F398683

General Info

Members Datasets Scaffolds Average Seq Length
306 161 612 252

Family's Representative Sequence

Representative Sequence 3300020082|Ga0206353_10844698|Ga0206353_108446983
Length 279
Sequence VGRPAQAGRPFVRYNGHVGETVDLLRLADSSLALPRLGGMARPDGVVIVSERYWAFASVDGGIREGRMPQPPEILHDIPLARGLVRLWASLAPVFRRSGVARGRERLLIATAVVAPLGLAFVGGPWSTAAGIALSLLLLLTILRGRALHLHGAEHRAIAAAEERRLVATWTGAAKPTRFSPRCGTNFAALALPVTVVADRFLPLAPEFWTPLVVLVLSLALTMELWRMVQRSSRGFWHAFLVPGLALQRLTTREPRLDETQVALRAVAAVLRRELGSAA

Samples

Sample ID Description Type Environment
1 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
55 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
78 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
79 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
80 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
81 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
82 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
83 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
84 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
85 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
86 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
88 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
89 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
90 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
93 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
94 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
95 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
96 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
97 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
98 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
99 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
100 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
101 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
102 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
103 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
104 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
105 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
106 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
107 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
108 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
109 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
110 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
111 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
112 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
113 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
114 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
115 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
116 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
117 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
118 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
119 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
120 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
121 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
122 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
123 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
124 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
125 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
128 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
129 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
130 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
131 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
132 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
141 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
142 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
143 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
144 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
145 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
146 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
147 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
148 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
149 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
150 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
151 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
152 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
153 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
154 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
155 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
156 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
157 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
158 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
159 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
160 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
161 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.41
Metatranscriptomes 3.59
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.5
Rhizosphere 90.52
Stem 0
Stem Tuber 0
Unclassified 3.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0206353_10844698 3300020082 Bacteria 2589
2 Ga0070658_10227217 3300005327 Bacteria 1580
3 Ga0070683_100325328 3300005329 Bacteria 1463
4 Ga0070680_100049186 3300005336 Bacteria 3436
5 Ga0070680_100110646 3300005336 Bacteria 2287
6 Ga0070680_100181301 3300005336 Bacteria 1774
7 Ga0070660_100014660 3300005339 Bacteria 5654
8 Ga0070660_100032987 3300005339 Bacteria 3900
9 Ga0070660_100254933 3300005339 Bacteria 1431
10 Ga0070660_100337708 3300005339 Bacteria 1239
11 Ga0070661_100057948 3300005344 Bacteria 2838
12 Ga0070659_100093474 3300005366 Bacteria 2413
13 Ga0070659_100306213 3300005366 Bacteria 1326
14 Ga0070714_100161979 3300005435 Bacteria 2025
15 Ga0070714_100448345 3300005435 Bacteria 1225
16 Ga0070663_100053851 3300005455 Bacteria 2874
17 Ga0070678_100260116 3300005456 Bacteria 1459
18 Ga0070681_10015095 3300005458 Bacteria 7683
19 Ga0070681_10020946 3300005458 Bacteria 6551
20 Ga0070681_10032791 3300005458 Bacteria 5215
21 Ga0070681_10046936 3300005458 Bacteria 4318
22 Ga0070681_10136220 3300005458 Bacteria 2386
23 Ga0070681_10165266 3300005458 Bacteria 2136
24 Ga0070681_10610205 3300005458 Unclassified 1005
25 Ga0070681_10877024 3300005458 Bacteria 815
26 Ga0070685_10137536 3300005466 Unclassified 1534
27 Ga0070707_100142746 3300005468 Bacteria 2330
28 Ga0070679_100016837 3300005530 Bacteria 7065
29 Ga0070679_100389196 3300005530 Bacteria 1340
30 Ga0070684_100028372 3300005535 Bacteria 4735
31 Ga0070684_100037743 3300005535 Bacteria 4146
32 Ga0070684_100052684 3300005535 Bacteria 3540
33 Ga0068853_100160158 3300005539 Bacteria 2030
34 Ga0068853_100488889 3300005539 Unclassified 1161
35 Ga0070696_100085222 3300005546 Bacteria 2242
36 Ga0070665_100147724 3300005548 Bacteria 2353
37 Ga0070704_100352514 3300005549 Bacteria 1243
38 Ga0068855_100044268 3300005563 Bacteria 5268
39 Ga0068855_100048283 3300005563 Bacteria 5025
40 Ga0068855_100053657 3300005563 Bacteria 4741
41 Ga0068855_100082158 3300005563 Bacteria 3734
42 Ga0068855_100100021 3300005563 Bacteria 3339
43 Ga0068855_100155045 3300005563 Bacteria 2603
44 Ga0068855_100253288 3300005563 Bacteria 1963
45 Ga0070664_100380738 3300005564 Bacteria 1288
46 Ga0068856_100105806 3300005614 Bacteria 2807
47 Ga0068856_100218627 3300005614 Bacteria 1920
48 Ga0068852_100124936 3300005616 Bacteria 2361
49 Ga0068852_100242065 3300005616 Bacteria 1725
50 Ga0068852_100495279 3300005616 Bacteria 1216
51 Ga0068864_100697865 3300005618 Unclassified 991
52 Ga0068870_10052829 3300005840 Bacteria 2156
53 Ga0081455_10224677 3300005937 Bacteria 1389
54 Ga0081538_10097800 3300005981 Bacteria 1490
55 Ga0081539_10009993 3300005985 Bacteria 7816
56 Ga0070715_10047827 3300006163 Bacteria 1825
57 Ga0070715_10087224 3300006163 Bacteria 1428
58 Ga0070716_100377030 3300006173 Bacteria 1013
59 Ga0068871_100161024 3300006358 Bacteria 1919
60 Ga0075433_10067593 3300006852 Bacteria 3137
61 Ga0075434_100044514 3300006871 Bacteria 4403
62 Ga0075436_100177886 3300006914 Bacteria 1503
63 Ga0075436_100397647 3300006914 Bacteria 998
64 Ga0075435_100145891 3300007076 Bacteria 1988
65 Ga0075435_100273462 3300007076 Bacteria 1441
66 Ga0105240_10027332 3300009093 Bacteria 7470
67 Ga0105240_10229742 3300009093 Bacteria 2157
68 Ga0105245_10389449 3300009098 Bacteria 1390
69 Ga0105245_10581258 3300009098 Bacteria 1145
70 Ga0105247_10268245 3300009101 Bacteria 1173
71 Ga0114129_10505192 3300009147 Bacteria 1578
72 Ga0105243_10112679 3300009148 Bacteria 2279
73 Ga0105241_10266954 3300009174 Bacteria 1456
74 Ga0105242_10019073 3300009176 Bacteria 5373
75 Ga0105237_10140476 3300009545 Bacteria 2409
76 Ga0105237_10153863 3300009545 Bacteria 2296
77 Ga0105238_10010471 3300009551 Bacteria 9308
78 Ga0105238_10336370 3300009551 Bacteria 1497
79 Ga0105238_10339523 3300009551 Bacteria 1490
80 Ga0105239_10151131 3300010375 Bacteria 2591
81 Ga0105239_10448770 3300010375 Bacteria 1463
82 Ga0157373_10036199 3300013100 Bacteria 3544
83 Ga0157370_10022810 3300013104 Bacteria 6225
84 Ga0157370_10030499 3300013104 Bacteria 5283
85 Ga0157370_10071614 3300013104 Bacteria 3271
86 Ga0157369_10102218 3300013105 Bacteria 3054
87 Ga0157374_10175772 3300013296 Bacteria 2090
88 Ga0157378_10342752 3300013297 Bacteria 1458
89 Ga0157372_10045584 3300013307 Bacteria 4865
90 Ga0157372_10108712 3300013307 Bacteria 3174
91 Ga0157372_10143308 3300013307 Bacteria 2755
92 Ga0157372_10469235 3300013307 Bacteria 1467
93 Ga0157372_10578324 3300013307 Bacteria 1309
94 Ga0206356_10576581 3300020070 Bacteria 2477
95 Ga0206356_11257707 3300020070 Bacteria 2806
96 Ga0206356_11440208 3300020070 Bacteria 1595
97 Ga0206349_1052252 3300020075 Bacteria 989
98 Ga0206353_10049162 3300020082 Bacteria 3590
99 Ga0206353_10294858 3300020082 Bacteria 6316
100 Ga0206353_10702626 3300020082 Bacteria 1027
101 Ga0206353_11652292 3300020082 Bacteria 3994
102 Ga0213876_10089263 3300021384 Bacteria 1633
103 Ga0224712_10074239 3300022467 Bacteria 1389
104 Ga0224712_10204998 3300022467 Bacteria 897
105 Ga0207685_10006094 3300025905 Bacteria 3254
106 Ga0207643_10043082 3300025908 Bacteria 2546
107 Ga0207705_10236509 3300025909 Bacteria 1391
108 Ga0207707_10018852 3300025912 Bacteria 6017
109 Ga0207707_10053660 3300025912 Bacteria 3509
110 Ga0207707_10080843 3300025912 Bacteria 2837
111 Ga0207707_10088875 3300025912 Bacteria 2700
112 Ga0207707_10111451 3300025912 Bacteria 2392
113 Ga0207707_10204235 3300025912 Bacteria 1722
114 Ga0207707_10240197 3300025912 Bacteria 1575
115 Ga0207671_10065779 3300025914 Bacteria 2697
116 Ga0207671_10236275 3300025914 Bacteria 1435
117 Ga0207660_10276391 3300025917 Bacteria 1332
118 Ga0207657_10000317 3300025919 Bacteria 51095
119 Ga0207657_10012072 3300025919 Bacteria 8542
120 Ga0207657_10021101 3300025919 Bacteria 6137
121 Ga0207657_10100335 3300025919 Bacteria 2403
122 Ga0207657_10121406 3300025919 Bacteria 2150
123 Ga0207649_10026599 3300025920 Bacteria 3386
124 Ga0207652_10065274 3300025921 Bacteria 3152
125 Ga0207652_10086689 3300025921 Bacteria 2745
126 Ga0207652_10206547 3300025921 Bacteria 1768
127 Ga0207652_10252871 3300025921 Bacteria 1589
128 Ga0207652_10398386 3300025921 Bacteria 1242
129 Ga0207646_10396577 3300025922 Bacteria 1246
130 Ga0207694_10132034 3300025924 Bacteria 2002
131 Ga0207687_10198705 3300025927 Bacteria 1565
132 Ga0207687_10373234 3300025927 Unclassified 1167
133 Ga0207664_10172585 3300025929 Bacteria 1851
134 Ga0207664_10368733 3300025929 Bacteria 1273
135 Ga0207661_10073151 3300025944 Bacteria 2806
136 Ga0207661_10172239 3300025944 Bacteria 1885
137 Ga0207661_10204757 3300025944 Bacteria 1736
138 Ga0207667_10121633 3300025949 Bacteria 2690
139 Ga0207667_10129444 3300025949 Bacteria 2599
140 Ga0207667_10165578 3300025949 Bacteria 2273
141 Ga0207667_10599035 3300025949 Bacteria 1111
142 Ga0207639_10548287 3300026041 Bacteria 1061
143 Ga0207678_10066097 3300026067 Bacteria 3105
144 Ga0207678_10254638 3300026067 Bacteria 1504
145 Ga0207702_10118359 3300026078 Bacteria 2367
146 Ga0207674_10012345 3300026116 Bacteria 9550
147 Ga0207698_10075428 3300026142 Bacteria 2695
148 Ga0207698_10148217 3300026142 Bacteria 2033
149 Ga0207698_10345012 3300026142 Bacteria 1404
150 Ga0207698_10631744 3300026142 Bacteria 1059
151 Ga0268266_10079771 3300028379 Bacteria 2851
152 Ga0268266_10242189 3300028379 Bacteria 1665
153 Ga0265338_10083776 3300028800 Bacteria 2665
154 Ga0265327_10029163 3300031251 Bacteria 3142
155 Ga0265327_10030404 3300031251 Bacteria 3054
156 Ga0265316_10103664 3300031344 Bacteria 2159
157 Ga0265314_10130640 3300031711 Bacteria 1567
158 Ga0265342_10040770 3300031712 Bacteria 2814
159 Ga0307409_100375999 3300031995 Unclassified 1349
160 Ga0307416_100087398 3300032002 Bacteria 2661
161 Ga0307416_100978128 3300032002 Bacteria 949
162 Ga0373926_0042429 3300035083 Bacteria 1627
163 Ga0373943_0010025 3300035170 Bacteria 4249
164 Ga0373925_0030447 3300037068 Bacteria 3961
165 Ga0395899_0157771 3300037312 Unclassified 1605
166 Ga0395900_0009289 3300037418 Bacteria 10081
167 Ga0395900_0116583 3300037418 Bacteria 2740
168 Ga0395900_0747905 3300037418 Bacteria 908
169 Ga0395898_0036166 3300037466 Bacteria 4904
170 Ga0395898_0079989 3300037466 Bacteria 3152
171 Ga0395898_0318008 3300037466 Bacteria 1485
172 Ga0395898_0649854 3300037466 Viruses 997
173 Ga0395898_0687304 3300037466 Bacteria 965
174 Ga0395905_0007009 3300037471 Bacteria 11267
175 Ga0395905_0033296 3300037471 Bacteria 4842
176 Ga0395905_0236584 3300037471 Unclassified 1707
177 Ga0395901_0003949 3300038443 Bacteria 14919
178 Ga0395901_0033810 3300038443 Bacteria 5279
179 Ga0395901_0033992 3300038443 Bacteria 5264
180 Ga0395901_0075237 3300038443 Bacteria 3523
181 Ga0395901_0270775 3300038443 Bacteria 1766
182 Ga0395901_0271897 3300038443 Bacteria 1762
183 Ga0395901_0717205 3300038443 Bacteria 996
184 Ga0436365_0076560 3300039437 Bacteria 1859
185 Ga0436365_1327309 3300039437 Bacteria 2742
186 Ga0439453_0001367 3300041408 Bacteria 3114
187 Ga0439461_0008656 3300041410 Bacteria 1829
188 Ga0439437_003365 3300042000 Bacteria 1724
189 Ga0439442_016477 3300042002 Bacteria 1524
190 Ga0439432_044984 3300042006 Bacteria 1390
191 Ga0439449_0007169 3300042007 Bacteria 4241
192 Ga0439454_003345 3300042011 Bacteria 1776
193 Ga0439462_0037941 3300042015 Bacteria 1284
194 Ga0439446_0000406 3300042156 Bacteria 8327
195 Ga0439446_0007955 3300042156 Bacteria 2801
196 Ga0466966_0004414 3300044684 Bacteria 9281
197 Ga0466966_0089317 3300044684 Bacteria 1914
198 Ga0466961_0002522 3300044693 Bacteria 11359
199 Ga0466961_0016470 3300044693 Bacteria 4750
200 Ga0466963_0002864 3300044694 Bacteria 9740
201 Ga0466963_0011739 3300044694 Bacteria 5341
202 Ga0466963_0014276 3300044694 Bacteria 4895
203 Ga0466963_0025541 3300044694 Bacteria 3769
204 Ga0466963_0074515 3300044694 Bacteria 2289
205 Ga0466963_0079530 3300044694 Bacteria 2218
206 Ga0466963_0151354 3300044694 Bacteria 1611
207 Ga0466963_0263806 3300044694 Bacteria 1209
208 Ga0466964_0017090 3300044706 Bacteria 2775
209 Ga0466964_0035294 3300044706 Bacteria 1998
210 Ga0466964_0054300 3300044706 Bacteria 1651
211 Ga0466971_0001396 3300044719 Bacteria 10143
212 Ga0466971_0051299 3300044719 Bacteria 1856
213 Ga0466971_0082538 3300044719 Bacteria 1467
214 Ga0466957_0000929 3300044842 Bacteria 14986
215 Ga0466957_0042169 3300044842 Bacteria 2760
216 Ga0466957_0100020 3300044842 Bacteria 1827
217 Ga0466957_0208400 3300044842 Bacteria 1286
218 Ga0466959_0020555 3300045049 Bacteria 4865
219 Ga0466959_0023827 3300045049 Bacteria 4532
220 Ga0466959_0239800 3300045049 Bacteria 1253
221 Ga0466958_0002209 3300045836 Bacteria 9696
222 Ga0466958_0040811 3300045836 Bacteria 2789
223 Ga0466958_0086760 3300045836 Bacteria 1932
224 Ga0466958_0195341 3300045836 Bacteria 1287
225 Ga0466967_0004229 3300045976 Bacteria 9633
226 Ga0466967_0004792 3300045976 Bacteria 9215
227 Ga0466967_0016419 3300045976 Bacteria 5838
228 Ga0466967_0018433 3300045976 Bacteria 5577
229 Ga0466967_0019103 3300045976 Bacteria 5502
230 Ga0466967_0041182 3300045976 Bacteria 3981
231 Ga0466967_0051790 3300045976 Bacteria 3600
232 Ga0466967_0053300 3300045976 Bacteria 3554
233 Ga0466967_0054351 3300045976 Bacteria 3524
234 Ga0466967_0072002 3300045976 Bacteria 3096
235 Ga0466967_0072848 3300045976 Bacteria 3080
236 Ga0466967_0702040 3300045976 Bacteria 1002
237 Ga0495603_0174454 3300046455 Bacteria 1245
238 Ga0495641_0136437 3300046461 Bacteria 1095
239 Ga0495652_0231731 3300046529 Bacteria 1381
240 Ga0495611_0152544 3300046648 Unclassified 1079
241 Ga0495588_0145367 3300046674 Bacteria 1253
242 Ga0495658_0341234 3300046683 Bacteria 951
243 Ga0495676_0045441 3300047321 Bacteria 3575
244 Ga0496100_0006618 3300048903 Bacteria 6333
245 Ga0496100_0009463 3300048903 Bacteria 5478
246 Ga0496100_0132661 3300048903 Bacteria 1756
247 Ga0496101_0019739 3300048904 Bacteria 4607
248 Ga0496101_0081943 3300048904 Bacteria 2387
249 Ga0496102_0003582 3300048905 Bacteria 13149
250 Ga0496102_0049926 3300048905 Bacteria 3808
251 Ga0496102_0236126 3300048905 Bacteria 1724
252 Ga0496104_0116397 3300048907 Bacteria 2565
253 Ga0496105_0011983 3300048908 Bacteria 6865
254 Ga0496106_0003528 3300048909 Bacteria 11653
255 Ga0496106_0030191 3300048909 Bacteria 4041
256 Ga0496107_0005690 3300048910 Bacteria 8528
257 Ga0496107_0043788 3300048910 Bacteria 3216
258 Ga0496107_0428094 3300048910 Bacteria 984
259 Ga0496108_0008467 3300048911 Bacteria 8345
260 Ga0496108_0138102 3300048911 Bacteria 2099
261 Ga0496109_0034974 3300048912 Bacteria 4529
262 Ga0496109_0414925 3300048912 Bacteria 1272
263 Ga0496111_0037072 3300048914 Bacteria 3489
264 Ga0496111_0550087 3300048914 Bacteria 847
265 Ga0496112_0003293 3300048915 Bacteria 13333
266 Ga0496112_0245064 3300048915 Bacteria 1744
267 Ga0496113_0160082 3300048916 Bacteria 1779
268 Ga0496114_0008756 3300048917 Bacteria 8016
269 Ga0496115_0385131 3300048918 Bacteria 1140
270 Ga0501031_0004934 3300049568 Bacteria 8674
271 Ga0501033_0032715 3300049570 Bacteria 3906
272 Ga0501039_0007651 3300049575 Bacteria 8249
273 Ga0501040_0051575 3300049576 Bacteria 2814
274 Ga0501041_0230324 3300049577 Bacteria 1163
275 Ga0501042_0061718 3300049578 Bacteria 2677
276 Ga0501046_0256256 3300049580 Bacteria 1286
277 Ga0501048_0042309 3300049582 Bacteria 3262
278 Ga0501067_0000306 3300049583 Bacteria 26960
279 Ga0501067_0020643 3300049583 Bacteria 3645
280 Ga0501067_0258251 3300049583 Unclassified 970
281 Ga0501069_0257132 3300049585 Bacteria 1019
282 Ga0501070_0002893 3300049586 Bacteria 14969
283 Ga0501071_0001858 3300049587 Bacteria 12520
284 Ga0501072_0142881 3300049588 Bacteria 1908
285 Ga0501074_0036855 3300049590 Bacteria 3543
286 Ga0501074_0054850 3300049590 Bacteria 2874
287 Ga0501074_0124739 3300049590 Bacteria 1842
288 Ga0501075_0036032 3300049591 Bacteria 3691
289 Ga0501076_0006121 3300049592 Bacteria 8709
290 Ga0501077_0004120 3300049593 Bacteria 8779
291 Ga0501080_0036593 3300049742 Bacteria 4581
292 Ga0501080_0441567 3300049742 Bacteria 1167
293 Ga0501081_0292397 3300049743 Bacteria 1194
294 Ga0501083_0219435 3300049744 Bacteria 1239
295 Ga0501035_0010620 3300049822 Bacteria 8527
296 nmdc:mga05p37_43470_c1 3300050507 Bacteria 5528
297 nmdc:mga0n895_4525_c1 3300050512 Bacteria 11439
298 nmdc:mga0n895_9636_c1 3300050512 Bacteria 2781
299 nmdc:mga0rr50_258357_c1 3300050513 Bacteria 1449
300 nmdc:mga0a205_5827_c2 3300050515 Bacteria 7066
301 nmdc:mga0a205_711052_c1 3300050515 Unclassified 854
302 Ga0495601_0160987 3300053077 Bacteria 1467
303 Ga0501084_0014349 3300054114 Bacteria 6564
304 Ga0501082_0018761 3300060353 Bacteria 5960
305 Ga0466962_0000864 3300061719 Bacteria 13743
306 Ga0530510_0105218 3300061734 Bacteria 2065
307 Ga0206353_10844698
308 Ga0070658_10227217
309 Ga0070683_100325328
310 Ga0070680_100049186
311 Ga0070680_100110646
312 Ga0070680_100181301
313 Ga0070660_100014660
314 Ga0070660_100032987
315 Ga0070660_100254933
316 Ga0070660_100337708
317 Ga0070661_100057948
318 Ga0070659_100093474
319 Ga0070659_100306213
320 Ga0070714_100161979
321 Ga0070714_100448345
322 Ga0070663_100053851
323 Ga0070678_100260116
324 Ga0070681_10015095
325 Ga0070681_10020946
326 Ga0070681_10032791
327 Ga0070681_10046936
328 Ga0070681_10136220
329 Ga0070681_10165266
330 Ga0070681_10610205
331 Ga0070681_10877024
332 Ga0070685_10137536
333 Ga0070707_100142746
334 Ga0070679_100016837
335 Ga0070679_100389196
336 Ga0070684_100028372
337 Ga0070684_100037743
338 Ga0070684_100052684
339 Ga0068853_100160158
340 Ga0068853_100488889
341 Ga0070696_100085222
342 Ga0070665_100147724
343 Ga0070704_100352514
344 Ga0068855_100044268
345 Ga0068855_100048283
346 Ga0068855_100053657
347 Ga0068855_100082158
348 Ga0068855_100100021
349 Ga0068855_100155045
350 Ga0068855_100253288
351 Ga0070664_100380738
352 Ga0068856_100105806
353 Ga0068856_100218627
354 Ga0068852_100124936
355 Ga0068852_100242065
356 Ga0068852_100495279
357 Ga0068864_100697865
358 Ga0068870_10052829
359 Ga0081455_10224677
360 Ga0081538_10097800
361 Ga0081539_10009993
362 Ga0070715_10047827
363 Ga0070715_10087224
364 Ga0070716_100377030
365 Ga0068871_100161024
366 Ga0075433_10067593
367 Ga0075434_100044514
368 Ga0075436_100177886
369 Ga0075436_100397647
370 Ga0075435_100145891
371 Ga0075435_100273462
372 Ga0105240_10027332
373 Ga0105240_10229742
374 Ga0105245_10389449
375 Ga0105245_10581258
376 Ga0105247_10268245
377 Ga0114129_10505192
378 Ga0105243_10112679
379 Ga0105241_10266954
380 Ga0105242_10019073
381 Ga0105237_10140476
382 Ga0105237_10153863
383 Ga0105238_10010471
384 Ga0105238_10336370
385 Ga0105238_10339523
386 Ga0105239_10151131
387 Ga0105239_10448770
388 Ga0157373_10036199
389 Ga0157370_10022810
390 Ga0157370_10030499
391 Ga0157370_10071614
392 Ga0157369_10102218
393 Ga0157374_10175772
394 Ga0157378_10342752
395 Ga0157372_10045584
396 Ga0157372_10108712
397 Ga0157372_10143308
398 Ga0157372_10469235
399 Ga0157372_10578324
400 Ga0206356_10576581
401 Ga0206356_11257707
402 Ga0206356_11440208
403 Ga0206349_1052252
404 Ga0206353_10049162
405 Ga0206353_10294858
406 Ga0206353_10702626
407 Ga0206353_11652292
408 Ga0213876_10089263
409 Ga0224712_10074239
410 Ga0224712_10204998
411 Ga0207685_10006094
412 Ga0207643_10043082
413 Ga0207705_10236509
414 Ga0207707_10018852
415 Ga0207707_10053660
416 Ga0207707_10080843
417 Ga0207707_10088875
418 Ga0207707_10111451
419 Ga0207707_10204235
420 Ga0207707_10240197
421 Ga0207671_10065779
422 Ga0207671_10236275
423 Ga0207660_10276391
424 Ga0207657_10000317
425 Ga0207657_10012072
426 Ga0207657_10021101
427 Ga0207657_10100335
428 Ga0207657_10121406
429 Ga0207649_10026599
430 Ga0207652_10065274
431 Ga0207652_10086689
432 Ga0207652_10206547
433 Ga0207652_10252871
434 Ga0207652_10398386
435 Ga0207646_10396577
436 Ga0207694_10132034
437 Ga0207687_10198705
438 Ga0207687_10373234
439 Ga0207664_10172585
440 Ga0207664_10368733
441 Ga0207661_10073151
442 Ga0207661_10172239
443 Ga0207661_10204757
444 Ga0207667_10121633
445 Ga0207667_10129444
446 Ga0207667_10165578
447 Ga0207667_10599035
448 Ga0207639_10548287
449 Ga0207678_10066097
450 Ga0207678_10254638
451 Ga0207702_10118359
452 Ga0207674_10012345
453 Ga0207698_10075428
454 Ga0207698_10148217
455 Ga0207698_10345012
456 Ga0207698_10631744
457 Ga0268266_10079771
458 Ga0268266_10242189
459 Ga0265338_10083776
460 Ga0265327_10029163
461 Ga0265327_10030404
462 Ga0265316_10103664
463 Ga0265314_10130640
464 Ga0265342_10040770
465 Ga0307409_100375999
466 Ga0307416_100087398
467 Ga0307416_100978128
468 Ga0373926_0042429
469 Ga0373943_0010025
470 Ga0373925_0030447
471 Ga0395899_0157771
472 Ga0395900_0009289
473 Ga0395900_0116583
474 Ga0395900_0747905
475 Ga0395898_0036166
476 Ga0395898_0079989
477 Ga0395898_0318008
478 Ga0395898_0649854
479 Ga0395898_0687304
480 Ga0395905_0007009
481 Ga0395905_0033296
482 Ga0395905_0236584
483 Ga0395901_0003949
484 Ga0395901_0033810
485 Ga0395901_0033992
486 Ga0395901_0075237
487 Ga0395901_0270775
488 Ga0395901_0271897
489 Ga0395901_0717205
490 Ga0436365_0076560
491 Ga0436365_1327309
492 Ga0439453_0001367
493 Ga0439461_0008656
494 Ga0439437_003365
495 Ga0439442_016477
496 Ga0439432_044984
497 Ga0439449_0007169
498 Ga0439454_003345
499 Ga0439462_0037941
500 Ga0439446_0000406
501 Ga0439446_0007955
502 Ga0466966_0004414
503 Ga0466966_0089317
504 Ga0466961_0002522
505 Ga0466961_0016470
506 Ga0466963_0002864
507 Ga0466963_0011739
508 Ga0466963_0014276
509 Ga0466963_0025541
510 Ga0466963_0074515
511 Ga0466963_0079530
512 Ga0466963_0151354
513 Ga0466963_0263806
514 Ga0466964_0017090
515 Ga0466964_0035294
516 Ga0466964_0054300
517 Ga0466971_0001396
518 Ga0466971_0051299
519 Ga0466971_0082538
520 Ga0466957_0000929
521 Ga0466957_0042169
522 Ga0466957_0100020
523 Ga0466957_0208400
524 Ga0466959_0020555
525 Ga0466959_0023827
526 Ga0466959_0239800
527 Ga0466958_0002209
528 Ga0466958_0040811
529 Ga0466958_0086760
530 Ga0466958_0195341
531 Ga0466967_0004229
532 Ga0466967_0004792
533 Ga0466967_0016419
534 Ga0466967_0018433
535 Ga0466967_0019103
536 Ga0466967_0041182
537 Ga0466967_0051790
538 Ga0466967_0053300
539 Ga0466967_0054351
540 Ga0466967_0072002
541 Ga0466967_0072848
542 Ga0466967_0702040
543 Ga0495603_0174454
544 Ga0495641_0136437
545 Ga0495652_0231731
546 Ga0495611_0152544
547 Ga0495588_0145367
548 Ga0495658_0341234
549 Ga0495676_0045441
550 Ga0496100_0006618
551 Ga0496100_0009463
552 Ga0496100_0132661
553 Ga0496101_0019739
554 Ga0496101_0081943
555 Ga0496102_0003582
556 Ga0496102_0049926
557 Ga0496102_0236126
558 Ga0496104_0116397
559 Ga0496105_0011983
560 Ga0496106_0003528
561 Ga0496106_0030191
562 Ga0496107_0005690
563 Ga0496107_0043788
564 Ga0496107_0428094
565 Ga0496108_0008467
566 Ga0496108_0138102
567 Ga0496109_0034974
568 Ga0496109_0414925
569 Ga0496111_0037072
570 Ga0496111_0550087
571 Ga0496112_0003293
572 Ga0496112_0245064
573 Ga0496113_0160082
574 Ga0496114_0008756
575 Ga0496115_0385131
576 Ga0501031_0004934
577 Ga0501033_0032715
578 Ga0501039_0007651
579 Ga0501040_0051575
580 Ga0501041_0230324
581 Ga0501042_0061718
582 Ga0501046_0256256
583 Ga0501048_0042309
584 Ga0501067_0000306
585 Ga0501067_0020643
586 Ga0501067_0258251
587 Ga0501069_0257132
588 Ga0501070_0002893
589 Ga0501071_0001858
590 Ga0501072_0142881
591 Ga0501074_0036855
592 Ga0501074_0054850
593 Ga0501074_0124739
594 Ga0501075_0036032
595 Ga0501076_0006121
596 Ga0501077_0004120
597 Ga0501080_0036593
598 Ga0501080_0441567
599 Ga0501081_0292397
600 Ga0501083_0219435
601 Ga0501035_0010620
602 nmdc:mga05p37_43470_c1
603 nmdc:mga0n895_4525_c1
604 nmdc:mga0n895_9636_c1
605 nmdc:mga0rr50_258357_c1
606 nmdc:mga0a205_5827_c2
607 nmdc:mga0a205_711052_c1
608 Ga0495601_0160987
609 Ga0501084_0014349
610 Ga0501082_0018761
611 Ga0466962_0000864
612 Ga0530510_0105218

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07136

DUF1385

Protein of unknown function (DUF1385)

130

273

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
8d9k-assembly1.cif.gz_B cryoem structure of human mettl1-wdr4 in complex with lys-trna 0.8312 14 46
8eg0-assembly1.cif.gz_B cryoem structure of human mettl1-wdr4 in complex with lys-trna and sah 0.818 14 45
4uuy-assembly1.cif.gz_B structural identification of the vps18 beta-propeller reveals a critical role in the hops complex stability and function. 0.7363 12 50
2xvg-assembly1.cif.gz_A crystal structure of alpha-xylosidase (gh31) from cellvibrio japonicus 0.7267 12 52
4uuy-assembly1.cif.gz_A structural identification of the vps18 beta-propeller reveals a critical role in the hops complex stability and function. 0.7163 10 50
ID Description Score Start End Superfamily
5jouA01 Mainly Beta;Sandwich;Immunoglobulin-like;glycosyl hydrolase (family 31) 0.8778 10 44 2.60.40.1760
2xvgA01 Mainly Beta;Sandwich;Immunoglobulin-like;glycosyl hydrolase (family 31) 0.8702 12 44 2.60.40.1760
af_Q550R3_25_280_3.30.2140.20 Alpha Beta;2-Layer Sandwich;Arylamine N-acetyltransferase fold; 0.8657 14 47 3.30.2140.20
af_Q8GYH4_50_377_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8519 16 47 2.130.10.10
af_Q54KU4_25_278_3.30.2140.20 Alpha Beta;2-Layer Sandwich;Arylamine N-acetyltransferase fold; 0.8197 16 47 3.30.2140.20
ID Description Score Start End GO Terms
AF-A0A538M2S2-F1-model_v4 DUF1385 domain-containing protein 0.979 2 253 GO:0016020
AF-A0A538M2S2-F1-model_v4 DUF1385 domain-containing protein 0.9714 2 253 GO:0016020
AF-A0A7V9DHR5-F1-model_v4 DUF1385 domain-containing protein 0.9332 127 253
AF-A0A538DJY6-F1-model_v4 DUF1385 domain-containing protein 0.9303 53 252 GO:0016020
AF-A0A7V9DHR5-F1-model_v4 DUF1385 domain-containing protein 0.9193 127 253

Map