F398674

General Info

Members Datasets Scaffolds Average Seq Length
306 173 612 409

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_10196145|Ga0157375_101961452
Length 411
Sequence VSGKFQAPRGTHDVLPSDGTWWGVLRTMEETAQLYGWRRIQTPGFEDTALFERTSGEASDVVHKEMYTFTDRSDRSLTLRPEGTAPIARAYLEHGMQREPQPVKAYTIAPMYRYGRPGRGRYREHYQLSVEAIGSDDPALDAEVIELYTEILRRIGVTQWELHLNSIGDEHCRPAYVEQLTAWLDAHDDLLDEEARHKRETSPLQVFDVKNPLLREALADAPKIGESLCDECRAHFELVQQHLTALGVPFVLDPTLVRGLDYYTRTTFEFIGPDENVNSTICGGGRYDGLVQAVGGPPTPGIGFGAGIERLLLAVENEGTTWEPPHVAVFVVVDGGSRETAQTVLQQLRRAGVAADMDYAGRSTKGQLSQASRSGAPTVVILREGDAVVRAAGRQDVTVAVGEVVATLTGP

Samples

Sample ID Description Type Environment
1 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
28 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
68 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
70 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
71 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
72 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
73 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
74 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
75 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
76 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
77 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
78 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
79 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
80 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
81 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
82 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
83 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
84 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
85 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
88 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
89 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
90 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
93 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
94 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
95 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
96 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
97 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
98 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
99 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
100 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
101 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
102 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
103 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
104 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
105 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
106 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
107 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
108 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
109 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
110 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
111 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
112 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
113 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
114 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
115 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
116 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
117 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
118 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
119 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
120 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
121 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
122 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
123 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
124 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
125 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
126 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
127 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
