT family N-acetyltransferase | 0.999 | 4 | 152 |
GO:0016747
|
| AF-A0A1H6QPB3-F1-model_v4 | Ribosomal protein S18 acetylase RimI | 0.9986 | 4 | 152 |
GO:0005840
GO:0016747 |
| AF-A0A5S4YHB3-F1-model_v4 | GNAT family N-acetyltransferase | 0.9978 | 3 | 152 |
GO:0008080
|
| AF-A0A3S0HDA6-F1-model_v4 | deleted | 0.9977 | 3 | 116 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar