F398706

General Info

Members Datasets Scaffolds Average Seq Length
306 224 299 245

Family's Representative Sequence

Representative Sequence 3300025929|Ga0207664_10046298|Ga0207664_100462983
Length 258
Sequence MPAQRHWISKVAIARALVVALAFVLLELLCRTGVIGRVTMIPPSEMVAALFDILRTGQFNSDIAFTCVNTISATALAIAAGFALGAGLHALPRLRRVIDPLLSAYYAVPTFVLFYPLLIVVFGAGRTALVVIGAMFGIVAMIINTVLGLDHVPPAVGRTGHVLKLDGLRQLVLIRLPAAAPHLVSGIKLAVAYSVIGIVAGEFILATRGIGKRVAFAYDNFDNKTMYGLLLLLLIAVALVNGCLSAWEKQLHRRFGQR

Samples

Sample ID Description Type Environment
1 2643221736 Bosea sp. Root483D1 Isolate Unclassified
2 2818991467 Bosea vestrisii 3192 Isolate Unclassified
3 2841760612 Bosea sp. Tri-49 Isolate Nodule
4 2844104063 Bosea sp. Tri-39 Isolate Nodule
5 2851182111 Bosea sp. Tri-44 Isolate Nodule
6 2851246043 Bosea sp. Tri-54 Isolate Nodule
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
46 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
71 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
72 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
73 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
74 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
111 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
112 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
115 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
116 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
117 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
118 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
119 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
120 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
121 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
122 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
124 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
125 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
133 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
134 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
135 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
136 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
137 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
138 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
139 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
140 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
141 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
142 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
143 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
144 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
145 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
146 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
147 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
148 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
149 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
150 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
151 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
152 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
153 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
154 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
155 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
156 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
157 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
158 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
159 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
160 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
161 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
162 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
163 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
164 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
165 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
166 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
167 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
168 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
169 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
170 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
171 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
172 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
173 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
174 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
175 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
176 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
177 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
178 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
179 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
180 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
181 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
182 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
183 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
186 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
187 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
195 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
196 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
197 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
198 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
199 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
202 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
203 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
204 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
205 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
206 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
207 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
208 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
209 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
210 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
211 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
212 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
213 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
214 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
215 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
216 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
217 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
218 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
219 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
220 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
221 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
222 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
223 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
224 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.71
Metatranscriptomes 0
Isolates 2.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.15
Nodule 1.63
Rhizoplane 0.98
Rhizosphere 86.6
Stem 0
Stem Tuber 0
Unclassified 1.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1006338 3300002987 Bacteria 3554
2 Ga0065165_1000229 3300005262 Bacteria 98699
3 Ga0065715_10305770 3300005293 Bacteria 1031
4 Ga0065715_10316452 3300005293 Bacteria 1000
5 Ga0070658_10024543 3300005327 Bacteria 4836
6 Ga0070658_10032181 3300005327 Bacteria 4217
7 Ga0070676_10077890 3300005328 Bacteria 2004
8 Ga0070670_100183358 3300005331 Bacteria 1817
9 Ga0070666_10034384 3300005335 Bacteria 3358
10 Ga0070680_100001887 3300005336 Bacteria 15378
11 Ga0070680_100138126 3300005336 Bacteria 2043
12 Ga0070680_100147308 3300005336 Unclassified 1976
13 Ga0070689_100184834 3300005340 Bacteria 1694
14 Ga0070689_100229193 3300005340 Bacteria 1526
15 Ga0070687_100061864 3300005343 Bacteria 1980
16 Ga0070687_100304305 3300005343 Bacteria 1013
17 Ga0070675_100240838 3300005354 Bacteria 1581
18 Ga0070675_100306057 3300005354 Bacteria 1401
19 Ga0070671_100074007 3300005355 Bacteria 2846
20 Ga0070673_100441449 3300005364 Bacteria 1169
21 Ga0070688_100060508 3300005365 Bacteria 2392
22 Ga0070659_100052566 3300005366 Unclassified 3205
23 Ga0070713_100126140 3300005436 Unclassified 2252
24 Ga0070701_10173393 3300005438 Bacteria 1257
25 Ga0070711_100076780 3300005439 Bacteria 2369
26 Ga0070705_100037208 3300005440 Bacteria 2743
27 Ga0070662_100222956 3300005457 Bacteria 1505
28 Ga0070681_10072303 3300005458 Bacteria 3412
29 Ga0070681_10326884 3300005458 Bacteria 1443
30 Ga0070685_10185710 3300005466 Bacteria 1341
31 Ga0070707_100566786 3300005468 Bacteria 1098
32 Ga0070698_100175772 3300005471 Bacteria 2081
33 Ga0070698_100763711 3300005471 Bacteria 910
34 Ga0070679_100005746 3300005530 Bacteria 11508
35 Ga0068853_100185351 3300005539 Bacteria 1889
36 Ga0068853_100722379 3300005539 Bacteria 951
37 Ga0070695_100012768 3300005545 Bacteria 5042
38 Ga0070665_100735383 3300005548 Bacteria 1000
39 Ga0068855_100015541 3300005563 Bacteria 9164
40 Ga0068855_100039698 3300005563 Bacteria 5587
41 Ga0068857_100120931 3300005577 Bacteria 2357
42 Ga0068856_100072059 3300005614 Bacteria 3421
43 Ga0068856_100373363 3300005614 Unclassified 1445
44 Ga0068852_100019271 3300005616 Bacteria 5395
45 Ga0068852_100104491 3300005616 Bacteria 2564
46 Ga0068864_100070957 3300005618 Bacteria 3032
47 Ga0068863_100100898 3300005841 Bacteria 2743
48 Ga0068862_100600066 3300005844 Bacteria 1057
49 Ga0081538_10029189 3300005981 Bacteria 3775
50 Ga0081539_10034076 3300005985 Bacteria 3088
51 Ga0070717_10242830 3300006028 Bacteria 1589
52 Ga0070717_10434143 3300006028 Bacteria 1182
53 Ga0075432_10030816 3300006058 Bacteria 1855
54 Ga0075362_10001180 3300006177 Bacteria 8185
55 Ga0075367_10007683 3300006178 Bacteria 5538
56 Ga0075369_10122500 3300006186 Bacteria 1178
57 Ga0075366_10001237 3300006195 Bacteria 12669
58 Ga0075366_10038855 3300006195 Bacteria 2811
59 Ga0075428_100148021 3300006844 Bacteria 2552
60 Ga0075434_100025900 3300006871 Bacteria 5741
61 Ga0075434_100339292 3300006871 Bacteria 1523
62 Ga0075436_100094037 3300006914 Bacteria 2085
63 Ga0105251_10074583 3300009011 Bacteria 1575
64 Ga0111539_10036258 3300009094 Bacteria 5965
65 Ga0111539_10233941 3300009094 Bacteria 2139
66 Ga0111539_10275051 3300009094 Bacteria 1960
67 Ga0105245_10570874 3300009098 Bacteria 1155
68 Ga0114129_10164372 3300009147 Bacteria 3030
69 Ga0105243_10261367 3300009148 Bacteria 1550
70 Ga0105248_10076366 3300009177 Bacteria 3766
71 Ga0105238_10096406 3300009551 Bacteria 2944
72 Ga0105249_10912614 3300009553 Bacteria 945
73 Ga0105246_10203689 3300011119 Bacteria 1540
74 Ga0157373_10078407 3300013100 Bacteria 2329
75 Ga0157371_10083441 3300013102 Bacteria 2263
76 Ga0157371_10185937 3300013102 Bacteria 1487
77 Ga0157370_10055398 3300013104 Bacteria 3778
78 Ga0157370_10187709 3300013104 Unclassified 1919
79 Ga0157369_10627700 3300013105 Bacteria 1108
80 Ga0163162_10330105 3300013306 Bacteria 1658
81 Ga0163162_10808002 3300013306 Bacteria 1055
82 Ga0157372_10197053 3300013307 Bacteria 2333
83 Ga0157380_10090841 3300014326 Bacteria 2520
84 Ga0157379_10556912 3300014968 Bacteria 1067
85 Ga0213871_10064393 3300021441 Bacteria 1026
86 Ga0209130_1000045 3300025284 Bacteria 240278
87 Ga0209025_1016636 3300025294 Bacteria 4317
88 Ga0209025_1064609 3300025294 Bacteria 1343
89 Ga0207426_1010082 3300025302 Bacteria 3693
90 Ga0207682_10000821 3300025893 Bacteria 14352
91 Ga0207710_10071666 3300025900 Bacteria 1590
92 Ga0207688_10014612 3300025901 Bacteria 4265
93 Ga0207688_10219241 3300025901 Bacteria 1145
94 Ga0207680_10312598 3300025903 Bacteria 1097
95 Ga0207645_10015201 3300025907 Bacteria 5124
96 Ga0207705_10004267 3300025909 Bacteria 10827
97 Ga0207705_10024644 3300025909 Bacteria 4293
98 Ga0207707_10086981 3300025912 Bacteria 2731
99 Ga0207707_10489654 3300025912 Bacteria 1050
100 Ga0207663_10132452 3300025916 Unclassified 1724
101 Ga0207660_10011533 3300025917 Bacteria 5759
102 Ga0207660_10119428 3300025917 Bacteria 1995
103 Ga0207662_10024536 3300025918 Bacteria 3469
104 Ga0207662_10385950 3300025918 Bacteria 947
105 Ga0207657_10229062 3300025919 Unclassified 1486
106 Ga0207652_10005554 3300025921 Bacteria 10221
107 Ga0207652_10719950 3300025921 Bacteria 890
108 Ga0207646_10141679 3300025922 Bacteria 2166
109 Ga0207694_10275017 3300025924 Bacteria 1382
110 Ga0207650_10208954 3300025925 Bacteria 1567
111 Ga0207650_10283597 3300025925 Bacteria 1349
112 Ga0207687_10151150 3300025927 Bacteria 1772
113 Ga0207700_10111143 3300025928 Unclassified 2205
114 Ga0207700_10282626 3300025928 Unclassified 1428
115 Ga0207664_10046298 3300025929 Bacteria 3413
116 Ga0207644_10210070 3300025931 Bacteria 1539
117 Ga0207690_10188121 3300025932 Unclassified 1560
118 Ga0207669_10470777 3300025937 Bacteria 999
119 Ga0207691_10016641 3300025940 Bacteria 6983
120 Ga0207691_10205553 3300025940 Bacteria 1713
121 Ga0207689_10398487 3300025942 Bacteria 1147
122 Ga0207667_10002456 3300025949 Bacteria 23176
123 Ga0207667_10081395 3300025949 Bacteria 3354
124 Ga0207668_10260143 3300025972 Bacteria 1414
125 Ga0207678_10287857 3300026067 Bacteria 1411
126 Ga0207708_10229841 3300026075 Bacteria 1489
127 Ga0207702_10075969 3300026078 Bacteria 2903
128 Ga0207702_10320213 3300026078 Unclassified 1477
129 Ga0207648_10122467 3300026089 Bacteria 2287
130 Ga0207676_10123624 3300026095 Bacteria 2186
131 Ga0207674_10153474 3300026116 Bacteria 2259
132 Ga0207675_100211187 3300026118 Bacteria 1867
133 Ga0207675_100551450 3300026118 Bacteria 1152
134 Ga0207683_10022537 3300026121 Bacteria 5406
135 Ga0207698_10078135 3300026142 Bacteria 2656
136 Ga0207428_10077328 3300027907 Bacteria 2605
137 Ga0268264_10267827 3300028381 Bacteria 1595
138 Ga0265325_10008700 3300031241 Bacteria 5970
139 Ga0265339_10001774 3300031249 Bacteria 15875
140 Ga0265316_10087898 3300031344 Bacteria 2374
141 Ga0307408_100269183 3300031548 Bacteria 1414
142 Ga0265313_10005248 3300031595 Bacteria 9593
143 Ga0307410_10023949 3300031852 Bacteria 3807
144 Ga0307414_10034218 3300032004 Bacteria 3366
145 Ga0307411_10035047 3300032005 Bacteria 3129
146 Ga0307510_10061301 3300033180 Bacteria 3859
147 Ga0373954_0041799 3300035118 Bacteria 2138
148 Ga0373943_0128162 3300035170 Bacteria 1356
149 Ga0373924_0057131 3300035410 Bacteria 1627
150 Ga0373935_0063565 3300035692 Bacteria 2366
151 Ga0373927_0147745 3300035695 Bacteria 1539
152 Ga0373947_0114381 3300035725 Bacteria 1709
153 Ga0373947_0154270 3300035725 Bacteria 1481
154 Ga0373937_0188758 3300036401 Bacteria 1936
155 Ga0373925_0436438 3300037068 Bacteria 1071
156 Ga0395899_0006840 3300037312 Bacteria 8833
157 Ga0395899_0288058 3300037312 Bacteria 1115
158 Ga0395900_0001715 3300037418 Bacteria 25336
159 Ga0395898_0025971 3300037466 Bacteria 5898
160 Ga0395898_0026356 3300037466 Bacteria 5851
161 Ga0395905_0773437 3300037471 Bacteria 863
162 Ga0395901_0011685 3300038443 Bacteria 8897
163 Ga0395901_0018310 3300038443 Bacteria 7151
164 Ga0395901_0027824 3300038443 Bacteria 5814
165 Ga0237819_05741 3300038705 Bacteria 1922
166 Ga0436360_1088500 3300039438 Bacteria 1247
167 Ga0439453_0023547 3300041408 Bacteria 1124
168 Ga0451577_0053982 3300042876 Bacteria 3588
169 Ga0451577_0214926 3300042876 Bacteria 1737
170 Ga0466963_0202410 3300044694 Bacteria 1389
171 Ga0453684_0548376 3300044712 Bacteria 1274
172 Ga0453684_0742425 3300044712 Bacteria 1063
173 Ga0466957_0397964 3300044842 Bacteria 942
174 Ga0466957_0465350 3300044842 Bacteria 873
175 Ga0495617_007487 3300046452 Bacteria 3788
176 Ga0495590_0081782 3300046457 Bacteria 1138
177 Ga0495591_009879 3300046458 Bacteria 3751
178 Ga0495629_0296885 3300046459 Unclassified 1107
179 Ga0495638_0018079 3300046460 Bacteria 4688
180 Ga0495638_0019577 3300046460 Bacteria 4477
181 Ga0495653_0131431 3300046463 Bacteria 1771
182 Ga0495650_0000316 3300046471 Bacteria 86653
183 Ga0495650_0006039 3300046471 Bacteria 7652
184 Ga0495582_0028739 3300046473 Bacteria 3052
185 Ga0495605_0000079 3300046474 Bacteria 126756
186 Ga0495605_0035176 3300046474 Bacteria 2533
187 Ga0495584_0217310 3300046491 Bacteria 972
188 Ga0495585_0076329 3300046492 Bacteria 1820
189 Ga0495607_0000677 3300046501 Bacteria 32941
190 Ga0495607_0054940 3300046501 Bacteria 2292
191 Ga0495583_0000591 3300046506 Bacteria 49672
192 Ga0495583_0001018 3300046506 Bacteria 31946
193 Ga0495583_0001437 3300046506 Bacteria 24216
194 Ga0495583_0001702 3300046506 Bacteria 21192
195 Ga0495606_0000022 3300046507 Bacteria 265567
196 Ga0495610_0006127 3300046512 Bacteria 8383
197 Ga0495610_0015167 3300046512 Bacteria 4490
198 Ga0495616_0014258 3300046513 Bacteria 4457
199 Ga0495620_0030044 3300046515 Bacteria 2507
200 Ga0495620_0156792 3300046515 Unclassified 885
201 Ga0495632_0000651 3300046519 Bacteria 31902
202 Ga0495632_0075360 3300046519 Bacteria 1614
203 Ga0495637_0012666 3300046520 Bacteria 4026
204 Ga0495637_0039494 3300046520 Bacteria 2036
205 Ga0495643_0045590 3300046522 Bacteria 2379
206 Ga0495663_0107352 3300046525 Bacteria 925
207 Ga0495654_0012882 3300046530 Bacteria 4483
208 Ga0495598_0004211 3300046537 Bacteria 3104
209 Ga0495609_0000168 3300046538 Bacteria 68840
210 Ga0495609_0000692 3300046538 Bacteria 25981
211 Ga0495597_0069377 3300046542 Bacteria 1521
212 Ga0495622_0006296 3300046557 Bacteria 5512
213 Ga0495667_0055862 3300046559 Bacteria 2597
214 Ga0495625_0000004 3300046660 Bacteria 611314
215 Ga0495625_0056135 3300046660 Bacteria 2805
216 Ga0495659_0146435 3300046664 Bacteria 946
217 Ga0495661_0000006 3300046665 Bacteria 427288
218 Ga0495661_0000241 3300046665 Bacteria 63218
219 Ga0495661_0008380 3300046665 Bacteria 7154
220 Ga0495646_0227222 3300046680 Bacteria 1007
221 Ga0495646_0324684 3300046680 Unclassified 810
222 Ga0495670_0019266 3300046691 Bacteria 3362
223 Ga0495649_0008246 3300046694 Bacteria 6276
224 Ga0495660_0010455 3300046810 Bacteria 5398
225 Ga0495660_0139427 3300046810 Bacteria 1208
226 Ga0495672_0089047 3300047320 Bacteria 1700
227 Ga0495676_0000004 3300047321 Bacteria 313696
228 Ga0495679_000015 3300047446 Bacteria 287256
229 Ga0495685_091410 3300047447 Bacteria 1009
230 Ga0495673_0007288 3300047469 Bacteria 6384
231 Ga0495673_0092395 3300047469 Bacteria 1234
232 Ga0495681_0003055 3300047470 Bacteria 11750
233 Ga0495686_0076449 3300047472 Bacteria 2051
234 Ga0495602_0122941 3300048088 Unclassified 2085
235 Ga0495602_0555774 3300048088 Bacteria 795
236 Ga0495626_0000012 3300048091 Bacteria 258483
237 Ga0496105_0012003 3300048908 Bacteria 6860
238 Ga0496111_0435535 3300048914 Bacteria 968
239 Ga0496112_0214089 3300048915 Bacteria 1884
240 Ga0496126_0140544 3300048929 Bacteria 2079
241 Ga0495678_019718 3300049459 Bacteria 3000
242 Ga0501031_0047379 3300049568 Bacteria 2803
243 Ga0501034_0057229 3300049571 Bacteria 3920
244 Ga0501037_0105123 3300049573 Bacteria 2035
245 Ga0501038_0049358 3300049574 Bacteria 3639
246 Ga0501038_0542404 3300049574 Bacteria 885
247 Ga0501039_0008884 3300049575 Bacteria 7656
248 Ga0501039_0278588 3300049575 Bacteria 1315
249 Ga0501039_0541181 3300049575 Bacteria 914
250 Ga0501047_0015335 3300049581 Bacteria 7300
251 Ga0501047_0298199 3300049581 Bacteria 1455
252 Ga0501048_0485473 3300049582 Bacteria 886
253 Ga0501070_0089318 3300049586 Bacteria 2550
254 Ga0501072_0058147 3300049588 Bacteria 3048
255 Ga0501072_0180018 3300049588 Bacteria 1686
256 Ga0501075_0467344 3300049591 Bacteria 962
257 Ga0501079_0159569 3300049741 Bacteria 1758
258 Ga0501081_0093534 3300049743 Bacteria 2117
259 Ga0501081_0165634 3300049743 Unclassified 1594
260 Ga0501081_0181145 3300049743 Bacteria 1524
261 Ga0501083_0030354 3300049744 Bacteria 3714
262 Ga0501083_0069976 3300049744 Bacteria 2335
263 Ga0501083_0070219 3300049744 Bacteria 2330
264 Ga0501044_0432487 3300049823 Unclassified 1225
265 Ga0501045_0335645 3300049824 Bacteria 1125
266 nmdc:mga03683_11573_c1 3300050489 Bacteria 3196
267 nmdc:mga03683_178336_c1 3300050489 Bacteria 968
268 nmdc:mga03683_91194_c1 3300050489 Bacteria 1329
269 nmdc:mga00v17_17852_c1 3300050491 Bacteria 4023
270 nmdc:mga0k408_1584_c1 3300050493 Bacteria 12299
271 nmdc:mga0k408_3072_c1 3300050493 Bacteria 8845
272 nmdc:mga06z11_36690_c1 3300050494 Bacteria 2421
273 nmdc:mga07m45_142701_c1 3300050496 Bacteria 1387
274 nmdc:mga08y16_164094_c1 3300050511 Bacteria 2308
275 nmdc:mga08y16_350105_c1 3300050511 Bacteria 1517
276 nmdc:mga0n895_317152_c1 3300050512 Bacteria 1580
277 nmdc:mga0rr50_245555_c1 3300050513 Bacteria 1485
278 nmdc:mga0sz30_40779_c1 3300050516 Bacteria 1951
279 Ga0495601_0004965 3300053077 Bacteria 7719
280 Ga0495601_0013139 3300053077 Bacteria 4978
281 Ga0500635_0084946 3300053080 Bacteria 1143
282 Ga0495595_0004309 3300053084 Bacteria 5724
283 Ga0495595_0015894 3300053084 Bacteria 3213
284 Ga0495595_0262335 3300053084 Unclassified 866
285 Ga0495619_0006479 3300053085 Bacteria 7415
286 Ga0500583_0072091 3300053092 Bacteria 1654
287 Ga0500641_0097906 3300053096 Bacteria 1257
288 Ga0500650_0117148 3300053098 Bacteria 1243
289 Ga0500652_107319 3300053131 Bacteria 1167
290 Ga0500577_0025913 3300053142 Bacteria 1990
291 Ga0500577_0087450 3300053142 Bacteria 1254
292 Ga0500604_0064830 3300053151 Bacteria 1155
293 Ga0501084_0063201 3300054114 Bacteria 3099
294 Ga0501084_0186063 3300054114 Bacteria 1753
295 Ga0501084_0371783 3300054114 Bacteria 1208
296 Ga0501082_0271420 3300060353 Bacteria 1476
297 Ga0501082_0394098 3300060353 Bacteria 1208
298 Ga0530510_0076942 3300061734 Bacteria 2425
299 Ga0530510_0227391 3300061734 Unclassified 1387

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053096 Ga0500641_0097906 Ga0500641_0097906_290_1039 174
2 3300046515 Ga0495620_0030044 Ga0495620_0030044_32_667 191
3 3300053080 Ga0500635_0084946 Ga0500635_0084946_23_637 191
4 3300053092 Ga0500583_0072091 Ga0500583_0072091_159_902 196
5 3300044842 Ga0466957_0465350 Ga0466957_0465350_12_650 199
6 3300048914 Ga0496111_0435535 Ga0496111_0435535_16_654 199
7 3300053084 Ga0495595_0262335 Ga0495595_0262335_201_839 199
8 3300009147 Ga0114129_10164372 Ga0114129_101643722 200
9 3300005471 Ga0070698_100763711 Ga0070698_1007637111 201
10 3300005563 Ga0068855_100039698 Ga0068855_1000396985 205
11 3300005614 Ga0068856_100373363 Ga0068856_1003733632 205
12 3300005616 Ga0068852_100019271 Ga0068852_1000192712 205
13 3300025912 Ga0207707_10086981 Ga0207707_100869812 205
14 3300025917 Ga0207660_10011533 Ga0207660_100115335 205
15 3300025919 Ga0207657_10229062 Ga0207657_102290622 205
16 3300025921 Ga0207652_10005554 Ga0207652_100055547 205
17 3300025932 Ga0207690_10188121 Ga0207690_101881211 205
18 3300025949 Ga0207667_10081395 Ga0207667_100813952 205
19 3300026078 Ga0207702_10320213 Ga0207702_103202132 205
20 3300050513 nmdc:mga0rr50_245555_c1 nmdc:mga0rr50_245555_c1_321_983 207
21 3300046463 Ga0495653_0131431 Ga0495653_0131431_10_684 211
22 3300013102 Ga0157371_10185937 Ga0157371_101859372 215
23 3300039438 Ga0436360_1088500 Ga0436360_1088500_297_1058 215
24 3300025294 Ga0209025_1064609 Ga0209025_10646092 216
25 3300044694 Ga0466963_0202410 Ga0466963_0202410_252_1025 217
26 3300044842 Ga0466957_0397964 Ga0466957_0397964_13_786 217
27 3300035725 Ga0373947_0154270 Ga0373947_0154270_447_1220 219
28 3300046559 Ga0495667_0055862 Ga0495667_0055862_684_1385 220
29 3300048088 Ga0495602_0122941 Ga0495602_0122941_1181_1882 220
30 3300053077 Ga0495601_0013139 Ga0495601_0013139_2235_2936 220
31 3300053084 Ga0495595_0004309 Ga0495595_0004309_1699_2400 220
32 3300053085 Ga0495619_0006479 Ga0495619_0006479_2299_3000 220
33 3300046520 Ga0495637_0039494 Ga0495637_0039494_88_813 221
34 3300050489 nmdc:mga03683_91194_c1 nmdc:mga03683_91194_c1_597_1301 222
35 3300031548 Ga0307408_100269183 Ga0307408_1002691832 223
36 3300031852 Ga0307410_10023949 Ga0307410_100239493 223
37 3300037312 Ga0395899_0288058 Ga0395899_0288058_123_896 223
38 3300038443 Ga0395901_0018310 Ga0395901_0018310_2861_3634 223
39 3300048929 Ga0496126_0140544 Ga0496126_0140544_594_1328 223
40 3300005440 Ga0070705_100037208 Ga0070705_1000372083 225
41 3300005545 Ga0070695_100012768 Ga0070695_1000127682 225
42 3300042876 Ga0451577_0053982 Ga0451577_0053982_2343_3104 225
43 3300033180 Ga0307510_10061301 Ga0307510_100613014 226
44 3300038705 Ga0237819_05741 Ga0237819_05741_114_860 227
45 3300048088 Ga0495602_0555774 Ga0495602_0555774_14_736 227
46 3300049575 Ga0501039_0008884 Ga0501039_0008884_2898_3620 227
47 3300049743 Ga0501081_0165634 Ga0501081_0165634_431_1153 227
48 3300054114 Ga0501084_0063201 Ga0501084_0063201_1073_1795 227
49 3300061734 Ga0530510_0227391 Ga0530510_0227391_392_1114 227
50 3300037312 Ga0395899_0006840 Ga0395899_0006840_734_1459 228
51 3300037418 Ga0395900_0001715 Ga0395900_0001715_13243_13968 228
52 3300037466 Ga0395898_0025971 Ga0395898_0025971_4206_4931 228
53 3300038443 Ga0395901_0011685 Ga0395901_0011685_942_1667 228
54 3300038443 Ga0395901_0027824 Ga0395901_0027824_4800_5525 228
55 3300046501 Ga0495607_0000677 Ga0495607_0000677_1749_2498 228
56 3300009011 Ga0105251_10074583 Ga0105251_100745832 229
57 3300035695 Ga0373927_0147745 Ga0373927_0147745_22_750 229
58 3300046452 Ga0495617_007487 Ga0495617_007487_567_1316 229
59 3300046457 Ga0495590_0081782 Ga0495590_0081782_365_1114 229
60 3300046458 Ga0495591_009879 Ga0495591_009879_2926_3675 229
61 3300046471 Ga0495650_0000316 Ga0495650_0000316_2741_3490 229
62 3300046471 Ga0495650_0006039 Ga0495650_0006039_4480_5229 229
63 3300046474 Ga0495605_0000079 Ga0495605_0000079_118838_119587 229
64 3300046491 Ga0495584_0217310 Ga0495584_0217310_90_839 229
65 3300046492 Ga0495585_0076329 Ga0495585_0076329_631_1380 229
66 3300046501 Ga0495607_0054940 Ga0495607_0054940_1146_1895 229
67 3300046506 Ga0495583_0000591 Ga0495583_0000591_37667_38416 229
68 3300046506 Ga0495583_0001018 Ga0495583_0001018_7142_7891 229
69 3300046506 Ga0495583_0001437 Ga0495583_0001437_23147_23896 229
70 3300046506 Ga0495583_0001702 Ga0495583_0001702_17856_18605 229
71 3300046507 Ga0495606_0000022 Ga0495606_0000022_101067_101816 229
72 3300046512 Ga0495610_0006127 Ga0495610_0006127_775_1524 229
73 3300046512 Ga0495610_0015167 Ga0495610_0015167_319_1068 229
74 3300046513 Ga0495616_0014258 Ga0495616_0014258_2718_3467 229
75 3300046515 Ga0495620_0156792 Ga0495620_0156792_41_790 229
76 3300046519 Ga0495632_0000651 Ga0495632_0000651_7169_7918 229
77 3300046519 Ga0495632_0075360 Ga0495632_0075360_555_1304 229
78 3300046520 Ga0495637_0012666 Ga0495637_0012666_857_1606 229
79 3300046522 Ga0495643_0045590 Ga0495643_0045590_268_1017 229
80 3300046530 Ga0495654_0012882 Ga0495654_0012882_1822_2571 229
81 3300046538 Ga0495609_0000168 Ga0495609_0000168_5447_6196 229
82 3300046538 Ga0495609_0000692 Ga0495609_0000692_7414_8163 229
83 3300046542 Ga0495597_0069377 Ga0495597_0069377_345_1094 229
84 3300046557 Ga0495622_0006296 Ga0495622_0006296_2430_3179 229
85 3300046660 Ga0495625_0000004 Ga0495625_0000004_476388_477137 229
86 3300046665 Ga0495661_0000006 Ga0495661_0000006_241526_242275 229
87 3300046665 Ga0495661_0000241 Ga0495661_0000241_7402_8151 229
88 3300046665 Ga0495661_0008380 Ga0495661_0008380_3652_4401 229
89 3300046691 Ga0495670_0019266 Ga0495670_0019266_37_786 229
90 3300046694 Ga0495649_0008246 Ga0495649_0008246_2060_2809 229
91 3300046810 Ga0495660_0010455 Ga0495660_0010455_2198_2947 229
92 3300046810 Ga0495660_0139427 Ga0495660_0139427_384_1133 229
93 3300047321 Ga0495676_0000004 Ga0495676_0000004_35934_36683 229
94 3300047446 Ga0495679_000015 Ga0495679_000015_165123_165872 229
95 3300047469 Ga0495673_0007288 Ga0495673_0007288_3004_3753 229
96 3300047469 Ga0495673_0092395 Ga0495673_0092395_13_762 229
97 3300047470 Ga0495681_0003055 Ga0495681_0003055_7355_8104 229
98 3300047472 Ga0495686_0076449 Ga0495686_0076449_17_766 229
99 3300048091 Ga0495626_0000012 Ga0495626_0000012_196149_196898 229
100 3300049459 Ga0495678_019718 Ga0495678_019718_1812_2561 229
101 3300053142 Ga0500577_0025913 Ga0500577_0025913_660_1409 229
102 3300026118 Ga0207675_100551450 Ga0207675_1005514503 230
103 3300032005 Ga0307411_10035047 Ga0307411_100350473 230
104 3300044712 Ga0453684_0742425 Ga0453684_0742425_123_875 230
105 iso_pu_bacteria 2643221736 2644743321 232
106 iso_pu_bacteria 2818991467 2819718464 232
107 iso_pu_bacteria 2841760612 2841764803 232
108 iso_pu_bacteria 2844104063 2844107749 232
109 iso_pu_bacteria 2851182111 2851183119 232
110 iso_pu_bacteria 2851246043 2851249855 232
111 iso_pu_bacteria 8057529695 8057533166 232
112 3300046460 Ga0495638_0019577 Ga0495638_0019577_2637_3380 234
113 3300005293 Ga0065715_10316452 Ga0065715_103164522 235
114 3300005328 Ga0070676_10077890 Ga0070676_100778901 235
115 3300005335 Ga0070666_10034384 Ga0070666_100343843 235
116 3300005340 Ga0070689_100229193 Ga0070689_1002291932 235
117 3300005343 Ga0070687_100304305 Ga0070687_1003043052 235
118 3300005355 Ga0070671_100074007 Ga0070671_1000740073 235
119 3300005364 Ga0070673_100441449 Ga0070673_1004414491 235
120 3300005365 Ga0070688_100060508 Ga0070688_1000605082 235
121 3300005438 Ga0070701_10173393 Ga0070701_101733932 235
122 3300005466 Ga0070685_10185710 Ga0070685_101857102 235
123 3300005548 Ga0070665_100735383 Ga0070665_1007353832 235
124 3300005577 Ga0068857_100120931 Ga0068857_1001209313 235
125 3300005618 Ga0068864_100070957 Ga0068864_1000709572 235
126 3300005841 Ga0068863_100100898 Ga0068863_1001008983 235
127 3300006186 Ga0075369_10122500 Ga0075369_101225002 235
128 3300009148 Ga0105243_10261367 Ga0105243_102613672 235
129 3300011119 Ga0105246_10203689 Ga0105246_102036892 235
130 3300014326 Ga0157380_10090841 Ga0157380_100908413 235
131 3300025294 Ga0209025_1016636 Ga0209025_10166364 235
132 3300025893 Ga0207682_10000821 Ga0207682_1000082110 235
133 3300025900 Ga0207710_10071666 Ga0207710_100716662 235
134 3300025901 Ga0207688_10014612 Ga0207688_100146125 235
135 3300025903 Ga0207680_10312598 Ga0207680_103125982 235
136 3300025907 Ga0207645_10015201 Ga0207645_100152013 235
137 3300025918 Ga0207662_10024536 Ga0207662_100245363 235
138 3300025918 Ga0207662_10385950 Ga0207662_103859502 235
139 3300025924 Ga0207694_10275017 Ga0207694_102750172 235
140 3300025925 Ga0207650_10208954 Ga0207650_102089542 235
141 3300025925 Ga0207650_10283597 Ga0207650_102835972 235
142 3300025931 Ga0207644_10210070 Ga0207644_102100702 235
143 3300025937 Ga0207669_10470777 Ga0207669_104707772 235
144 3300025940 Ga0207691_10016641 Ga0207691_100166414 235
145 3300025972 Ga0207668_10260143 Ga0207668_102601432 235
146 3300026067 Ga0207678_10287857 Ga0207678_102878572 235
147 3300026075 Ga0207708_10229841 Ga0207708_102298412 235
148 3300026089 Ga0207648_10122467 Ga0207648_101224673 235
149 3300026095 Ga0207676_10123624 Ga0207676_101236243 235
150 3300026116 Ga0207674_10153474 Ga0207674_101534743 235
151 3300026118 Ga0207675_100211187 Ga0207675_1002111872 235
152 3300026121 Ga0207683_10022537 Ga0207683_100225373 235
153 3300046474 Ga0495605_0035176 Ga0495605_0035176_326_1075 235
154 3300046537 Ga0495598_0004211 Ga0495598_0004211_697_1446 235
155 3300046680 Ga0495646_0324684 Ga0495646_0324684_10_765 235
156 3300049823 Ga0501044_0432487 Ga0501044_0432487_394_1152 235
157 3300050489 nmdc:mga03683_178336_c1 nmdc:mga03683_178336_c1_91_840 235
158 3300050516 nmdc:mga0sz30_40779_c1 nmdc:mga0sz30_40779_c1_140_886 235
159 3300053084 Ga0495595_0015894 Ga0495595_0015894_2441_3196 235
160 3300002987 JGI25159J45721_1006338 JGI25159J45721_10063383 236
161 3300005262 Ga0065165_1000229 Ga0065165_100022932 236
162 3300005293 Ga0065715_10305770 Ga0065715_103057702 236
163 3300005327 Ga0070658_10024543 Ga0070658_100245432 236
164 3300005327 Ga0070658_10032181 Ga0070658_100321813 236
165 3300005331 Ga0070670_100183358 Ga0070670_1001833582 236
166 3300005336 Ga0070680_100001887 Ga0070680_1000018879 236
167 3300005336 Ga0070680_100138126 Ga0070680_1001381262 236
168 3300005336 Ga0070680_100147308 Ga0070680_1001473082 236
169 3300005340 Ga0070689_100184834 Ga0070689_1001848342 236
170 3300005343 Ga0070687_100061864 Ga0070687_1000618642 236
171 3300005354 Ga0070675_100240838 Ga0070675_1002408382 236
172 3300005354 Ga0070675_100306057 Ga0070675_1003060572 236
173 3300005366 Ga0070659_100052566 Ga0070659_1000525662 236
174 3300005436 Ga0070713_100126140 Ga0070713_1001261403 236
175 3300005439 Ga0070711_100076780 Ga0070711_1000767801 236
176 3300005457 Ga0070662_100222956 Ga0070662_1002229562 236
177 3300005458 Ga0070681_10072303 Ga0070681_100723032 236
178 3300005458 Ga0070681_10326884 Ga0070681_103268842 236
179 3300005468 Ga0070707_100566786 Ga0070707_1005667862 236
180 3300005471 Ga0070698_100175772 Ga0070698_1001757721 236
181 3300005530 Ga0070679_100005746 Ga0070679_1000057465 236
182 3300005539 Ga0068853_100185351 Ga0068853_1001853512 236
183 3300005539 Ga0068853_100722379 Ga0068853_1007223791 236
184 3300005563 Ga0068855_100015541 Ga0068855_1000155412 236
185 3300005614 Ga0068856_100072059 Ga0068856_1000720592 236
186 3300005616 Ga0068852_100104491 Ga0068852_1001044913 236
187 3300005844 Ga0068862_100600066 Ga0068862_1006000662 236
188 3300005981 Ga0081538_10029189 Ga0081538_100291892 236
189 3300005985 Ga0081539_10034076 Ga0081539_100340764 236
190 3300006028 Ga0070717_10242830 Ga0070717_102428302 236
191 3300006028 Ga0070717_10434143 Ga0070717_104341432 236
192 3300006058 Ga0075432_10030816 Ga0075432_100308163 236
193 3300006177 Ga0075362_10001180 Ga0075362_100011803 236
194 3300006178 Ga0075367_10007683 Ga0075367_100076835 236
195 3300006195 Ga0075366_10001237 Ga0075366_100012375 236
196 3300006195 Ga0075366_10038855 Ga0075366_100388552 236
197 3300006844 Ga0075428_100148021 Ga0075428_1001480213 236
198 3300006871 Ga0075434_100025900 Ga0075434_1000259004 236
199 3300006871 Ga0075434_100339292 Ga0075434_1003392921 236
200 3300006914 Ga0075436_100094037 Ga0075436_1000940373 236
201 3300009094 Ga0111539_10036258 Ga0111539_100362585 236
202 3300009094 Ga0111539_10233941 Ga0111539_102339412 236
203 3300009094 Ga0111539_10275051 Ga0111539_102750513 236
204 3300009098 Ga0105245_10570874 Ga0105245_105708741 236
205 3300009177 Ga0105248_10076366 Ga0105248_100763664 236
206 3300009551 Ga0105238_10096406 Ga0105238_100964061 236
207 3300009553 Ga0105249_10912614 Ga0105249_109126142 236
208 3300013100 Ga0157373_10078407 Ga0157373_100784073 236
209 3300013102 Ga0157371_10083441 Ga0157371_100834413 236
210 3300013104 Ga0157370_10055398 Ga0157370_100553983 236
211 3300013104 Ga0157370_10187709 Ga0157370_101877092 236
212 3300013105 Ga0157369_10627700 Ga0157369_106277002 236
213 3300013306 Ga0163162_10330105 Ga0163162_103301052 236
214 3300013306 Ga0163162_10808002 Ga0163162_108080022 236
215 3300013307 Ga0157372_10197053 Ga0157372_101970532 236
216 3300014968 Ga0157379_10556912 Ga0157379_105569122 236
217 3300021441 Ga0213871_10064393 Ga0213871_100643932 236
218 3300025284 Ga0209130_1000045 Ga0209130_100004513 236
219 3300025302 Ga0207426_1010082 Ga0207426_10100822 236
220 3300025901 Ga0207688_10219241 Ga0207688_102192411 236
221 3300025909 Ga0207705_10004267 Ga0207705_100042672 236
222 3300025909 Ga0207705_10024644 Ga0207705_100246443 236
223 3300025912 Ga0207707_10489654 Ga0207707_104896542 236
224 3300025916 Ga0207663_10132452 Ga0207663_101324521 236
225 3300025917 Ga0207660_10119428 Ga0207660_101194282 236
226 3300025921 Ga0207652_10719950 Ga0207652_107199501 236
227 3300025922 Ga0207646_10141679 Ga0207646_101416792 236
228 3300025927 Ga0207687_10151150 Ga0207687_101511501 236
229 3300025928 Ga0207700_10111143 Ga0207700_101111432 236
230 3300025928 Ga0207700_10282626 Ga0207700_102826262 236
231 3300025929 Ga0207664_10046298 Ga0207664_100462983 236
232 3300025940 Ga0207691_10205553 Ga0207691_102055532 236
233 3300025942 Ga0207689_10398487 Ga0207689_103984872 236
234 3300025949 Ga0207667_10002456 Ga0207667_100024562 236
235 3300026078 Ga0207702_10075969 Ga0207702_100759693 236
236 3300026142 Ga0207698_10078135 Ga0207698_100781353 236
237 3300027907 Ga0207428_10077328 Ga0207428_100773283 236
238 3300028381 Ga0268264_10267827 Ga0268264_102678272 236
239 3300031241 Ga0265325_10008700 Ga0265325_100087003 236
240 3300031249 Ga0265339_10001774 Ga0265339_1000177414 236
241 3300031344 Ga0265316_10087898 Ga0265316_100878983 236
242 3300031595 Ga0265313_10005248 Ga0265313_100052482 236
243 3300032004 Ga0307414_10034218 Ga0307414_100342182 236
244 3300035118 Ga0373954_0041799 Ga0373954_0041799_594_1361 236
245 3300035170 Ga0373943_0128162 Ga0373943_0128162_351_1124 236
246 3300035410 Ga0373924_0057131 Ga0373924_0057131_190_957 236
247 3300035692 Ga0373935_0063565 Ga0373935_0063565_174_941 236
248 3300035725 Ga0373947_0114381 Ga0373947_0114381_380_1147 236
249 3300036401 Ga0373937_0188758 Ga0373937_0188758_954_1721 236
250 3300037068 Ga0373925_0436438 Ga0373925_0436438_64_831 236
251 3300037466 Ga0395898_0026356 Ga0395898_0026356_2412_3185 236
252 3300037471 Ga0395905_0773437 Ga0395905_0773437_78_839 236
253 3300041408 Ga0439453_0023547 Ga0439453_0023547_117_869 236
254 3300042876 Ga0451577_0214926 Ga0451577_0214926_646_1407 236
255 3300044712 Ga0453684_0548376 Ga0453684_0548376_427_1188 236
256 3300046459 Ga0495629_0296885 Ga0495629_0296885_325_1092 236
257 3300046460 Ga0495638_0018079 Ga0495638_0018079_2295_3047 236
258 3300046473 Ga0495582_0028739 Ga0495582_0028739_830_1597 236
259 3300046525 Ga0495663_0107352 Ga0495663_0107352_65_817 236
260 3300046660 Ga0495625_0056135 Ga0495625_0056135_1425_2183 236
261 3300046664 Ga0495659_0146435 Ga0495659_0146435_54_806 236
262 3300046680 Ga0495646_0227222 Ga0495646_0227222_40_807 236
263 3300047320 Ga0495672_0089047 Ga0495672_0089047_70_822 236
264 3300047447 Ga0495685_091410 Ga0495685_091410_55_807 236
265 3300048908 Ga0496105_0012003 Ga0496105_0012003_1256_2008 236
266 3300048915 Ga0496112_0214089 Ga0496112_0214089_19_774 236
267 3300049568 Ga0501031_0047379 Ga0501031_0047379_255_1004 236
268 3300049571 Ga0501034_0057229 Ga0501034_0057229_930_1679 236
269 3300049573 Ga0501037_0105123 Ga0501037_0105123_508_1257 236
270 3300049574 Ga0501038_0049358 Ga0501038_0049358_664_1413 236
271 3300049574 Ga0501038_0542404 Ga0501038_0542404_103_861 236
272 3300049575 Ga0501039_0278588 Ga0501039_0278588_173_961 236
273 3300049575 Ga0501039_0541181 Ga0501039_0541181_129_878 236
274 3300049581 Ga0501047_0015335 Ga0501047_0015335_342_1091 236
275 3300049581 Ga0501047_0298199 Ga0501047_0298199_555_1322 236
276 3300049582 Ga0501048_0485473 Ga0501048_0485473_97_861 236
277 3300049586 Ga0501070_0089318 Ga0501070_0089318_351_1118 236
278 3300049588 Ga0501072_0058147 Ga0501072_0058147_929_1693 236
279 3300049588 Ga0501072_0180018 Ga0501072_0180018_350_1099 236
280 3300049591 Ga0501075_0467344 Ga0501075_0467344_111_869 236
281 3300049741 Ga0501079_0159569 Ga0501079_0159569_854_1618 236
282 3300049743 Ga0501081_0093534 Ga0501081_0093534_630_1388 236
283 3300049743 Ga0501081_0181145 Ga0501081_0181145_500_1264 236
284 3300049744 Ga0501083_0030354 Ga0501083_0030354_2665_3414 236
285 3300049744 Ga0501083_0069976 Ga0501083_0069976_485_1273 236
286 3300049744 Ga0501083_0070219 Ga0501083_0070219_1247_1999 236
287 3300049824 Ga0501045_0335645 Ga0501045_0335645_148_912 236
288 3300050489 nmdc:mga03683_11573_c1 nmdc:mga03683_11573_c1_1438_2190 236
289 3300050491 nmdc:mga00v17_17852_c1 nmdc:mga00v17_17852_c1_3225_3977 236
290 3300050493 nmdc:mga0k408_1584_c1 nmdc:mga0k408_1584_c1_1756_2505 236
291 3300050493 nmdc:mga0k408_3072_c1 nmdc:mga0k408_3072_c1_7188_7940 236
292 3300050494 nmdc:mga06z11_36690_c1 nmdc:mga06z11_36690_c1_642_1394 236
293 3300050496 nmdc:mga07m45_142701_c1 nmdc:mga07m45_142701_c1_186_938 236
294 3300050511 nmdc:mga08y16_164094_c1 nmdc:mga08y16_164094_c1_724_1476 236
295 3300050511 nmdc:mga08y16_350105_c1 nmdc:mga08y16_350105_c1_695_1447 236
296 3300050512 nmdc:mga0n895_317152_c1 nmdc:mga0n895_317152_c1_139_906 236
297 3300053077 Ga0495601_0004965 Ga0495601_0004965_4579_5331 236
298 3300053098 Ga0500650_0117148 Ga0500650_0117148_145_894 236
299 3300053131 Ga0500652_107319 Ga0500652_107319_210_959 236
300 3300053142 Ga0500577_0087450 Ga0500577_0087450_64_816 236
301 3300053151 Ga0500604_0064830 Ga0500604_0064830_356_1108 236
302 3300054114 Ga0501084_0186063 Ga0501084_0186063_809_1567 236
303 3300054114 Ga0501084_0371783 Ga0501084_0371783_197_961 236
304 3300060353 Ga0501082_0271420 Ga0501082_0271420_476_1240 236
305 3300060353 Ga0501082_0394098 Ga0501082_0394098_68_835 236
306 3300061734 Ga0530510_0076942 Ga0530510_0076942_671_1429 236

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

77

257

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ahc-assembly1.cif.gz_B opua apo inward-facing 0.7396 44 230
7ahd-assembly1.cif.gz_B opua (e190q) occluded 0.7243 44 230
7ahd-assembly1.cif.gz_A opua (e190q) occluded 0.7132 44 230
3dhw-assembly2.cif.gz_E crystal structure of methionine importer metni 0.6479 56 226
3dhw-assembly1.cif.gz_B crystal structure of methionine importer metni 0.6467 50 226
ID Description Score Start End Superfamily
af_P75851_53_247_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7809 47 226 1.10.3720.10
af_Q47539_71_268_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7616 54 231 1.10.3720.10
af_Q2G088_14_207_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.743 50 226 1.10.3720.10
af_P14176_140_330_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7413 53 232 1.10.3720.10
af_Q2G1I4_54_251_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7384 54 235 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A7G2IJA1-F1-model_v4 Alkanesulfonates ABC transporter ATP-binding protein / Sulfonate ABC transporter, ATP-binding subunit SsuB 0.8309 1 203 GO:0005524
GO:0005886
GO:0016887
GO:0055085
AF-A0A4Q7Y480-F1-model_v4 NitT/TauT family transport system permease protein 0.8188 3 226 GO:0005886
GO:0055085
AF-A0A432TQM8-F1-model_v4 ABC transporter ATP-binding protein 0.8183 10 226 GO:0005524
GO:0005886
GO:0016887
GO:0055085
AF-A0A6F8YEI0-F1-model_v4 ABC transporter permease 0.8165 2 226 GO:0005886
GO:0055085
AF-A0A2W4MNX5-F1-model_v4 deleted 0.812 12 208

Feature Viewer

pLDDT pTM Quality
83.36 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map