128 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
129 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
130 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
131 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
132 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
133 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
134 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
135 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
136 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
137 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
138 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
139 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
140 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
141 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
142 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
143 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
146 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
147 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
148 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
156 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
159 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
160 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
161 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
162 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
163 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
166 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
167 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
168 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
169 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
170 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
171 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
172 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
173 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.37
Metatranscriptomes 1.63
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 13.07
Rhizosphere 86.6
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157375_10196145 3300013308 Bacteria 2174
2 Ga0070658_10006215 3300005327 Bacteria 9682
3 Ga0070658_10020660 3300005327 Bacteria 5275
4 Ga0070683_100016225 3300005329 Bacteria 6562
5 Ga0070683_100035559 3300005329 Bacteria 4553
6 Ga0070683_100105711 3300005329 Bacteria 2654
7 Ga0070680_100019121 3300005336 Bacteria 5424
8 Ga0070680_100036027 3300005336 Bacteria 3996
9 Ga0070680_100114488 3300005336 Bacteria 2247
10 Ga0070682_100062355 3300005337 Bacteria 2361
11 Ga0070682_100097645 3300005337 Bacteria 1934
12 Ga0070660_100001356 3300005339 Bacteria 16658
13 Ga0070660_100012738 3300005339 Bacteria 6012
14 Ga0070660_100016347 3300005339 Bacteria 5385
15 Ga0070661_100029092 3300005344 Bacteria 3986
16 Ga0070671_100165551 3300005355 Bacteria 1869
17 Ga0070659_100220561 3300005366 Bacteria 1565
18 Ga0070713_100058297 3300005436 Bacteria 3220
19 Ga0070713_100308871 3300005436 Bacteria 1458
20 Ga0070711_100066365 3300005439 Bacteria 2527
21 Ga0070694_100099627 3300005444 Bacteria 2054
22 Ga0070678_100018613 3300005456 Bacteria 4505
23 Ga0070681_10002135 3300005458 Bacteria 17966
24 Ga0070681_10004035 3300005458 Bacteria 13852
25 Ga0070681_10009250 3300005458 Bacteria 9685
26 Ga0070681_10067915 3300005458 Bacteria 3532
27 Ga0070681_10182164 3300005458 Bacteria 2022
28 Ga0070706_100296070 3300005467 Bacteria 1510
29 Ga0070679_100008486 3300005530 Bacteria 9677
30 Ga0070679_100015080 3300005530 Bacteria 7426
31 Ga0070679_100038955 3300005530 Bacteria 4726
32 Ga0070679_100039880 3300005530 Bacteria 4668
33 Ga0070679_100102973 3300005530 Bacteria 2841
34 Ga0070684_100001040 3300005535 Bacteria 19816
35 Ga0070684_100141362 3300005535 Bacteria 2177
36 Ga0070697_100145256 3300005536 Bacteria 1996
37 Ga0068853_100038359 3300005539 Bacteria 4081
38 Ga0068853_100214500 3300005539 Bacteria 1755
39 Ga0070686_100054514 3300005544 Bacteria 2558
40 Ga0070693_100008957 3300005547 Bacteria 4965
41 Ga0070665_100025090 3300005548 Bacteria 6008
42 Ga0068855_100058170 3300005563 Bacteria 4528
43 Ga0068855_100064318 3300005563 Bacteria 4278
44 Ga0068855_100090705 3300005563 Bacteria 3526
45 Ga0068855_100166957 3300005563 Bacteria 2494
46 Ga0068855_100325216 3300005563 Bacteria 1699
47 Ga0068854_100039910 3300005578 Bacteria 3309
48 Ga0068856_100105481 3300005614 Bacteria 2812
49 Ga0081455_10153517 3300005937 Bacteria 1773
50 Ga0081540_1002947 3300005983 Bacteria 13675
51 Ga0070715_10048918 3300006163 Bacteria 1810
52 Ga0075428_100044962 3300006844 Bacteria 4853
53 Ga0075431_100013848 3300006847 Bacteria 8145
54 Ga0075433_10002683 3300006852 Bacteria 13591
55 Ga0075433_10129002 3300006852 Bacteria 2247
56 Ga0075434_100010733 3300006871 Bacteria 8601
57 Ga0075434_100038366 3300006871 Bacteria 4744
58 Ga0075436_100002352 3300006914 Bacteria 13055
59 Ga0075435_100171383 3300007076 Bacteria 1831
60 Ga0105240_10080316 3300009093 Bacteria 4011
61 Ga0111539_10045917 3300009094 Bacteria 5228
62 Ga0114129_10005074 3300009147 Bacteria 18535
63 Ga0105242_10100648 3300009176 Bacteria 2448
64 Ga0105237_10292140 3300009545 Bacteria 1633
65 Ga0105238_10038400 3300009551 Bacteria 4863
66 Ga0105238_10063517 3300009551 Bacteria 3693
67 Ga0105239_10338815 3300010375 Bacteria 1697
68 Ga0105239_10361049 3300010375 Bacteria 1640
69 Ga0157370_10056980 3300013104 Bacteria 3718
70 Ga0157370_10061933 3300013104 Bacteria 3550
71 Ga0157369_10002867 3300013105 Bacteria 20583
72 Ga0157369_10039163 3300013105 Bacteria 5180
73 Ga0157369_10053916 3300013105 Bacteria 4343
74 Ga0157369_10119083 3300013105 Bacteria 2802
75 Ga0157369_10127862 3300013105 Bacteria 2693
76 Ga0157378_10032332 3300013297 Bacteria 4623
77 Ga0157372_10048436 3300013307 Bacteria 4724
78 Ga0157372_10227303 3300013307 Bacteria 2163
79 Ga0157372_10455424 3300013307 Bacteria 1491
80 Ga0206356_10247448 3300020070 Bacteria 4535
81 Ga0206356_10440255 3300020070 Bacteria 4224
82 Ga0206353_10039862 3300020082 Bacteria 4663
83 Ga0206353_11366223 3300020082 Bacteria 2829
84 Ga0206353_11548617 3300020082 Bacteria 4199
85 Ga0207707_10025197 3300025912 Bacteria 5203
86 Ga0207693_10026782 3300025915 Bacteria 4561
87 Ga0207660_10019062 3300025917 Bacteria 4582
88 Ga0207660_10073383 3300025917 Bacteria 2494
89 Ga0207657_10000729 3300025919 Bacteria 34956
90 Ga0207657_10009664 3300025919 Bacteria 9678
91 Ga0207657_10016047 3300025919 Bacteria 7230
92 Ga0207657_10046851 3300025919 Bacteria 3785
93 Ga0207649_10030079 3300025920 Bacteria 3213
94 Ga0207652_10025393 3300025921 Bacteria 4926
95 Ga0207652_10066476 3300025921 Bacteria 3125
96 Ga0207652_10071523 3300025921 Bacteria 3014
97 Ga0207652_10073229 3300025921 Bacteria 2980
98 Ga0207652_10094525 3300025921 Bacteria 2632
99 Ga0207694_10029420 3300025924 Bacteria 4192
100 Ga0207687_10021330 3300025927 Bacteria 4303
101 Ga0207700_10036036 3300025928 Bacteria 3569
102 Ga0207664_10116260 3300025929 Bacteria 2231
103 Ga0207644_10145496 3300025931 Bacteria 1829
104 Ga0207644_10236903 3300025931 Bacteria 1452
105 Ga0207690_10175368 3300025932 Bacteria 1609
106 Ga0207686_10063440 3300025934 Bacteria 2350
107 Ga0207661_10006591 3300025944 Bacteria 8211
108 Ga0207661_10063814 3300025944 Bacteria 2984
109 Ga0207661_10099004 3300025944 Bacteria 2444
110 Ga0207661_10148477 3300025944 Bacteria 2025
111 Ga0207661_10293696 3300025944 Bacteria 1455
112 Ga0207667_10059157 3300025949 Bacteria 4015
113 Ga0207640_10047183 3300025981 Bacteria 2777
114 Ga0207702_10255826 3300026078 Bacteria 1647
115 Ga0207674_10054873 3300026116 Bacteria 4055
116 Ga0207683_10015670 3300026121 Bacteria 6452
117 Ga0207683_10077092 3300026121 Bacteria 2952
118 Ga0207428_10016238 3300027907 Bacteria 6411
119 Ga0268266_10058071 3300028379 Bacteria 3331
120 Ga0265338_10062559 3300028800 Bacteria 3251
121 Ga0265339_10014780 3300031249 Bacteria 4698
122 Ga0265342_10091560 3300031712 Bacteria 1742
123 Ga0307410_10049663 3300031852 Bacteria 2817
124 Ga0307406_10073102 3300031901 Bacteria 2253
125 Ga0307409_100087739 3300031995 Bacteria 2536
126 Ga0307414_10106051 3300032004 Bacteria 2126
127 Ga0307415_100114840 3300032126 Bacteria 2005
128 Ga0373945_0002217 3300035116 Bacteria 6072
129 Ga0373945_0005203 3300035116 Bacteria 4158
130 Ga0373957_0039459 3300035120 Bacteria 1771
131 Ga0373943_0004307 3300035170 Bacteria 6459
132 Ga0373946_0003811 3300035171 Bacteria 5351
133 Ga0373946_0036598 3300035171 Bacteria 1991
134 Ga0373955_0049736 3300035172 Bacteria 2277
135 Ga0373924_0018961 3300035410 Bacteria 2660
136 Ga0373935_0028577 3300035692 Bacteria 3446
137 Ga0373947_0007242 3300035725 Bacteria 6430
138 Ga0373947_0019652 3300035725 Bacteria 3896
139 Ga0373937_0019963 3300036401 Bacteria 6001
140 Ga0373925_0011707 3300037068 Bacteria 6343
141 Ga0395899_0001704 3300037312 Bacteria 18327
142 Ga0395899_0013195 3300037312 Bacteria 6320
143 Ga0395900_0002083 3300037418 Bacteria 22427
144 Ga0395900_0039989 3300037418 Bacteria 4833
145 Ga0395898_0002500 3300037466 Bacteria 21621
146 Ga0395898_0004874 3300037466 Bacteria 14571
147 Ga0395898_0022125 3300037466 Bacteria 6440
148 Ga0395905_0001543 3300037471 Bacteria 27575
149 Ga0395905_0048160 3300037471 Bacteria 3995
150 Ga0395905_0049032 3300037471 Bacteria 3957
151 Ga0395905_0149892 3300037471 Bacteria 2194
152 Ga0395901_0000793 3300038443 Bacteria 35158
153 Ga0395901_0005251 3300038443 Bacteria 13079
154 Ga0395901_0007905 3300038443 Bacteria 10729
155 Ga0395901_0008703 3300038443 Bacteria 10256
156 Ga0395901_0030693 3300038443 Bacteria 5538
157 Ga0395901_0079648 3300038443 Bacteria 3421
158 Ga0436365_0049714 3300039437 Bacteria 3288
159 Ga0439433_0011656 3300041999 Bacteria 1926
160 Ga0466966_0030770 3300044684 Bacteria 3482
161 Ga0466961_0009661 3300044693 Bacteria 6141
162 Ga0466961_0018441 3300044693 Bacteria 4488
163 Ga0466963_0004000 3300044694 Bacteria 8526
164 Ga0466963_0006710 3300044694 Bacteria 6835
165 Ga0466963_0045339 3300044694 Bacteria 2896
166 Ga0466971_0000517 3300044719 Bacteria 15241
167 Ga0466957_0007238 3300044842 Bacteria 6272
168 Ga0466959_0012774 3300045049 Bacteria 6077
169 Ga0466959_0036304 3300045049 Bacteria 3642
170 Ga0451576_0071736 3300045051 Bacteria 3605
171 Ga0466958_0000293 3300045836 Bacteria 19554
172 Ga0466958_0014490 3300045836 Bacteria 4501
173 Ga0466958_0017429 3300045836 Bacteria 4152
174 Ga0466967_0001106 3300045976 Bacteria 14952
175 Ga0466967_0001267 3300045976 Bacteria 14313
176 Ga0466967_0010726 3300045976 Bacteria 6889
177 Ga0466967_0018116 3300045976 Bacteria 5618
178 Ga0466967_0031136 3300045976 Bacteria 4487
179 Ga0466967_0052131 3300045976 Bacteria 3589
180 Ga0466967_0204639 3300045976 Bacteria 1870
181 Ga0466967_0206815 3300045976 Bacteria 1860
182 Ga0495592_0030812 3300046454 Bacteria 4058
183 Ga0495629_0004514 3300046459 Bacteria 10412
184 Ga0495641_0003127 3300046461 Bacteria 12616
185 Ga0495651_0013734 3300046462 Bacteria 6262
186 Ga0495651_0036844 3300046462 Bacteria 3808
187 Ga0495651_0216604 3300046462 Bacteria 1328
188 Ga0495653_0017163 3300046463 Bacteria 5887
189 Ga0495582_0000462 3300046473 Bacteria 22207
190 Ga0495605_0038761 3300046474 Bacteria 2389
191 Ga0495639_0002317 3300046475 Bacteria 8332
192 Ga0495662_0002338 3300046476 Bacteria 9555
193 Ga0495664_0040905 3300046477 Bacteria 2742
194 Ga0495664_0046532 3300046477 Bacteria 2574
195 Ga0495664_0064000 3300046477 Bacteria 2192
196 Ga0495664_0102588 3300046477 Bacteria 1724
197 Ga0495594_0008714 3300046499 Bacteria 5231
198 Ga0495608_0013679 3300046511 Bacteria 5630
199 Ga0495608_0013746 3300046511 Bacteria 5615
200 Ga0495628_0076206 3300046516 Bacteria 2610
201 Ga0495628_0254781 3300046516 Bacteria 1309
202 Ga0495630_0015507 3300046517 Bacteria 5565
203 Ga0495630_0021222 3300046517 Bacteria 4796
204 Ga0495630_0023061 3300046517 Bacteria 4599
205 Ga0495630_0079354 3300046517 Bacteria 2476
206 Ga0495630_0098208 3300046517 Bacteria 2215
207 Ga0495652_0016920 3300046529 Bacteria 6515
208 Ga0495652_0092129 3300046529 Bacteria 2476
209 Ga0495652_0128484 3300046529 Bacteria 2010
210 Ga0495652_0143702 3300046529 Bacteria 1873
211 Ga0495665_0017075 3300046531 Bacteria 3904
212 Ga0495640_0006739 3300046533 Bacteria 9062
213 Ga0495586_0003530 3300046535 Bacteria 8384
214 Ga0495587_0017327 3300046536 Bacteria 4475
215 Ga0495667_0016510 3300046559 Bacteria 4987
216 Ga0495667_0044086 3300046559 Bacteria 2954
217 Ga0495634_0011078 3300046642 Bacteria 6580
218 Ga0495599_0045184 3300046678 Bacteria 2762
219 Ga0495599_0046787 3300046678 Bacteria 2712
220 Ga0495623_0031446 3300046679 Bacteria 3412
221 Ga0495646_0030792 3300046680 Bacteria 3348
222 Ga0495646_0038953 3300046680 Bacteria 2932
223 Ga0495647_0007220 3300046681 Bacteria 3716
224 Ga0495658_0000373 3300046683 Bacteria 25168
225 Ga0495658_0007800 3300046683 Bacteria 5299
226 Ga0495658_0039116 3300046683 Bacteria 2630
227 Ga0495613_0021983 3300046689 Bacteria 4755
228 Ga0495624_0029370 3300046690 Bacteria 3587
229 Ga0495624_0030196 3300046690 Bacteria 3532
230 Ga0495581_0004800 3300047315 Bacteria 7816
231 Ga0495604_0051516 3300047317 Bacteria 3190
232 Ga0495674_0007113 3300047319 Bacteria 10707
233 Ga0495676_0024720 3300047321 Bacteria 5193
234 Ga0495680_0020691 3300047322 Bacteria 5526
235 Ga0495680_0023427 3300047322 Bacteria 5133
236 Ga0495680_0028941 3300047322 Bacteria 4540
237 Ga0495680_0040047 3300047322 Bacteria 3734
238 Ga0495675_0041386 3300047444 Bacteria 2937
239 Ga0495684_0002223 3300047471 Bacteria 15550
240 Ga0495684_0021214 3300047471 Bacteria 5006
241 Ga0495602_0037120 3300048088 Bacteria 4526
242 Ga0495602_0040991 3300048088 Bacteria 4234
243 Ga0495614_0011324 3300048089 Bacteria 3926
244 Ga0496100_0017816 3300048903 Bacteria 4201
245 Ga0496100_0055623 3300048903 Bacteria 2586
246 Ga0496100_0064597 3300048903 Bacteria 2422
247 Ga0496100_0149262 3300048903 Bacteria 1665
248 Ga0496101_0015353 3300048904 Bacteria 5159
249 Ga0496101_0089797 3300048904 Bacteria 2284
250 Ga0496102_0004771 3300048905 Bacteria 11469
251 Ga0496102_0045452 3300048905 Bacteria 3987
252 Ga0496103_0031202 3300048906 Bacteria 3246
253 Ga0496104_0007918 3300048907 Bacteria 9422
254 Ga0496104_0011297 3300048907 Bacteria 7994
255 Ga0496104_0065422 3300048907 Bacteria 3450
256 Ga0496104_0344417 3300048907 Bacteria 1403
257 Ga0496105_0001614 3300048908 Bacteria 16000
258 Ga0496105_0017895 3300048908 Bacteria 5687
259 Ga0496105_0113516 3300048908 Bacteria 2235
260 Ga0496106_0011915 3300048909 Bacteria 6419
261 Ga0496106_0022586 3300048909 Bacteria 4676
262 Ga0496107_0004494 3300048910 Bacteria 9458
263 Ga0496107_0013891 3300048910 Bacteria 5629
264 Ga0496107_0096252 3300048910 Bacteria 2166
265 Ga0496107_0148646 3300048910 Bacteria 1733
266 Ga0496108_0029528 3300048911 Bacteria 4541
267 Ga0496109_0054716 3300048912 Bacteria 3640
268 Ga0496110_0003278 3300048913 Bacteria 12346
269 Ga0496110_0039031 3300048913 Bacteria 4133
270 Ga0496111_0013435 3300048914 Bacteria 5573
271 Ga0496111_0053134 3300048914 Bacteria 2926
272 Ga0496112_0002957 3300048915 Bacteria 13861
273 Ga0496112_0006645 3300048915 Bacteria 10184
274 Ga0496112_0058010 3300048915 Bacteria 3812
275 Ga0496112_0082273 3300048915 Bacteria 3184
276 Ga0496112_0213654 3300048915 Bacteria 1886
277 Ga0496112_0299098 3300048915 Bacteria 1555
278 Ga0496113_0102372 3300048916 Bacteria 2220
279 Ga0496114_0001590 3300048917 Bacteria 17228
280 Ga0496114_0005019 3300048917 Bacteria 10322
281 Ga0496114_0005213 3300048917 Bacteria 10153
282 Ga0496115_0002211 3300048918 Bacteria 13940
283 Ga0496115_0103995 3300048918 Bacteria 2330
284 Ga0501034_0207591 3300049571 Bacteria 1915
285 Ga0501047_0076454 3300049581 Bacteria 3222
286 Ga0501067_0000285 3300049583 Bacteria 27590
287 Ga0501069_0005681 3300049585 Bacteria 6496
288 Ga0501077_0002003 3300049593 Bacteria 12295
