F398706
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 306 | 224 | 299 | 245 |
Family's Representative Sequence
| Representative Sequence | 3300025929|Ga0207664_10046298|Ga0207664_100462983 |
| Length | 258 |
| Sequence | MPAQRHWISKVAIARALVVALAFVLLELLCRTGVIGRVTMIPPSEMVAALFDILRTGQFNSDIAFTCVNTISATALAIAAGFALGAGLHALPRLRRVIDPLLSAYYAVPTFVLFYPLLIVVFGAGRTALVVIGAMFGIVAMIINTVLGLDHVPPAVGRTGHVLKLDGLRQLVLIRLPAAAPHLVSGIKLAVAYSVIGIVAGEFILATRGIGKRVAFAYDNFDNKTMYGLLLLLLIAVALVNGCLSAWEKQLHRRFGQR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 2 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 3 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 4 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 5 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 6 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 7 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 8 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 36 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 37 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 38 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 39 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 40 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 41 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 42 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 43 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 44 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 46 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 47 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 48 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 49 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 50 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 51 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 52 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 53 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 71 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 109 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 111 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 112 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 113 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 114 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 115 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 116 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 117 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 118 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 119 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 120 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 121 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 122 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 123 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 124 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 125 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 126 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 127 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 128 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 129 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 130 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 131 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 132 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 133 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 134 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 135 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 136 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 137 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 138 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 139 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 183 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 184 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 185 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 186 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 188 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 192 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 194 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 196 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 203 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 204 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 205 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 206 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 207 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 208 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 209 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 210 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 211 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 213 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 216 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 217 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 218 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 219 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 220 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 221 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 224 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.71 |
| Metatranscriptomes | 0 |
| Isolates | 2.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.15 |
| Nodule | 1.63 |
| Rhizoplane | 0.98 |
| Rhizosphere | 86.6 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.63 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25159J45721_1006338 | 3300002987 | Bacteria | 3554 |
| 2 | Ga0065165_1000229 | 3300005262 | Bacteria | 98699 |
| 3 | Ga0065715_10305770 | 3300005293 | Bacteria | 1031 |
| 4 | Ga0065715_10316452 | 3300005293 | Bacteria | 1000 |
| 5 | Ga0070658_10024543 | 3300005327 | Bacteria | 4836 |
| 6 | Ga0070658_10032181 | 3300005327 | Bacteria | 4217 |
| 7 | Ga0070676_10077890 | 3300005328 | Bacteria | 2004 |
| 8 | Ga0070670_100183358 | 3300005331 | Bacteria | 1817 |
| 9 | Ga0070666_10034384 | 3300005335 | Bacteria | 3358 |
| 10 | Ga0070680_100001887 | 3300005336 | Bacteria | 15378 |
| 11 | Ga0070680_100138126 | 3300005336 | Bacteria | 2043 |
| 12 | Ga0070680_100147308 | 3300005336 | Unclassified | 1976 |
| 13 | Ga0070689_100184834 | 3300005340 | Bacteria | 1694 |
| 14 | Ga0070689_100229193 | 3300005340 | Bacteria | 1526 |
| 15 | Ga0070687_100061864 | 3300005343 | Bacteria | 1980 |
| 16 | Ga0070687_100304305 | 3300005343 | Bacteria | 1013 |
| 17 | Ga0070675_100240838 | 3300005354 | Bacteria | 1581 |
| 18 | Ga0070675_100306057 | 3300005354 | Bacteria | 1401 |
| 19 | Ga0070671_100074007 | 3300005355 | Bacteria | 2846 |
| 20 | Ga0070673_100441449 | 3300005364 | Bacteria | 1169 |
| 21 | Ga0070688_100060508 | 3300005365 | Bacteria | 2392 |
| 22 | Ga0070659_100052566 | 3300005366 | Unclassified | 3205 |
| 23 | Ga0070713_100126140 | 3300005436 | Unclassified | 2252 |
| 24 | Ga0070701_10173393 | 3300005438 | Bacteria | 1257 |
| 25 | Ga0070711_100076780 | 3300005439 | Bacteria | 2369 |
| 26 | Ga0070705_100037208 | 3300005440 | Bacteria | 2743 |
| 27 | Ga0070662_100222956 | 3300005457 | Bacteria | 1505 |
| 28 | Ga0070681_10072303 | 3300005458 | Bacteria | 3412 |
| 29 | Ga0070681_10326884 | 3300005458 | Bacteria | 1443 |
| 30 | Ga0070685_10185710 | 3300005466 | Bacteria | 1341 |
| 31 | Ga0070707_100566786 | 3300005468 | Bacteria | 1098 |
| 32 | Ga0070698_100175772 | 3300005471 | Bacteria | 2081 |
| 33 | Ga0070698_100763711 | 3300005471 | Bacteria | 910 |
| 34 | Ga0070679_100005746 | 3300005530 | Bacteria | 11508 |
| 35 | Ga0068853_100185351 | 3300005539 | Bacteria | 1889 |
| 36 | Ga0068853_100722379 | 3300005539 | Bacteria | 951 |
| 37 | Ga0070695_100012768 | 3300005545 | Bacteria | 5042 |
| 38 | Ga0070665_100735383 | 3300005548 | Bacteria | 1000 |
| 39 | Ga0068855_100015541 | 3300005563 | Bacteria | 9164 |
| 40 | Ga0068855_100039698 | 3300005563 | Bacteria | 5587 |
| 41 | Ga0068857_100120931 | 3300005577 | Bacteria | 2357 |
| 42 | Ga0068856_100072059 | 3300005614 | Bacteria | 3421 |
| 43 | Ga0068856_100373363 | 3300005614 | Unclassified | 1445 |
| 44 | Ga0068852_100019271 | 3300005616 | Bacteria | 5395 |
| 45 | Ga0068852_100104491 | 3300005616 | Bacteria | 2564 |
| 46 | Ga0068864_100070957 | 3300005618 | Bacteria | 3032 |
| 47 | Ga0068863_100100898 | 3300005841 | Bacteria | 2743 |
| 48 | Ga0068862_100600066 | 3300005844 | Bacteria | 1057 |
| 49 | Ga0081538_10029189 | 3300005981 | Bacteria | 3775 |
| 50 | Ga0081539_10034076 | 3300005985 | Bacteria | 3088 |
| 51 | Ga0070717_10242830 | 3300006028 | Bacteria | 1589 |
| 52 | Ga0070717_10434143 | 3300006028 | Bacteria | 1182 |
| 53 | Ga0075432_10030816 | 3300006058 | Bacteria | 1855 |
| 54 | Ga0075362_10001180 | 3300006177 | Bacteria | 8185 |
| 55 | Ga0075367_10007683 | 3300006178 | Bacteria | 5538 |
| 56 | Ga0075369_10122500 | 3300006186 | Bacteria | 1178 |
| 57 | Ga0075366_10001237 | 3300006195 | Bacteria | 12669 |
| 58 | Ga0075366_10038855 | 3300006195 | Bacteria | 2811 |
| 59 | Ga0075428_100148021 | 3300006844 | Bacteria | 2552 |
| 60 | Ga0075434_100025900 | 3300006871 | Bacteria | 5741 |
| 61 | Ga0075434_100339292 | 3300006871 | Bacteria | 1523 |
| 62 | Ga0075436_100094037 | 3300006914 | Bacteria | 2085 |
| 63 | Ga0105251_10074583 | 3300009011 | Bacteria | 1575 |
| 64 | Ga0111539_10036258 | 3300009094 | Bacteria | 5965 |
| 65 | Ga0111539_10233941 | 3300009094 | Bacteria | 2139 |
| 66 | Ga0111539_10275051 | 3300009094 | Bacteria | 1960 |
| 67 | Ga0105245_10570874 | 3300009098 | Bacteria | 1155 |
| 68 | Ga0114129_10164372 | 3300009147 | Bacteria | 3030 |
| 69 | Ga0105243_10261367 | 3300009148 | Bacteria | 1550 |
| 70 | Ga0105248_10076366 | 3300009177 | Bacteria | 3766 |
| 71 | Ga0105238_10096406 | 3300009551 | Bacteria | 2944 |
| 72 | Ga0105249_10912614 | 3300009553 | Bacteria | 945 |
| 73 | Ga0105246_10203689 | 3300011119 | Bacteria | 1540 |
| 74 | Ga0157373_10078407 | 3300013100 | Bacteria | 2329 |
| 75 | Ga0157371_10083441 | 3300013102 | Bacteria | 2263 |
| 76 | Ga0157371_10185937 | 3300013102 | Bacteria | 1487 |
| 77 | Ga0157370_10055398 | 3300013104 | Bacteria | 3778 |
| 78 | Ga0157370_10187709 | 3300013104 | Unclassified | 1919 |
| 79 | Ga0157369_10627700 | 3300013105 | Bacteria | 1108 |
| 80 | Ga0163162_10330105 | 3300013306 | Bacteria | 1658 |
| 81 | Ga0163162_10808002 | 3300013306 | Bacteria | 1055 |
| 82 | Ga0157372_10197053 | 3300013307 | Bacteria | 2333 |
| 83 | Ga0157380_10090841 | 3300014326 | Bacteria | 2520 |
| 84 | Ga0157379_10556912 | 3300014968 | Bacteria | 1067 |
| 85 | Ga0213871_10064393 | 3300021441 | Bacteria | 1026 |
| 86 | Ga0209130_1000045 | 3300025284 | Bacteria | 240278 |
| 87 | Ga0209025_1016636 | 3300025294 | Bacteria | 4317 |
| 88 | Ga0209025_1064609 | 3300025294 | Bacteria | 1343 |
| 89 | Ga0207426_1010082 | 3300025302 | Bacteria | 3693 |
| 90 | Ga0207682_10000821 | 3300025893 | Bacteria | 14352 |
| 91 | Ga0207710_10071666 | 3300025900 | Bacteria | 1590 |
| 92 | Ga0207688_10014612 | 3300025901 | Bacteria | 4265 |
| 93 | Ga0207688_10219241 | 3300025901 | Bacteria | 1145 |
| 94 | Ga0207680_10312598 | 3300025903 | Bacteria | 1097 |
| 95 | Ga0207645_10015201 | 3300025907 | Bacteria | 5124 |
| 96 | Ga0207705_10004267 | 3300025909 | Bacteria | 10827 |
| 97 | Ga0207705_10024644 | 3300025909 | Bacteria | 4293 |
| 98 | Ga0207707_10086981 | 3300025912 | Bacteria | 2731 |
| 99 | Ga0207707_10489654 | 3300025912 | Bacteria | 1050 |
| 100 | Ga0207663_10132452 | 3300025916 | Unclassified | 1724 |
| 101 | Ga0207660_10011533 | 3300025917 | Bacteria | 5759 |
| 102 | Ga0207660_10119428 | 3300025917 | Bacteria | 1995 |
| 103 | Ga0207662_10024536 | 3300025918 | Bacteria | 3469 |
| 104 | Ga0207662_10385950 | 3300025918 | Bacteria | 947 |
| 105 | Ga0207657_10229062 | 3300025919 | Unclassified | 1486 |
| 106 | Ga0207652_10005554 | 3300025921 | Bacteria | 10221 |
| 107 | Ga0207652_10719950 | 3300025921 | Bacteria | 890 |
| 108 | Ga0207646_10141679 | 3300025922 | Bacteria | 2166 |
| 109 | Ga0207694_10275017 | 3300025924 | Bacteria | 1382 |
| 110 | Ga0207650_10208954 | 3300025925 | Bacteria | 1567 |
| 111 | Ga0207650_10283597 | 3300025925 | Bacteria | 1349 |
| 112 | Ga0207687_10151150 | 3300025927 | Bacteria | 1772 |
| 113 | Ga0207700_10111143 | 3300025928 | Unclassified | 2205 |
| 114 | Ga0207700_10282626 | 3300025928 | Unclassified | 1428 |
| 115 | Ga0207664_10046298 | 3300025929 | Bacteria | 3413 |
| 116 | Ga0207644_10210070 | 3300025931 | Bacteria | 1539 |
| 117 | Ga0207690_10188121 | 3300025932 | Unclassified | 1560 |
| 118 | Ga0207669_10470777 | 3300025937 | Bacteria | 999 |
| 119 | Ga0207691_10016641 | 3300025940 | Bacteria | 6983 |
| 120 | Ga0207691_10205553 | 3300025940 | Bacteria | 1713 |
| 121 | Ga0207689_10398487 | 3300025942 | Bacteria | 1147 |
| 122 | Ga0207667_10002456 | 3300025949 | Bacteria | 23176 |
| 123 | Ga0207667_10081395 | 3300025949 | Bacteria | 3354 |
| 124 | Ga0207668_10260143 | 3300025972 | Bacteria | 1414 |
| 125 | Ga0207678_10287857 | 3300026067 | Bacteria | 1411 |
| 126 | Ga0207708_10229841 | 3300026075 | Bacteria | 1489 |
| 127 | Ga0207702_10075969 | 3300026078 | Bacteria | 2903 |
| 128 | Ga0207702_10320213 | 3300026078 | Unclassified | 1477 |
| 129 | Ga0207648_10122467 | 3300026089 | Bacteria | 2287 |
| 130 | Ga0207676_10123624 | 3300026095 | Bacteria | 2186 |
| 131 | Ga0207674_10153474 | 3300026116 | Bacteria | 2259 |
| 132 | Ga0207675_100211187 | 3300026118 | Bacteria | 1867 |
| 133 | Ga0207675_100551450 | 3300026118 | Bacteria | 1152 |
| 134 | Ga0207683_10022537 | 3300026121 | Bacteria | 5406 |
| 135 | Ga0207698_10078135 | 3300026142 | Bacteria | 2656 |
| 136 | Ga0207428_10077328 | 3300027907 | Bacteria | 2605 |
| 137 | Ga0268264_10267827 | 3300028381 | Bacteria | 1595 |
| 138 | Ga0265325_10008700 | 3300031241 | Bacteria | 5970 |
| 139 | Ga0265339_10001774 | 3300031249 | Bacteria | 15875 |
| 140 | Ga0265316_10087898 | 3300031344 | Bacteria | 2374 |
| 141 | Ga0307408_100269183 | 3300031548 | Bacteria | 1414 |
| 142 | Ga0265313_10005248 | 3300031595 | Bacteria | 9593 |
| 143 | Ga0307410_10023949 | 3300031852 | Bacteria | 3807 |
| 144 | Ga0307414_10034218 | 3300032004 | Bacteria | 3366 |
| 145 | Ga0307411_10035047 | 3300032005 | Bacteria | 3129 |
| 146 | Ga0307510_10061301 | 3300033180 | Bacteria | 3859 |
| 147 | Ga0373954_0041799 | 3300035118 | Bacteria | 2138 |
| 148 | Ga0373943_0128162 | 3300035170 | Bacteria | 1356 |
| 149 | Ga0373924_0057131 | 3300035410 | Bacteria | 1627 |
| 150 | Ga0373935_0063565 | 3300035692 | Bacteria | 2366 |
| 151 | Ga0373927_0147745 | 3300035695 | Bacteria | 1539 |
| 152 | Ga0373947_0114381 | 3300035725 | Bacteria | 1709 |
| 153 | Ga0373947_0154270 | 3300035725 | Bacteria | 1481 |
| 154 | Ga0373937_0188758 | 3300036401 | Bacteria | 1936 |
| 155 | Ga0373925_0436438 | 3300037068 | Bacteria | 1071 |
| 156 | Ga0395899_0006840 | 3300037312 | Bacteria | 8833 |
| 157 | Ga0395899_0288058 | 3300037312 | Bacteria | 1115 |
| 158 | Ga0395900_0001715 | 3300037418 | Bacteria | 25336 |
| 159 | Ga0395898_0025971 | 3300037466 | Bacteria | 5898 |
| 160 | Ga0395898_0026356 | 3300037466 | Bacteria | 5851 |
| 161 | Ga0395905_0773437 | 3300037471 | Bacteria | 863 |
| 162 | Ga0395901_0011685 | 3300038443 | Bacteria | 8897 |
| 163 | Ga0395901_0018310 | 3300038443 | Bacteria | 7151 |
| 164 | Ga0395901_0027824 | 3300038443 | Bacteria | 5814 |
| 165 | Ga0237819_05741 | 3300038705 | Bacteria | 1922 |
| 166 | Ga0436360_1088500 | 3300039438 | Bacteria | 1247 |
| 167 | Ga0439453_0023547 | 3300041408 | Bacteria | 1124 |
| 168 | Ga0451577_0053982 | 3300042876 | Bacteria | 3588 |
| 169 | Ga0451577_0214926 | 3300042876 | Bacteria | 1737 |
| 170 | Ga0466963_0202410 | 3300044694 | Bacteria | 1389 |
| 171 | Ga0453684_0548376 | 3300044712 | Bacteria | 1274 |
| 172 | Ga0453684_0742425 | 3300044712 | Bacteria | 1063 |
| 173 | Ga0466957_0397964 | 3300044842 | Bacteria | 942 |
| 174 | Ga0466957_0465350 | 3300044842 | Bacteria | 873 |
| 175 | Ga0495617_007487 | 3300046452 | Bacteria | 3788 |
| 176 | Ga0495590_0081782 | 3300046457 | Bacteria | 1138 |
| 177 | Ga0495591_009879 | 3300046458 | Bacteria | 3751 |
| 178 | Ga0495629_0296885 | 3300046459 | Unclassified | 1107 |
| 179 | Ga0495638_0018079 | 3300046460 | Bacteria | 4688 |
| 180 | Ga0495638_0019577 | 3300046460 | Bacteria | 4477 |
| 181 | Ga0495653_0131431 | 3300046463 | Bacteria | 1771 |
| 182 | Ga0495650_0000316 | 3300046471 | Bacteria | 86653 |
| 183 | Ga0495650_0006039 | 3300046471 | Bacteria | 7652 |
| 184 | Ga0495582_0028739 | 3300046473 | Bacteria | 3052 |
| 185 | Ga0495605_0000079 | 3300046474 | Bacteria | 126756 |
| 186 | Ga0495605_0035176 | 3300046474 | Bacteria | 2533 |
| 187 | Ga0495584_0217310 | 3300046491 | Bacteria | 972 |
| 188 | Ga0495585_0076329 | 3300046492 | Bacteria | 1820 |
| 189 | Ga0495607_0000677 | 3300046501 | Bacteria | 32941 |
| 190 | Ga0495607_0054940 | 3300046501 | Bacteria | 2292 |
| 191 | Ga0495583_0000591 | 3300046506 | Bacteria | 49672 |
| 192 | Ga0495583_0001018 | 3300046506 | Bacteria | 31946 |
| 193 | Ga0495583_0001437 | 3300046506 | Bacteria | 24216 |
| 194 | Ga0495583_0001702 | 3300046506 | Bacteria | 21192 |
| 195 | Ga0495606_0000022 | 3300046507 | Bacteria | 265567 |
| 196 | Ga0495610_0006127 | 3300046512 | Bacteria | 8383 |
| 197 | Ga0495610_0015167 | 3300046512 | Bacteria | 4490 |
| 198 | Ga0495616_0014258 | 3300046513 | Bacteria | 4457 |
| 199 | Ga0495620_0030044 | 3300046515 | Bacteria | 2507 |
| 200 | Ga0495620_0156792 | 3300046515 | Unclassified | 885 |
| 201 | Ga0495632_0000651 | 3300046519 | Bacteria | 31902 |
| 202 | Ga0495632_0075360 | 3300046519 | Bacteria | 1614 |
| 203 | Ga0495637_0012666 | 3300046520 | Bacteria | 4026 |
| 204 | Ga0495637_0039494 | 3300046520 | Bacteria | 2036 |
| 205 | Ga0495643_0045590 | 3300046522 | Bacteria | 2379 |
| 206 | Ga0495663_0107352 | 3300046525 | Bacteria | 925 |
| 207 | Ga0495654_0012882 | 3300046530 | Bacteria | 4483 |
| 208 | Ga0495598_0004211 | 3300046537 | Bacteria | 3104 |
| 209 | Ga0495609_0000168 | 3300046538 | Bacteria | 68840 |
| 210 | Ga0495609_0000692 | 3300046538 | Bacteria | 25981 |
| 211 | Ga0495597_0069377 | 3300046542 | Bacteria | 1521 |
| 212 | Ga0495622_0006296 | 3300046557 | Bacteria | 5512 |
| 213 | Ga0495667_0055862 | 3300046559 | Bacteria | 2597 |
| 214 | Ga0495625_0000004 | 3300046660 | Bacteria | 611314 |
| 215 | Ga0495625_0056135 | 3300046660 | Bacteria | 2805 |
| 216 | Ga0495659_0146435 | 3300046664 | Bacteria | 946 |
| 217 | Ga0495661_0000006 | 3300046665 | Bacteria | 427288 |
| 218 | Ga0495661_0000241 | 3300046665 | Bacteria | 63218 |
| 219 | Ga0495661_0008380 | 3300046665 | Bacteria | 7154 |
| 220 | Ga0495646_0227222 | 3300046680 | Bacteria | 1007 |
| 221 | Ga0495646_0324684 | 3300046680 | Unclassified | 810 |
| 222 | Ga0495670_0019266 | 3300046691 | Bacteria | 3362 |
| 223 | Ga0495649_0008246 | 3300046694 | Bacteria | 6276 |
| 224 | Ga0495660_0010455 | 3300046810 | Bacteria | 5398 |
| 225 | Ga0495660_0139427 | 3300046810 | Bacteria | 1208 |
| 226 | Ga0495672_0089047 | 3300047320 | Bacteria | 1700 |
| 227 | Ga0495676_0000004 | 3300047321 | Bacteria | 313696 |
| 228 | Ga0495679_000015 | 3300047446 | Bacteria | 287256 |
| 229 | Ga0495685_091410 | 3300047447 | Bacteria | 1009 |
| 230 | Ga0495673_0007288 | 3300047469 | Bacteria | 6384 |
| 231 | Ga0495673_0092395 | 3300047469 | Bacteria | 1234 |
| 232 | Ga0495681_0003055 | 3300047470 | Bacteria | 11750 |
| 233 | Ga0495686_0076449 | 3300047472 | Bacteria | 2051 |
| 234 | Ga0495602_0122941 | 3300048088 | Unclassified | 2085 |
| 235 | Ga0495602_0555774 | 3300048088 | Bacteria | 795 |
| 236 | Ga0495626_0000012 | 3300048091 | Bacteria | 258483 |
| 237 | Ga0496105_0012003 | 3300048908 | Bacteria | 6860 |
| 238 | Ga0496111_0435535 | 3300048914 | Bacteria | 968 |
| 239 | Ga0496112_0214089 | 3300048915 | Bacteria | 1884 |
| 240 | Ga0496126_0140544 | 3300048929 | Bacteria | 2079 |
| 241 | Ga0495678_019718 | 3300049459 | Bacteria | 3000 |
| 242 | Ga0501031_0047379 | 3300049568 | Bacteria | 2803 |
| 243 | Ga0501034_0057229 | 3300049571 | Bacteria | 3920 |
| 244 | Ga0501037_0105123 | 3300049573 | Bacteria | 2035 |
| 245 | Ga0501038_0049358 | 3300049574 | Bacteria | 3639 |
| 246 | Ga0501038_0542404 | 3300049574 | Bacteria | 885 |
| 247 | Ga0501039_0008884 | 3300049575 | Bacteria | 7656 |
| 248 | Ga0501039_0278588 | 3300049575 | Bacteria | 1315 |
| 249 | Ga0501039_0541181 | 3300049575 | Bacteria | 914 |
| 250 | Ga0501047_0015335 | 3300049581 | Bacteria | 7300 |
| 251 | Ga0501047_0298199 | 3300049581 | Bacteria | 1455 |
| 252 | Ga0501048_0485473 | 3300049582 | Bacteria | 886 |
| 253 | Ga0501070_0089318 | 3300049586 | Bacteria | 2550 |
| 254 | Ga0501072_0058147 | 3300049588 | Bacteria | 3048 |
| 255 | Ga0501072_0180018 | 3300049588 | Bacteria | 1686 |
| 256 | Ga0501075_0467344 | 3300049591 | Bacteria | 962 |
| 257 | Ga0501079_0159569 | 3300049741 | Bacteria | 1758 |
| 258 | Ga0501081_0093534 | 3300049743 | Bacteria | 2117 |
| 259 | Ga0501081_0165634 | 3300049743 | Unclassified | 1594 |
| 260 | Ga0501081_0181145 | 3300049743 | Bacteria | 1524 |
| 261 | Ga0501083_0030354 | 3300049744 | Bacteria | 3714 |
| 262 | Ga0501083_0069976 | 3300049744 | Bacteria | 2335 |
| 263 | Ga0501083_0070219 | 3300049744 | Bacteria | 2330 |
| 264 | Ga0501044_0432487 | 3300049823 | Unclassified | 1225 |
| 265 | Ga0501045_0335645 | 3300049824 | Bacteria | 1125 |
| 266 | nmdc:mga03683_11573_c1 | 3300050489 | Bacteria | 3196 |
| 267 | nmdc:mga03683_178336_c1 | 3300050489 | Bacteria | 968 |
| 268 | nmdc:mga03683_91194_c1 | 3300050489 | Bacteria | 1329 |
| 269 | nmdc:mga00v17_17852_c1 | 3300050491 | Bacteria | 4023 |
| 270 | nmdc:mga0k408_1584_c1 | 3300050493 | Bacteria | 12299 |
| 271 | nmdc:mga0k408_3072_c1 | 3300050493 | Bacteria | 8845 |
| 272 | nmdc:mga06z11_36690_c1 | 3300050494 | Bacteria | 2421 |
| 273 | nmdc:mga07m45_142701_c1 | 3300050496 | Bacteria | 1387 |
| 274 | nmdc:mga08y16_164094_c1 | 3300050511 | Bacteria | 2308 |
| 275 | nmdc:mga08y16_350105_c1 | 3300050511 | Bacteria | 1517 |
| 276 | nmdc:mga0n895_317152_c1 | 3300050512 | Bacteria | 1580 |
| 277 | nmdc:mga0rr50_245555_c1 | 3300050513 | Bacteria | 1485 |
| 278 | nmdc:mga0sz30_40779_c1 | 3300050516 | Bacteria | 1951 |
| 279 | Ga0495601_0004965 | 3300053077 | Bacteria | 7719 |
| 280 | Ga0495601_0013139 | 3300053077 | Bacteria | 4978 |
| 281 | Ga0500635_0084946 | 3300053080 | Bacteria | 1143 |
| 282 | Ga0495595_0004309 | 3300053084 | Bacteria | 5724 |
| 283 | Ga0495595_0015894 | 3300053084 | Bacteria | 3213 |
| 284 | Ga0495595_0262335 | 3300053084 | Unclassified | 866 |
| 285 | Ga0495619_0006479 | 3300053085 | Bacteria | 7415 |
| 286 | Ga0500583_0072091 | 3300053092 | Bacteria | 1654 |
| 287 | Ga0500641_0097906 | 3300053096 | Bacteria | 1257 |
| 288 | Ga0500650_0117148 | 3300053098 | Bacteria | 1243 |
| 289 | Ga0500652_107319 | 3300053131 | Bacteria | 1167 |
| 290 | Ga0500577_0025913 | 3300053142 | Bacteria | 1990 |
| 291 | Ga0500577_0087450 | 3300053142 | Bacteria | 1254 |
| 292 | Ga0500604_0064830 | 3300053151 | Bacteria | 1155 |
| 293 | Ga0501084_0063201 | 3300054114 | Bacteria | 3099 |
| 294 | Ga0501084_0186063 | 3300054114 | Bacteria | 1753 |
| 295 | Ga0501084_0371783 | 3300054114 | Bacteria | 1208 |
| 296 | Ga0501082_0271420 | 3300060353 | Bacteria | 1476 |
| 297 | Ga0501082_0394098 | 3300060353 | Bacteria | 1208 |
| 298 | Ga0530510_0076942 | 3300061734 | Bacteria | 2425 |
| 299 | Ga0530510_0227391 | 3300061734 | Unclassified | 1387 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053096 | Ga0500641_0097906 | Ga0500641_0097906_290_1039 | 174 |
| 2 | 3300046515 | Ga0495620_0030044 | Ga0495620_0030044_32_667 | 191 |
| 3 | 3300053080 | Ga0500635_0084946 | Ga0500635_0084946_23_637 | 191 |
| 4 | 3300053092 | Ga0500583_0072091 | Ga0500583_0072091_159_902 | 196 |
| 5 | 3300044842 | Ga0466957_0465350 | Ga0466957_0465350_12_650 | 199 |
| 6 | 3300048914 | Ga0496111_0435535 | Ga0496111_0435535_16_654 | 199 |
| 7 | 3300053084 | Ga0495595_0262335 | Ga0495595_0262335_201_839 | 199 |
| 8 | 3300009147 | Ga0114129_10164372 | Ga0114129_101643722 | 200 |
| 9 | 3300005471 | Ga0070698_100763711 | Ga0070698_1007637111 | 201 |
| 10 | 3300005563 | Ga0068855_100039698 | Ga0068855_1000396985 | 205 |
| 11 | 3300005614 | Ga0068856_100373363 | Ga0068856_1003733632 | 205 |
| 12 | 3300005616 | Ga0068852_100019271 | Ga0068852_1000192712 | 205 |
| 13 | 3300025912 | Ga0207707_10086981 | Ga0207707_100869812 | 205 |
| 14 | 3300025917 | Ga0207660_10011533 | Ga0207660_100115335 | 205 |
| 15 | 3300025919 | Ga0207657_10229062 | Ga0207657_102290622 | 205 |
| 16 | 3300025921 | Ga0207652_10005554 | Ga0207652_100055547 | 205 |
| 17 | 3300025932 | Ga0207690_10188121 | Ga0207690_101881211 | 205 |
| 18 | 3300025949 | Ga0207667_10081395 | Ga0207667_100813952 | 205 |
| 19 | 3300026078 | Ga0207702_10320213 | Ga0207702_103202132 | 205 |
| 20 | 3300050513 | nmdc:mga0rr50_245555_c1 | nmdc:mga0rr50_245555_c1_321_983 | 207 |
| 21 | 3300046463 | Ga0495653_0131431 | Ga0495653_0131431_10_684 | 211 |
| 22 | 3300013102 | Ga0157371_10185937 | Ga0157371_101859372 | 215 |
| 23 | 3300039438 | Ga0436360_1088500 | Ga0436360_1088500_297_1058 | 215 |
| 24 | 3300025294 | Ga0209025_1064609 | Ga0209025_10646092 | 216 |
| 25 | 3300044694 | Ga0466963_0202410 | Ga0466963_0202410_252_1025 | 217 |
| 26 | 3300044842 | Ga0466957_0397964 | Ga0466957_0397964_13_786 | 217 |
| 27 | 3300035725 | Ga0373947_0154270 | Ga0373947_0154270_447_1220 | 219 |
| 28 | 3300046559 | Ga0495667_0055862 | Ga0495667_0055862_684_1385 | 220 |
| 29 | 3300048088 | Ga0495602_0122941 | Ga0495602_0122941_1181_1882 | 220 |
| 30 | 3300053077 | Ga0495601_0013139 | Ga0495601_0013139_2235_2936 | 220 |
| 31 | 3300053084 | Ga0495595_0004309 | Ga0495595_0004309_1699_2400 | 220 |
| 32 | 3300053085 | Ga0495619_0006479 | Ga0495619_0006479_2299_3000 | 220 |
| 33 | 3300046520 | Ga0495637_0039494 | Ga0495637_0039494_88_813 | 221 |
| 34 | 3300050489 | nmdc:mga03683_91194_c1 | nmdc:mga03683_91194_c1_597_1301 | 222 |
| 35 | 3300031548 | Ga0307408_100269183 | Ga0307408_1002691832 | 223 |
| 36 | 3300031852 | Ga0307410_10023949 | Ga0307410_100239493 | 223 |
| 37 | 3300037312 | Ga0395899_0288058 | Ga0395899_0288058_123_896 | 223 |
| 38 | 3300038443 | Ga0395901_0018310 | Ga0395901_0018310_2861_3634 | 223 |
| 39 | 3300048929 | Ga0496126_0140544 | Ga0496126_0140544_594_1328 | 223 |
| 40 | 3300005440 | Ga0070705_100037208 | Ga0070705_1000372083 | 225 |
| 41 | 3300005545 | Ga0070695_100012768 | Ga0070695_1000127682 | 225 |
| 42 | 3300042876 | Ga0451577_0053982 | Ga0451577_0053982_2343_3104 | 225 |
| 43 | 3300033180 | Ga0307510_10061301 | Ga0307510_100613014 | 226 |
| 44 | 3300038705 | Ga0237819_05741 | Ga0237819_05741_114_860 | 227 |
| 45 | 3300048088 | Ga0495602_0555774 | Ga0495602_0555774_14_736 | 227 |
| 46 | 3300049575 | Ga0501039_0008884 | Ga0501039_0008884_2898_3620 | 227 |
| 47 | 3300049743 | Ga0501081_0165634 | Ga0501081_0165634_431_1153 | 227 |
| 48 | 3300054114 | Ga0501084_0063201 | Ga0501084_0063201_1073_1795 | 227 |
| 49 | 3300061734 | Ga0530510_0227391 | Ga0530510_0227391_392_1114 | 227 |
| 50 | 3300037312 | Ga0395899_0006840 | Ga0395899_0006840_734_1459 | 228 |
| 51 | 3300037418 | Ga0395900_0001715 | Ga0395900_0001715_13243_13968 | 228 |
| 52 | 3300037466 | Ga0395898_0025971 | Ga0395898_0025971_4206_4931 | 228 |
| 53 | 3300038443 | Ga0395901_0011685 | Ga0395901_0011685_942_1667 | 228 |
| 54 | 3300038443 | Ga0395901_0027824 | Ga0395901_0027824_4800_5525 | 228 |
| 55 | 3300046501 | Ga0495607_0000677 | Ga0495607_0000677_1749_2498 | 228 |
| 56 | 3300009011 | Ga0105251_10074583 | Ga0105251_100745832 | 229 |
| 57 | 3300035695 | Ga0373927_0147745 | Ga0373927_0147745_22_750 | 229 |
| 58 | 3300046452 | Ga0495617_007487 | Ga0495617_007487_567_1316 | 229 |
| 59 | 3300046457 | Ga0495590_0081782 | Ga0495590_0081782_365_1114 | 229 |
| 60 | 3300046458 | Ga0495591_009879 | Ga0495591_009879_2926_3675 | 229 |
| 61 | 3300046471 | Ga0495650_0000316 | Ga0495650_0000316_2741_3490 | 229 |
| 62 | 3300046471 | Ga0495650_0006039 | Ga0495650_0006039_4480_5229 | 229 |
| 63 | 3300046474 | Ga0495605_0000079 | Ga0495605_0000079_118838_119587 | 229 |
| 64 | 3300046491 | Ga0495584_0217310 | Ga0495584_0217310_90_839 | 229 |
| 65 | 3300046492 | Ga0495585_0076329 | Ga0495585_0076329_631_1380 | 229 |
| 66 | 3300046501 | Ga0495607_0054940 | Ga0495607_0054940_1146_1895 | 229 |
| 67 | 3300046506 | Ga0495583_0000591 | Ga0495583_0000591_37667_38416 | 229 |
| 68 | 3300046506 | Ga0495583_0001018 | Ga0495583_0001018_7142_7891 | 229 |
| 69 | 3300046506 | Ga0495583_0001437 | Ga0495583_0001437_23147_23896 | 229 |
| 70 | 3300046506 | Ga0495583_0001702 | Ga0495583_0001702_17856_18605 | 229 |
| 71 | 3300046507 | Ga0495606_0000022 | Ga0495606_0000022_101067_101816 | 229 |
| 72 | 3300046512 | Ga0495610_0006127 | Ga0495610_0006127_775_1524 | 229 |
| 73 | 3300046512 | Ga0495610_0015167 | Ga0495610_0015167_319_1068 | 229 |
| 74 | 3300046513 | Ga0495616_0014258 | Ga0495616_0014258_2718_3467 | 229 |
| 75 | 3300046515 | Ga0495620_0156792 | Ga0495620_0156792_41_790 | 229 |
| 76 | 3300046519 | Ga0495632_0000651 | Ga0495632_0000651_7169_7918 | 229 |
| 77 | 3300046519 | Ga0495632_0075360 | Ga0495632_0075360_555_1304 | 229 |
| 78 | 3300046520 | Ga0495637_0012666 | Ga0495637_0012666_857_1606 | 229 |
| 79 | 3300046522 | Ga0495643_0045590 | Ga0495643_0045590_268_1017 | 229 |
| 80 | 3300046530 | Ga0495654_0012882 | Ga0495654_0012882_1822_2571 | 229 |
| 81 | 3300046538 | Ga0495609_0000168 | Ga0495609_0000168_5447_6196 | 229 |
| 82 | 3300046538 | Ga0495609_0000692 | Ga0495609_0000692_7414_8163 | 229 |
| 83 | 3300046542 | Ga0495597_0069377 | Ga0495597_0069377_345_1094 | 229 |
| 84 | 3300046557 | Ga0495622_0006296 | Ga0495622_0006296_2430_3179 | 229 |
| 85 | 3300046660 | Ga0495625_0000004 | Ga0495625_0000004_476388_477137 | 229 |
| 86 | 3300046665 | Ga0495661_0000006 | Ga0495661_0000006_241526_242275 | 229 |
| 87 | 3300046665 | Ga0495661_0000241 | Ga0495661_0000241_7402_8151 | 229 |
| 88 | 3300046665 | Ga0495661_0008380 | Ga0495661_0008380_3652_4401 | 229 |
| 89 | 3300046691 | Ga0495670_0019266 | Ga0495670_0019266_37_786 | 229 |
| 90 | 3300046694 | Ga0495649_0008246 | Ga0495649_0008246_2060_2809 | 229 |
| 91 | 3300046810 | Ga0495660_0010455 | Ga0495660_0010455_2198_2947 | 229 |
| 92 | 3300046810 | Ga0495660_0139427 | Ga0495660_0139427_384_1133 | 229 |
| 93 | 3300047321 | Ga0495676_0000004 | Ga0495676_0000004_35934_36683 | 229 |
| 94 | 3300047446 | Ga0495679_000015 | Ga0495679_000015_165123_165872 | 229 |
| 95 | 3300047469 | Ga0495673_0007288 | Ga0495673_0007288_3004_3753 | 229 |
| 96 | 3300047469 | Ga0495673_0092395 | Ga0495673_0092395_13_762 | 229 |
| 97 | 3300047470 | Ga0495681_0003055 | Ga0495681_0003055_7355_8104 | 229 |
| 98 | 3300047472 | Ga0495686_0076449 | Ga0495686_0076449_17_766 | 229 |
| 99 | 3300048091 | Ga0495626_0000012 | Ga0495626_0000012_196149_196898 | 229 |
| 100 | 3300049459 | Ga0495678_019718 | Ga0495678_019718_1812_2561 | 229 |
| 101 | 3300053142 | Ga0500577_0025913 | Ga0500577_0025913_660_1409 | 229 |
| 102 | 3300026118 | Ga0207675_100551450 | Ga0207675_1005514503 | 230 |
| 103 | 3300032005 | Ga0307411_10035047 | Ga0307411_100350473 | 230 |
| 104 | 3300044712 | Ga0453684_0742425 | Ga0453684_0742425_123_875 | 230 |
| 105 | iso_pu_bacteria | 2643221736 | 2644743321 | 232 |
| 106 | iso_pu_bacteria | 2818991467 | 2819718464 | 232 |
| 107 | iso_pu_bacteria | 2841760612 | 2841764803 | 232 |
| 108 | iso_pu_bacteria | 2844104063 | 2844107749 | 232 |
| 109 | iso_pu_bacteria | 2851182111 | 2851183119 | 232 |
| 110 | iso_pu_bacteria | 2851246043 | 2851249855 | 232 |
| 111 | iso_pu_bacteria | 8057529695 | 8057533166 | 232 |
| 112 | 3300046460 | Ga0495638_0019577 | Ga0495638_0019577_2637_3380 | 234 |
| 113 | 3300005293 | Ga0065715_10316452 | Ga0065715_103164522 | 235 |
| 114 | 3300005328 | Ga0070676_10077890 | Ga0070676_100778901 | 235 |
| 115 | 3300005335 | Ga0070666_10034384 | Ga0070666_100343843 | 235 |
| 116 | 3300005340 | Ga0070689_100229193 | Ga0070689_1002291932 | 235 |
| 117 | 3300005343 | Ga0070687_100304305 | Ga0070687_1003043052 | 235 |
| 118 | 3300005355 | Ga0070671_100074007 | Ga0070671_1000740073 | 235 |
| 119 | 3300005364 | Ga0070673_100441449 | Ga0070673_1004414491 | 235 |
| 120 | 3300005365 | Ga0070688_100060508 | Ga0070688_1000605082 | 235 |
| 121 | 3300005438 | Ga0070701_10173393 | Ga0070701_101733932 | 235 |
| 122 | 3300005466 | Ga0070685_10185710 | Ga0070685_101857102 | 235 |
| 123 | 3300005548 | Ga0070665_100735383 | Ga0070665_1007353832 | 235 |
| 124 | 3300005577 | Ga0068857_100120931 | Ga0068857_1001209313 | 235 |
| 125 | 3300005618 | Ga0068864_100070957 | Ga0068864_1000709572 | 235 |
| 126 | 3300005841 | Ga0068863_100100898 | Ga0068863_1001008983 | 235 |
| 127 | 3300006186 | Ga0075369_10122500 | Ga0075369_101225002 | 235 |
| 128 | 3300009148 | Ga0105243_10261367 | Ga0105243_102613672 | 235 |
| 129 | 3300011119 | Ga0105246_10203689 | Ga0105246_102036892 | 235 |
| 130 | 3300014326 | Ga0157380_10090841 | Ga0157380_100908413 | 235 |
| 131 | 3300025294 | Ga0209025_1016636 | Ga0209025_10166364 | 235 |
| 132 | 3300025893 | Ga0207682_10000821 | Ga0207682_1000082110 | 235 |
| 133 | 3300025900 | Ga0207710_10071666 | Ga0207710_100716662 | 235 |
| 134 | 3300025901 | Ga0207688_10014612 | Ga0207688_100146125 | 235 |
| 135 | 3300025903 | Ga0207680_10312598 | Ga0207680_103125982 | 235 |
| 136 | 3300025907 | Ga0207645_10015201 | Ga0207645_100152013 | 235 |
| 137 | 3300025918 | Ga0207662_10024536 | Ga0207662_100245363 | 235 |
| 138 | 3300025918 | Ga0207662_10385950 | Ga0207662_103859502 | 235 |
| 139 | 3300025924 | Ga0207694_10275017 | Ga0207694_102750172 | 235 |
| 140 | 3300025925 | Ga0207650_10208954 | Ga0207650_102089542 | 235 |
| 141 | 3300025925 | Ga0207650_10283597 | Ga0207650_102835972 | 235 |
| 142 | 3300025931 | Ga0207644_10210070 | Ga0207644_102100702 | 235 |
| 143 | 3300025937 | Ga0207669_10470777 | Ga0207669_104707772 | 235 |
| 144 | 3300025940 | Ga0207691_10016641 | Ga0207691_100166414 | 235 |
| 145 | 3300025972 | Ga0207668_10260143 | Ga0207668_102601432 | 235 |
| 146 | 3300026067 | Ga0207678_10287857 | Ga0207678_102878572 | 235 |
| 147 | 3300026075 | Ga0207708_10229841 | Ga0207708_102298412 | 235 |
| 148 | 3300026089 | Ga0207648_10122467 | Ga0207648_101224673 | 235 |
| 149 | 3300026095 | Ga0207676_10123624 | Ga0207676_101236243 | 235 |
| 150 | 3300026116 | Ga0207674_10153474 | Ga0207674_101534743 | 235 |
| 151 | 3300026118 | Ga0207675_100211187 | Ga0207675_1002111872 | 235 |
| 152 | 3300026121 | Ga0207683_10022537 | Ga0207683_100225373 | 235 |
| 153 | 3300046474 | Ga0495605_0035176 | Ga0495605_0035176_326_1075 | 235 |
| 154 | 3300046537 | Ga0495598_0004211 | Ga0495598_0004211_697_1446 | 235 |
| 155 | 3300046680 | Ga0495646_0324684 | Ga0495646_0324684_10_765 | 235 |
| 156 | 3300049823 | Ga0501044_0432487 | Ga0501044_0432487_394_1152 | 235 |
| 157 | 3300050489 | nmdc:mga03683_178336_c1 | nmdc:mga03683_178336_c1_91_840 | 235 |
| 158 | 3300050516 | nmdc:mga0sz30_40779_c1 | nmdc:mga0sz30_40779_c1_140_886 | 235 |
| 159 | 3300053084 | Ga0495595_0015894 | Ga0495595_0015894_2441_3196 | 235 |
| 160 | 3300002987 | JGI25159J45721_1006338 | JGI25159J45721_10063383 | 236 |
| 161 | 3300005262 | Ga0065165_1000229 | Ga0065165_100022932 | 236 |
| 162 | 3300005293 | Ga0065715_10305770 | Ga0065715_103057702 | 236 |
| 163 | 3300005327 | Ga0070658_10024543 | Ga0070658_100245432 | 236 |
| 164 | 3300005327 | Ga0070658_10032181 | Ga0070658_100321813 | 236 |
| 165 | 3300005331 | Ga0070670_100183358 | Ga0070670_1001833582 | 236 |
| 166 | 3300005336 | Ga0070680_100001887 | Ga0070680_1000018879 | 236 |
| 167 | 3300005336 | Ga0070680_100138126 | Ga0070680_1001381262 | 236 |
| 168 | 3300005336 | Ga0070680_100147308 | Ga0070680_1001473082 | 236 |
| 169 | 3300005340 | Ga0070689_100184834 | Ga0070689_1001848342 | 236 |
| 170 | 3300005343 | Ga0070687_100061864 | Ga0070687_1000618642 | 236 |
| 171 | 3300005354 | Ga0070675_100240838 | Ga0070675_1002408382 | 236 |
| 172 | 3300005354 | Ga0070675_100306057 | Ga0070675_1003060572 | 236 |
| 173 | 3300005366 | Ga0070659_100052566 | Ga0070659_1000525662 | 236 |
| 174 | 3300005436 | Ga0070713_100126140 | Ga0070713_1001261403 | 236 |
| 175 | 3300005439 | Ga0070711_100076780 | Ga0070711_1000767801 | 236 |
| 176 | 3300005457 | Ga0070662_100222956 | Ga0070662_1002229562 | 236 |
| 177 | 3300005458 | Ga0070681_10072303 | Ga0070681_100723032 | 236 |
| 178 | 3300005458 | Ga0070681_10326884 | Ga0070681_103268842 | 236 |
| 179 | 3300005468 | Ga0070707_100566786 | Ga0070707_1005667862 | 236 |
| 180 | 3300005471 | Ga0070698_100175772 | Ga0070698_1001757721 | 236 |
| 181 | 3300005530 | Ga0070679_100005746 | Ga0070679_1000057465 | 236 |
| 182 | 3300005539 | Ga0068853_100185351 | Ga0068853_1001853512 | 236 |
| 183 | 3300005539 | Ga0068853_100722379 | Ga0068853_1007223791 | 236 |
| 184 | 3300005563 | Ga0068855_100015541 | Ga0068855_1000155412 | 236 |
| 185 | 3300005614 | Ga0068856_100072059 | Ga0068856_1000720592 | 236 |
| 186 | 3300005616 | Ga0068852_100104491 | Ga0068852_1001044913 | 236 |
| 187 | 3300005844 | Ga0068862_100600066 | Ga0068862_1006000662 | 236 |
| 188 | 3300005981 | Ga0081538_10029189 | Ga0081538_100291892 | 236 |
| 189 | 3300005985 | Ga0081539_10034076 | Ga0081539_100340764 | 236 |
| 190 | 3300006028 | Ga0070717_10242830 | Ga0070717_102428302 | 236 |
| 191 | 3300006028 | Ga0070717_10434143 | Ga0070717_104341432 | 236 |
| 192 | 3300006058 | Ga0075432_10030816 | Ga0075432_100308163 | 236 |
| 193 | 3300006177 | Ga0075362_10001180 | Ga0075362_100011803 | 236 |
| 194 | 3300006178 | Ga0075367_10007683 | Ga0075367_100076835 | 236 |
| 195 | 3300006195 | Ga0075366_10001237 | Ga0075366_100012375 | 236 |
| 196 | 3300006195 | Ga0075366_10038855 | Ga0075366_100388552 | 236 |
| 197 | 3300006844 | Ga0075428_100148021 | Ga0075428_1001480213 | 236 |
| 198 | 3300006871 | Ga0075434_100025900 | Ga0075434_1000259004 | 236 |
| 199 | 3300006871 | Ga0075434_100339292 | Ga0075434_1003392921 | 236 |
| 200 | 3300006914 | Ga0075436_100094037 | Ga0075436_1000940373 | 236 |
| 201 | 3300009094 | Ga0111539_10036258 | Ga0111539_100362585 | 236 |
| 202 | 3300009094 | Ga0111539_10233941 | Ga0111539_102339412 | 236 |
| 203 | 3300009094 | Ga0111539_10275051 | Ga0111539_102750513 | 236 |
| 204 | 3300009098 | Ga0105245_10570874 | Ga0105245_105708741 | 236 |
| 205 | 3300009177 | Ga0105248_10076366 | Ga0105248_100763664 | 236 |
| 206 | 3300009551 | Ga0105238_10096406 | Ga0105238_100964061 | 236 |
| 207 | 3300009553 | Ga0105249_10912614 | Ga0105249_109126142 | 236 |
| 208 | 3300013100 | Ga0157373_10078407 | Ga0157373_100784073 | 236 |
| 209 | 3300013102 | Ga0157371_10083441 | Ga0157371_100834413 | 236 |
| 210 | 3300013104 | Ga0157370_10055398 | Ga0157370_100553983 | 236 |
| 211 | 3300013104 | Ga0157370_10187709 | Ga0157370_101877092 | 236 |
| 212 | 3300013105 | Ga0157369_10627700 | Ga0157369_106277002 | 236 |
| 213 | 3300013306 | Ga0163162_10330105 | Ga0163162_103301052 | 236 |
| 214 | 3300013306 | Ga0163162_10808002 | Ga0163162_108080022 | 236 |
| 215 | 3300013307 | Ga0157372_10197053 | Ga0157372_101970532 | 236 |
| 216 | 3300014968 | Ga0157379_10556912 | Ga0157379_105569122 | 236 |
| 217 | 3300021441 | Ga0213871_10064393 | Ga0213871_100643932 | 236 |
| 218 | 3300025284 | Ga0209130_1000045 | Ga0209130_100004513 | 236 |
| 219 | 3300025302 | Ga0207426_1010082 | Ga0207426_10100822 | 236 |
| 220 | 3300025901 | Ga0207688_10219241 | Ga0207688_102192411 | 236 |
| 221 | 3300025909 | Ga0207705_10004267 | Ga0207705_100042672 | 236 |
| 222 | 3300025909 | Ga0207705_10024644 | Ga0207705_100246443 | 236 |
| 223 | 3300025912 | Ga0207707_10489654 | Ga0207707_104896542 | 236 |
| 224 | 3300025916 | Ga0207663_10132452 | Ga0207663_101324521 | 236 |
| 225 | 3300025917 | Ga0207660_10119428 | Ga0207660_101194282 | 236 |
| 226 | 3300025921 | Ga0207652_10719950 | Ga0207652_107199501 | 236 |
| 227 | 3300025922 | Ga0207646_10141679 | Ga0207646_101416792 | 236 |
| 228 | 3300025927 | Ga0207687_10151150 | Ga0207687_101511501 | 236 |
| 229 | 3300025928 | Ga0207700_10111143 | Ga0207700_101111432 | 236 |
| 230 | 3300025928 | Ga0207700_10282626 | Ga0207700_102826262 | 236 |
| 231 | 3300025929 | Ga0207664_10046298 | Ga0207664_100462983 | 236 |
| 232 | 3300025940 | Ga0207691_10205553 | Ga0207691_102055532 | 236 |
| 233 | 3300025942 | Ga0207689_10398487 | Ga0207689_103984872 | 236 |
| 234 | 3300025949 | Ga0207667_10002456 | Ga0207667_100024562 | 236 |
| 235 | 3300026078 | Ga0207702_10075969 | Ga0207702_100759693 | 236 |
| 236 | 3300026142 | Ga0207698_10078135 | Ga0207698_100781353 | 236 |
| 237 | 3300027907 | Ga0207428_10077328 | Ga0207428_100773283 | 236 |
| 238 | 3300028381 | Ga0268264_10267827 | Ga0268264_102678272 | 236 |
| 239 | 3300031241 | Ga0265325_10008700 | Ga0265325_100087003 | 236 |
| 240 | 3300031249 | Ga0265339_10001774 | Ga0265339_1000177414 | 236 |
| 241 | 3300031344 | Ga0265316_10087898 | Ga0265316_100878983 | 236 |
| 242 | 3300031595 | Ga0265313_10005248 | Ga0265313_100052482 | 236 |
| 243 | 3300032004 | Ga0307414_10034218 | Ga0307414_100342182 | 236 |
| 244 | 3300035118 | Ga0373954_0041799 | Ga0373954_0041799_594_1361 | 236 |
| 245 | 3300035170 | Ga0373943_0128162 | Ga0373943_0128162_351_1124 | 236 |
| 246 | 3300035410 | Ga0373924_0057131 | Ga0373924_0057131_190_957 | 236 |
| 247 | 3300035692 | Ga0373935_0063565 | Ga0373935_0063565_174_941 | 236 |
| 248 | 3300035725 | Ga0373947_0114381 | Ga0373947_0114381_380_1147 | 236 |
| 249 | 3300036401 | Ga0373937_0188758 | Ga0373937_0188758_954_1721 | 236 |
| 250 | 3300037068 | Ga0373925_0436438 | Ga0373925_0436438_64_831 | 236 |
| 251 | 3300037466 | Ga0395898_0026356 | Ga0395898_0026356_2412_3185 | 236 |
| 252 | 3300037471 | Ga0395905_0773437 | Ga0395905_0773437_78_839 | 236 |
| 253 | 3300041408 | Ga0439453_0023547 | Ga0439453_0023547_117_869 | 236 |