289 Ga0501080_0050054 3300049742 Bacteria 3889
290 Ga0501080_0072372 3300049742 Bacteria 3207
291 nmdc:mga05p37_300717_c1 3300050507 Bacteria 1907
292 nmdc:mga06r32_57080_c1 3300050510 Bacteria 3750
293 nmdc:mga08y16_227258_c1 3300050511 Bacteria 1931
294 nmdc:mga0n895_57839_c1 3300050512 Bacteria 3823
295 nmdc:mga0n895_66076_c1 3300050512 Bacteria 3581
296 nmdc:mga0rr50_170597_c1 3300050513 Bacteria 1773
297 nmdc:mga08x19_5666_c1 3300050514 Bacteria 7380
298 nmdc:mga0a205_19866_c1 3300050515 Bacteria 6337
299 nmdc:mga0a205_222506_c1 3300050515 Bacteria 1773
300 Ga0495655_0002574 3300053083 Bacteria 2900
301 Ga0495595_0037844 3300053084 Bacteria 2195
302 Ga0495619_0035839 3300053085 Bacteria 3229
303 Ga0495619_0058180 3300053085 Bacteria 2565
304 Ga0495619_0064043 3300053085 Bacteria 2450
305 Ga0466962_0003333 3300061719 Bacteria 7630
306 Ga0530510_0053777 3300061734 Bacteria 2909
307 Ga0157375_10196145
308 Ga0070658_10006215
309 Ga0070658_10020660
310 Ga0070683_100016225
311 Ga0070683_100035559
312 Ga0070683_100105711
313 Ga0070680_100019121
314 Ga0070680_100036027
315 Ga0070680_100114488
316 Ga0070682_100062355
317 Ga0070682_100097645
318 Ga0070660_100001356
319 Ga0070660_100012738
320 Ga0070660_100016347
321 Ga0070661_100029092
322 Ga0070671_100165551
323 Ga0070659_100220561
324 Ga0070713_100058297
325 Ga0070713_100308871
326 Ga0070711_100066365
327 Ga0070694_100099627
328 Ga0070678_100018613
329 Ga0070681_10002135
330 Ga0070681_10004035
331 Ga0070681_10009250
332 Ga0070681_10067915
333 Ga0070681_10182164
334 Ga0070706_100296070
335 Ga0070679_100008486
336 Ga0070679_100015080
337 Ga0070679_100038955
338 Ga0070679_100039880
339 Ga0070679_100102973
340 Ga0070684_100001040
341 Ga0070684_100141362
342 Ga0070697_100145256
343 Ga0068853_100038359
344 Ga0068853_100214500
345 Ga0070686_100054514
346 Ga0070693_100008957
347 Ga0070665_100025090
348 Ga0068855_100058170
349 Ga0068855_100064318
350 Ga0068855_100090705
351 Ga0068855_100166957
352 Ga0068855_100325216
353 Ga0068854_100039910
354 Ga0068856_100105481
355 Ga0081455_10153517
356 Ga0081540_1002947
357 Ga0070715_10048918
358 Ga0075428_100044962
359 Ga0075431_100013848
360 Ga0075433_10002683
361 Ga0075433_10129002
362 Ga0075434_100010733
363 Ga0075434_100038366
364 Ga0075436_100002352
365 Ga0075435_100171383
366 Ga0105240_10080316
367 Ga0111539_10045917
368 Ga0114129_10005074
369 Ga0105242_10100648
370 Ga0105237_10292140
371 Ga0105238_10038400
372 Ga0105238_10063517
373 Ga0105239_10338815
374 Ga0105239_10361049
375 Ga0157370_10056980
376 Ga0157370_10061933
377 Ga0157369_10002867
378 Ga0157369_10039163
379 Ga0157369_10053916
380 Ga0157369_10119083
381 Ga0157369_10127862
382 Ga0157378_10032332
383 Ga0157372_10048436
384 Ga0157372_10227303
385 Ga0157372_10455424
386 Ga0206356_10247448
387 Ga0206356_10440255
388 Ga0206353_10039862
389 Ga0206353_11366223
390 Ga0206353_11548617
391 Ga0207707_10025197
392 Ga0207693_10026782
393 Ga0207660_10019062
394 Ga0207660_10073383
395 Ga0207657_10000729
396 Ga0207657_10009664
397 Ga0207657_10016047
398 Ga0207657_10046851
399 Ga0207649_10030079
400 Ga0207652_10025393
401 Ga0207652_10066476
402 Ga0207652_10071523
403 Ga0207652_10073229
404 Ga0207652_10094525
405 Ga0207694_10029420
406 Ga0207687_10021330
407 Ga0207700_10036036
408 Ga0207664_10116260
409 Ga0207644_10145496
410 Ga0207644_10236903
411 Ga0207690_10175368
412 Ga0207686_10063440
413 Ga0207661_10006591
414 Ga0207661_10063814
415 Ga0207661_10099004
416 Ga0207661_10148477
417 Ga0207661_10293696
418 Ga0207667_10059157
419 Ga0207640_10047183
420 Ga0207702_10255826
421 Ga0207674_10054873
422 Ga0207683_10015670
423 Ga0207683_10077092
424 Ga0207428_10016238
425 Ga0268266_10058071
426 Ga0265338_10062559
427 Ga0265339_10014780
428 Ga0265342_10091560
429 Ga0307410_10049663
430 Ga0307406_10073102
431 Ga0307409_100087739
432 Ga0307414_10106051
433 Ga0307415_100114840
434 Ga0373945_0002217
435 Ga0373945_0005203
436 Ga0373957_0039459
437 Ga0373943_0004307
438 Ga0373946_0003811
439 Ga0373946_0036598
440 Ga0373955_0049736
441 Ga0373924_0018961
442 Ga0373935_0028577
443 Ga0373947_0007242
444 Ga0373947_0019652
445 Ga0373937_0019963
446 Ga0373925_0011707
447 Ga0395899_0001704
448 Ga0395899_0013195
449 Ga0395900_0002083
450 Ga0395900_0039989
451 Ga0395898_0002500
452 Ga0395898_0004874
453 Ga0395898_0022125
454 Ga0395905_0001543
455 Ga0395905_0048160
456 Ga0395905_0049032
457 Ga0395905_0149892
458 Ga0395901_0000793
459 Ga0395901_0005251
460 Ga0395901_0007905
461 Ga0395901_0008703
462 Ga0395901_0030693
463 Ga0395901_0079648
464 Ga0436365_0049714
465 Ga0439433_0011656
466 Ga0466966_0030770
467 Ga0466961_0009661
468 Ga0466961_0018441
469 Ga0466963_0004000
470 Ga0466963_0006710
471 Ga0466963_0045339
472 Ga0466971_0000517
473 Ga0466957_0007238
474 Ga0466959_0012774
475 Ga0466959_0036304
476 Ga0451576_0071736
477 Ga0466958_0000293
478 Ga0466958_0014490
479 Ga0466958_0017429
480 Ga0466967_0001106
481 Ga0466967_0001267
482 Ga0466967_0010726
483 Ga0466967_0018116
484 Ga0466967_0031136
485 Ga0466967_0052131
486 Ga0466967_0204639
487 Ga0466967_0206815
488 Ga0495592_0030812
489 Ga0495629_0004514
490 Ga0495641_0003127
491 Ga0495651_0013734
492 Ga0495651_0036844
493 Ga0495651_0216604
494 Ga0495653_0017163
495 Ga0495582_0000462
496 Ga0495605_0038761
497 Ga0495639_0002317
498 Ga0495662_0002338
499 Ga0495664_0040905
500 Ga0495664_0046532
501 Ga0495664_0064000
502 Ga0495664_0102588
503 Ga0495594_0008714
504 Ga0495608_0013679
505 Ga0495608_0013746
506 Ga0495628_0076206
507 Ga0495628_0254781
508 Ga0495630_0015507
509 Ga0495630_0021222
510 Ga0495630_0023061
511 Ga0495630_0079354
512 Ga0495630_0098208
513 Ga0495652_0016920
514 Ga0495652_0092129
515 Ga0495652_0128484
516 Ga0495652_0143702
517 Ga0495665_0017075
518 Ga0495640_0006739
519 Ga0495586_0003530
520 Ga0495587_0017327
521 Ga0495667_0016510
522 Ga0495667_0044086
523 Ga0495634_0011078
524 Ga0495599_0045184
525 Ga0495599_0046787
526 Ga0495623_0031446
527 Ga0495646_0030792
528 Ga0495646_0038953
529 Ga0495647_0007220
530 Ga0495658_0000373
531 Ga0495658_0007800
532 Ga0495658_0039116
533 Ga0495613_0021983
534 Ga0495624_0029370
535 Ga0495624_0030196
536 Ga0495581_0004800
537 Ga0495604_0051516
538 Ga0495674_0007113
539 Ga0495676_0024720
540 Ga0495680_0020691
541 Ga0495680_0023427
542 Ga0495680_0028941
543 Ga0495680_0040047
544 Ga0495675_0041386
545 Ga0495684_0002223
546 Ga0495684_0021214
547 Ga0495602_0037120
548 Ga0495602_0040991
549 Ga0495614_0011324
550 Ga0496100_0017816
551 Ga0496100_0055623
552 Ga0496100_0064597
553 Ga0496100_0149262
554 Ga0496101_0015353
555 Ga0496101_0089797
556 Ga0496102_0004771
557 Ga0496102_0045452
558 Ga0496103_0031202
559 Ga0496104_0007918
560 Ga0496104_0011297
561 Ga0496104_0065422
562 Ga0496104_0344417
563 Ga0496105_0001614
564 Ga0496105_0017895
565 Ga0496105_0113516
566 Ga0496106_0011915
567 Ga0496106_0022586
568 Ga0496107_0004494
569 Ga0496107_0013891
570 Ga0496107_0096252
571 Ga0496107_0148646
572 Ga0496108_0029528
573 Ga0496109_0054716
574 Ga0496110_0003278
575 Ga0496110_0039031
576 Ga0496111_0013435
577 Ga0496111_0053134
578 Ga0496112_0002957
579 Ga0496112_0006645
580 Ga0496112_0058010
581 Ga0496112_0082273
582 Ga0496112_0213654
583 Ga0496112_0299098
584 Ga0496113_0102372
585 Ga0496114_0001590
586 Ga0496114_0005019
587 Ga0496114_0005213
588 Ga0496115_0002211
589 Ga0496115_0103995
590 Ga0501034_0207591
591 Ga0501047_0076454
592 Ga0501067_0000285
593 Ga0501069_0005681
594 Ga0501077_0002003
595 Ga0501080_0050054
596 Ga0501080_0072372
597 nmdc:mga05p37_300717_c1
598 nmdc:mga06r32_57080_c1
599 nmdc:mga08y16_227258_c1
600 nmdc:mga0n895_57839_c1
601 nmdc:mga0n895_66076_c1
602 nmdc:mga0rr50_170597_c1
603 nmdc:mga08x19_5666_c1
604 nmdc:mga0a205_19866_c1
605 nmdc:mga0a205_222506_c1
606 Ga0495655_0002574
607 Ga0495595_0037844
608 Ga0495619_0035839
609 Ga0495619_0058180
610 Ga0495619_0064043
611 Ga0466962_0003333
612 Ga0530510_0053777

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13393

tRNA-synt_His

Histidyl-tRNA synthetase

10

311

0.86

PF03129

HGTP_anticodon

Anticodon binding domain

326

410

0.85

PF00587

tRNA-synt_2b

tRNA synthetase class II core domain (G, H, P, S and T)

67

319

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
4e51-assembly1.cif.gz_A crystal structure of a histidyl-trna synthetase hisrs from burkholderia thailandensis bound to histidine 0.8325 4 409
4e51-assembly1.cif.gz_B crystal structure of a histidyl-trna synthetase hisrs from burkholderia thailandensis bound to histidine 0.8313 4 409
1kmn-assembly1.cif.gz_B histidyl-trna synthetase complexed with histidinol and atp 0.8241 6 409
4e51-assembly1.cif.gz_A crystal structure of a histidyl-trna synthetase hisrs from burkholderia thailandensis bound to histidine 0.8213 4 409
2el9-assembly1.cif.gz_B crystal structure of e.coli histidyl-trna synthetase complexed with a histidyl-adenylate analogue 0.8212 6 409
ID Description Score Start End Superfamily
af_Q75JN1_1597_1690_3.40.50.800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.8891 325 410 3.40.50.800
af_P9WFV5_326_422_3.40.50.800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.8851 326 409 3.40.50.800
1qe0B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.8725 326 406 3.40.50.800
2i4oB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.8723 327 410 3.40.50.800
af_P9WFV5_6_323_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8578 5 322 3.30.930.10
ID Description Score Start End GO Terms
AF-A0A348P357-F1-model_v4 Histidine--tRNA ligase (EC 6.1.1.21) 0.9132 116 409 GO:0004821
GO:0005524
GO:0005737
GO:0006427
GO:0016740
AF-X1NXX5-F1-model_v4 Aminoacyl-transfer RNA synthetases class-II family profile domain-containing protein 0.9123 96 301 GO:0004821
GO:0005737
GO:0006427
AF-A0A2T6EQX2-F1-model_v4 deleted 0.9114 243 409
AF-A0A2V8X6S7-F1-model_v4 Histidine--tRNA ligase (EC 6.1.1.21) 0.9099 77 316 GO:0004821
GO:0005524
GO:0005737
GO:0006427
AF-X1NXX5-F1-model_v4 Aminoacyl-transfer RNA synthetases class-II family profile domain-containing protein 0.904 96 301 GO:0004821
GO:0005737
GO:0006427

Map