| 254 | 3300042876 | Ga0451577_0214926 | Ga0451577_0214926_646_1407 | 236 |
| 255 | 3300044712 | Ga0453684_0548376 | Ga0453684_0548376_427_1188 | 236 |
| 256 | 3300046459 | Ga0495629_0296885 | Ga0495629_0296885_325_1092 | 236 |
| 257 | 3300046460 | Ga0495638_0018079 | Ga0495638_0018079_2295_3047 | 236 |
| 258 | 3300046473 | Ga0495582_0028739 | Ga0495582_0028739_830_1597 | 236 |
| 259 | 3300046525 | Ga0495663_0107352 | Ga0495663_0107352_65_817 | 236 |
| 260 | 3300046660 | Ga0495625_0056135 | Ga0495625_0056135_1425_2183 | 236 |
| 261 | 3300046664 | Ga0495659_0146435 | Ga0495659_0146435_54_806 | 236 |
| 262 | 3300046680 | Ga0495646_0227222 | Ga0495646_0227222_40_807 | 236 |
| 263 | 3300047320 | Ga0495672_0089047 | Ga0495672_0089047_70_822 | 236 |
| 264 | 3300047447 | Ga0495685_091410 | Ga0495685_091410_55_807 | 236 |
| 265 | 3300048908 | Ga0496105_0012003 | Ga0496105_0012003_1256_2008 | 236 |
| 266 | 3300048915 | Ga0496112_0214089 | Ga0496112_0214089_19_774 | 236 |
| 267 | 3300049568 | Ga0501031_0047379 | Ga0501031_0047379_255_1004 | 236 |
| 268 | 3300049571 | Ga0501034_0057229 | Ga0501034_0057229_930_1679 | 236 |
| 269 | 3300049573 | Ga0501037_0105123 | Ga0501037_0105123_508_1257 | 236 |
| 270 | 3300049574 | Ga0501038_0049358 | Ga0501038_0049358_664_1413 | 236 |
| 271 | 3300049574 | Ga0501038_0542404 | Ga0501038_0542404_103_861 | 236 |
| 272 | 3300049575 | Ga0501039_0278588 | Ga0501039_0278588_173_961 | 236 |
| 273 | 3300049575 | Ga0501039_0541181 | Ga0501039_0541181_129_878 | 236 |
| 274 | 3300049581 | Ga0501047_0015335 | Ga0501047_0015335_342_1091 | 236 |
| 275 | 3300049581 | Ga0501047_0298199 | Ga0501047_0298199_555_1322 | 236 |
| 276 | 3300049582 | Ga0501048_0485473 | Ga0501048_0485473_97_861 | 236 |
| 277 | 3300049586 | Ga0501070_0089318 | Ga0501070_0089318_351_1118 | 236 |
| 278 | 3300049588 | Ga0501072_0058147 | Ga0501072_0058147_929_1693 | 236 |
| 279 | 3300049588 | Ga0501072_0180018 | Ga0501072_0180018_350_1099 | 236 |
| 280 | 3300049591 | Ga0501075_0467344 | Ga0501075_0467344_111_869 | 236 |
| 281 | 3300049741 | Ga0501079_0159569 | Ga0501079_0159569_854_1618 | 236 |
| 282 | 3300049743 | Ga0501081_0093534 | Ga0501081_0093534_630_1388 | 236 |
| 283 | 3300049743 | Ga0501081_0181145 | Ga0501081_0181145_500_1264 | 236 |
| 284 | 3300049744 | Ga0501083_0030354 | Ga0501083_0030354_2665_3414 | 236 |
| 285 | 3300049744 | Ga0501083_0069976 | Ga0501083_0069976_485_1273 | 236 |
| 286 | 3300049744 | Ga0501083_0070219 | Ga0501083_0070219_1247_1999 | 236 |
| 287 | 3300049824 | Ga0501045_0335645 | Ga0501045_0335645_148_912 | 236 |
| 288 | 3300050489 | nmdc:mga03683_11573_c1 | nmdc:mga03683_11573_c1_1438_2190 | 236 |
| 289 | 3300050491 | nmdc:mga00v17_17852_c1 | nmdc:mga00v17_17852_c1_3225_3977 | 236 |
| 290 | 3300050493 | nmdc:mga0k408_1584_c1 | nmdc:mga0k408_1584_c1_1756_2505 | 236 |
| 291 | 3300050493 | nmdc:mga0k408_3072_c1 | nmdc:mga0k408_3072_c1_7188_7940 | 236 |
| 292 | 3300050494 | nmdc:mga06z11_36690_c1 | nmdc:mga06z11_36690_c1_642_1394 | 236 |
| 293 | 3300050496 | nmdc:mga07m45_142701_c1 | nmdc:mga07m45_142701_c1_186_938 | 236 |
| 294 | 3300050511 | nmdc:mga08y16_164094_c1 | nmdc:mga08y16_164094_c1_724_1476 | 236 |
| 295 | 3300050511 | nmdc:mga08y16_350105_c1 | nmdc:mga08y16_350105_c1_695_1447 | 236 |
| 296 | 3300050512 | nmdc:mga0n895_317152_c1 | nmdc:mga0n895_317152_c1_139_906 | 236 |
| 297 | 3300053077 | Ga0495601_0004965 | Ga0495601_0004965_4579_5331 | 236 |
| 298 | 3300053098 | Ga0500650_0117148 | Ga0500650_0117148_145_894 | 236 |
| 299 | 3300053131 | Ga0500652_107319 | Ga0500652_107319_210_959 | 236 |
| 300 | 3300053142 | Ga0500577_0087450 | Ga0500577_0087450_64_816 | 236 |
| 301 | 3300053151 | Ga0500604_0064830 | Ga0500604_0064830_356_1108 | 236 |
| 302 | 3300054114 | Ga0501084_0186063 | Ga0501084_0186063_809_1567 | 236 |
| 303 | 3300054114 | Ga0501084_0371783 | Ga0501084_0371783_197_961 | 236 |
| 304 | 3300060353 | Ga0501082_0271420 | Ga0501082_0271420_476_1240 | 236 |
| 305 | 3300060353 | Ga0501082_0394098 | Ga0501082_0394098_68_835 | 236 |
| 306 | 3300061734 | Ga0530510_0076942 | Ga0530510_0076942_671_1429 | 236 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
77
257
0.95
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7ahc-assembly1.cif.gz_B | opua apo inward-facing | 0.7396 | 44 | 230 |
| 7ahd-assembly1.cif.gz_B | opua (e190q) occluded | 0.7243 | 44 | 230 |
| 7ahd-assembly1.cif.gz_A | opua (e190q) occluded | 0.7132 | 44 | 230 |
| 3dhw-assembly2.cif.gz_E | crystal structure of methionine importer metni | 0.6479 | 56 | 226 |
| 3dhw-assembly1.cif.gz_B | crystal structure of methionine importer metni | 0.6467 | 50 | 226 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P75851_53_247_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.7809 | 47 | 226 | 1.10.3720.10 |
| af_Q47539_71_268_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.7616 | 54 | 231 | 1.10.3720.10 |
| af_Q2G088_14_207_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.743 | 50 | 226 | 1.10.3720.10 |
| af_P14176_140_330_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.7413 | 53 | 232 | 1.10.3720.10 |
| af_Q2G1I4_54_251_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.7384 | 54 | 235 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7G2IJA1-F1-model_v4 | Alkanesulfonates ABC transporter ATP-binding protein / Sulfonate ABC transporter, ATP-binding subunit SsuB | 0.8309 | 1 | 203 |
GO:0005524
GO:0005886 GO:0016887 GO:0055085 |
| AF-A0A4Q7Y480-F1-model_v4 | NitT/TauT family transport system permease protein | 0.8188 | 3 | 226 |
GO:0005886
GO:0055085 |
| AF-A0A432TQM8-F1-model_v4 | ABC transporter ATP-binding protein | 0.8183 | 10 | 226 |
GO:0005524
GO:0005886 GO:0016887 GO:0055085 |
| AF-A0A6F8YEI0-F1-model_v4 | ABC transporter permease | 0.8165 | 2 | 226 |
GO:0005886
GO:0055085 |
| AF-A0A2W4MNX5-F1-model_v4 | deleted | 0.812 | 12 | 208 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar