F398656

General Info

Members Datasets Scaffolds Average Seq Length
306 203 612 98

Family's Representative Sequence

Representative Sequence 3300011119|Ga0105246_10036378|Ga0105246_100363782
Length 119
Sequence LTEVLIPGFCPWGEEGFCVVPRQRKYPPELLDRGAWLVFESGRPIAHVARDLGVPSETLRVHVRRVEADEGLRPDLPTAAEREEIKRLRRENFELRRANEILKAASVFFATELDADRPK

Samples

Sample ID Description Type Environment
1 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
60 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
61 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
62 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
93 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
94 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
97 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
103 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
104 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
105 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
106 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
109 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
110 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
111 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
112 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
113 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
114 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
115 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
116 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
117 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
118 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
119 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
120 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
121 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
122 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
123 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
126 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
127 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
128 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
129 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
130 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
131 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
132 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
133 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
134 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
135 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
136 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
137 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
138 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
139 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
140 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
141 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
142 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
143 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
144 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
145 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
146 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
147 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
148 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
149 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
150 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
151 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
152 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
153 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
154 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
155 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
156 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
157 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
158 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
159 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
160 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
161 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
162 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
163 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
171 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
172 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
179 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
180 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
181 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
182 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
183 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
184 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
185 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
186 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
187 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
188 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
189 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
190 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
191 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
192 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
193 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
194 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
195 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
196 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
197 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
198 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
199 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
200 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
201 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
202 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
203 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.02
Metatranscriptomes 0.65
Isolates 0.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.29
Nodule 0
Rhizoplane 4.58
Rhizosphere 87.58
Stem 0
Stem Tuber 0
Unclassified 4.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105246_10036378 3300011119 Bacteria 3297
2 CNAas_1001803 3300000532 Bacteria 1676
3 JGI25406J46586_10015756 3300003203 Bacteria 3177
4 JGI25406J46586_10176277 3300003203 Bacteria 623
5 Ga0070658_11041828 3300005327 Unclassified 712
6 Ga0070683_100451174 3300005329 Bacteria 1227
7 Ga0070670_100152399 3300005331 Bacteria 2001
8 Ga0070682_100129646 3300005337 Bacteria 1705
9 Ga0070682_101616853 3300005337 Bacteria 560
10 Ga0068868_100743712 3300005338 Bacteria 881
11 Ga0070661_100336315 3300005344 Bacteria 1182
12 Ga0070668_101227290 3300005347 Unclassified 680
13 Ga0070668_102283703 3300005347 Bacteria 500
14 Ga0070674_100367392 3300005356 Bacteria 1167
15 Ga0070673_102187218 3300005364 Bacteria 526
16 Ga0070667_101568956 3300005367 Bacteria 619
17 Ga0070709_10034663 3300005434 Bacteria 3061
18 Ga0070714_100162984 3300005435 Bacteria 2018
19 Ga0070714_101165718 3300005435 Bacteria 751
20 Ga0070714_101707484 3300005435 Bacteria 615
21 Ga0070713_100042432 3300005436 Bacteria 3712
22 Ga0070713_100247649 3300005436 Bacteria 1624
23 Ga0070713_100317252 3300005436 Bacteria 1439
24 Ga0070713_101146937 3300005436 Bacteria 752
25 Ga0070713_101565568 3300005436 Bacteria 640
26 Ga0070710_10064289 3300005437 Bacteria 2098
27 Ga0070710_10226091 3300005437 Bacteria 1193
28 Ga0070710_10524977 3300005437 Bacteria 814
29 Ga0070701_10161598 3300005438 Bacteria 1298
30 Ga0070711_100035401 3300005439 Bacteria 3338
31 Ga0070700_100117539 3300005441 Bacteria 1777
32 Ga0070663_100074351 3300005455 Bacteria 2481
33 Ga0070663_100438765 3300005455 Bacteria 1074
34 Ga0070678_100224907 3300005456 Bacteria 1561
35 Ga0070678_100655983 3300005456 Bacteria 942
36 Ga0070706_100988417 3300005467 Unclassified 776
37 Ga0070679_101179345 3300005530 Bacteria 711
38 Ga0070684_100071020 3300005535 Bacteria 3064
39 Ga0070684_101317086 3300005535 Bacteria 680
40 Ga0070696_100458504 3300005546 Bacteria 1007
41 Ga0070664_100199861 3300005564 Bacteria 1784
42 Ga0068857_100135695 3300005577 Bacteria 2221
43 Ga0068856_100364261 3300005614 Bacteria 1464
44 Ga0068852_100352355 3300005616 Bacteria 1438
45 Ga0068864_100195520 3300005618 Bacteria 1856
46 Ga0068864_100268611 3300005618 Bacteria 1589
47 Ga0068861_101094339 3300005719 Bacteria 766
48 Ga0068851_11006670 3300005834 Bacteria 526
49 Ga0068870_10157359 3300005840 Bacteria 1344
50 Ga0068862_102632897 3300005844 Bacteria 515
51 Ga0081455_10893729 3300005937 Bacteria 553
52 Ga0081538_10040229 3300005981 Bacteria 2985
53 Ga0081538_10074334 3300005981 Bacteria 1850
54 Ga0081538_10092225 3300005981 Bacteria 1560
55 Ga0081538_10167713 3300005981 Bacteria 964
56 Ga0081538_10219042 3300005981 Unclassified 757
57 Ga0081538_10383363 3300005981 Bacteria 507
58 Ga0081539_10027838 3300005985 Bacteria 3570
59 Ga0081539_10119255 3300005985 Bacteria 1313
60 Ga0070717_10012728 3300006028 Bacteria 6421
61 Ga0070717_10033671 3300006028 Bacteria 4134
62 Ga0070717_10189268 3300006028 Bacteria 1797
63 Ga0070717_10815806 3300006028 Bacteria 849
64 Ga0070715_10017960 3300006163 Bacteria 2687
65 Ga0070716_100089238 3300006173 Bacteria 1862
66 Ga0070716_100193441 3300006173 Bacteria 1346
67 Ga0070712_100485204 3300006175 Bacteria 1034
68 Ga0075428_101122486 3300006844 Unclassified 830
69 Ga0105245_10250464 3300009098 Bacteria 1721
70 Ga0105247_10420673 3300009101 Bacteria 956
71 Ga0105243_12310265 3300009148 Bacteria 575
72 Ga0105248_10761897 3300009177 Bacteria 1092
73 Ga0105248_12414047 3300009177 Bacteria 599
74 Ga0105238_12191428 3300009551 Bacteria 587
75 Ga0105239_11462438 3300010375 Bacteria 789
76 Ga0105239_11646532 3300010375 Bacteria 742
77 Ga0157369_10588116 3300013105 Bacteria 1149
78 Ga0157374_10312859 3300013296 Bacteria 1555
79 Ga0157372_11971588 3300013307 Bacteria 671
80 Ga0163163_10361277 3300014325 Bacteria 1508
81 Ga0163163_11530895 3300014325 Bacteria 728
82 Ga0182008_10732494 3300014497 Bacteria 568
83 Ga0157377_10217951 3300014745 Bacteria 1220
84 Ga0163161_10400314 3300017792 Bacteria 1101
85 Ga0163161_12059435 3300017792 Bacteria 508
86 Ga0206354_10094454 3300020081 Bacteria 533
87 Ga0206353_10215166 3300020082 Bacteria 580
88 Ga0213874_10031830 3300021377 Bacteria 1528
89 Ga0213874_10070610 3300021377 Bacteria 1113
90 Ga0213876_10018712 3300021384 Bacteria 3658
91 Ga0213876_10020214 3300021384 Bacteria 3518
92 Ga0213875_10051318 3300021388 Bacteria 1932
93 Ga0207692_10044418 3300025898 Bacteria 2217
94 Ga0207692_10549262 3300025898 Bacteria 738
95 Ga0207685_10019934 3300025905 Bacteria 2219
96 Ga0207643_10134626 3300025908 Bacteria 1472
97 Ga0207654_11397935 3300025911 Bacteria 510
98 Ga0207707_11469699 3300025912 Bacteria 541
99 Ga0207663_10028669 3300025916 Bacteria 3261
100 Ga0207663_11010953 3300025916 Bacteria 667
101 Ga0207649_10373369 3300025920 Bacteria 1061
102 Ga0207694_10521567 3300025924 Bacteria 996
103 Ga0207650_10174354 3300025925 Bacteria 1711
104 Ga0207687_11311088 3300025927 Bacteria 622
105 Ga0207700_10055294 3300025928 Bacteria 2983
106 Ga0207700_10336081 3300025928 Bacteria 1312
107 Ga0207700_10337827 3300025928 Bacteria 1309
108 Ga0207700_11085245 3300025928 Bacteria 716
109 Ga0207664_10025945 3300025929 Bacteria 4422
110 Ga0207664_10287902 3300025929 Bacteria 1443
111 Ga0207664_10317515 3300025929 Bacteria 1374
112 Ga0207664_11037563 3300025929 Bacteria 734
113 Ga0207644_11039753 3300025931 Bacteria 688
114 Ga0207669_11436669 3300025937 Bacteria 588
115 Ga0207669_11717531 3300025937 Bacteria 536
116 Ga0207704_10709159 3300025938 Bacteria 834
117 Ga0207665_10045971 3300025939 Bacteria 2924
118 Ga0207661_10240078 3300025944 Bacteria 1607
119 Ga0207679_10214509 3300025945 Bacteria 1616
120 Ga0207651_10973013 3300025960 Bacteria 758
121 Ga0207677_10199350 3300026023 Bacteria 1590
122 Ga0207678_10079354 3300026067 Bacteria 2811
123 Ga0207678_10093846 3300026067 Bacteria 2564
124 Ga0207708_10043575 3300026075 Bacteria 3420
125 Ga0207708_10821920 3300026075 Bacteria 801
126 Ga0207702_10337112 3300026078 Bacteria 1440
127 Ga0207702_11427829 3300026078 Bacteria 686
128 Ga0207648_11148374 3300026089 Bacteria 729
129 Ga0207676_10185719 3300026095 Bacteria 1825
130 Ga0207676_10239629 3300026095 Bacteria 1626
131 Ga0207674_10113896 3300026116 Bacteria 2677
132 Ga0207674_11740088 3300026116 Bacteria 591
133 Ga0207675_100557932 3300026118 Bacteria 1145
134 Ga0207675_100567432 3300026118 Bacteria 1135
135 Ga0207675_102036214 3300026118 Unclassified 591
136 Ga0207683_10198354 3300026121 Bacteria 1824
137 Ga0207698_11312348 3300026142 Bacteria 738
138 Ga0207428_10768500 3300027907 Unclassified 686
139 Ga0207428_11082198 3300027907 Bacteria 561
140 Ga0307408_101490411 3300031548 Bacteria 639
141 Ga0316579_10362788 3300031691 Bacteria 700
142 Ga0307405_10214367 3300031731 Bacteria 1408
143 Ga0307410_10081169 3300031852 Bacteria 2277
144 Ga0307406_10152490 3300031901 Bacteria 1650
145 Ga0307412_10338021 3300031911 Bacteria 1204
146 Ga0307409_100101214 3300031995 Bacteria 2390
147 Ga0307409_100318084 3300031995 Bacteria 1455
148 Ga0307416_100295481 3300032002 Bacteria 1606
149 Ga0307416_101588262 3300032002 Bacteria 759
150 Ga0307411_10217035 3300032005 Bacteria 1481
151 Ga0307415_100151116 3300032126 Bacteria 1787
152 Ga0307415_100409351 3300032126 Bacteria 1160
153 Ga0373943_0451718 3300035170 Bacteria 747
154 Ga0373947_0450320 3300035725 Bacteria 872
155 Ga0316582_0061841 3300036647 Bacteria 2403
156 Ga0395898_0327743 3300037466 Bacteria 1460
157 Ga0436364_0162438 3300037853 Bacteria 2025
158 Ga0436364_0858425 3300037853 Bacteria 33017
159 Ga0395901_1810357 3300038443 Bacteria 560
160 Ga0436365_0121821 3300039437 Bacteria 1210
161 Ga0436365_0911667 3300039437 Bacteria 1401
162 Ga0436365_1186239 3300039437 Bacteria 9882
163 Ga0436363_0525043 3300039450 Bacteria 2198
164 Ga0436363_1023853 3300039450 Bacteria 1099
165 Ga0436362_0209136 3300039453 Bacteria 1610
166 Ga0436362_0395858 3300039453 Bacteria 1968
167 Ga0451791_0692209 3300041451 Bacteria 511
168 Ga0451797_0221507 3300041453 Bacteria 507
169 Ga0451800_0525470 3300041459 Bacteria 508
170 Ga0451847_0690015 3300041503 Bacteria 593
171 Ga0451853_0185689 3300041512 Bacteria 1342
172 Ga0451853_2207603 3300041512 Bacteria 713
173 Ga0451853_2593848 3300041512 Unclassified 539
174 Ga0466972_0076301 3300044658 Bacteria 1596
175 Ga0466971_0544943 3300044719 Unclassified 575
176 Ga0466968_0132335 3300044735 Bacteria 1136
177 Ga0466968_0304458 3300044735 Bacteria 767
178 Ga0466968_0402234 3300044735 Bacteria 671
179 Ga0466970_0105157 3300044765 Bacteria 1539
180 Ga0466957_0397862 3300044842 Bacteria 942
181 Ga0466957_0507684 3300044842 Bacteria 836
182 Ga0466960_0189226 3300044901 Bacteria 1119
183 Ga0466960_0640055 3300044901 Bacteria 634
184 Ga0466959_0233264 3300045049 Bacteria 1273
185 Ga0466959_0676260 3300045049 Bacteria 692
186 Ga0466958_0160652 3300045836 Bacteria 1419
187 Ga0466967_0352609 3300045976 Bacteria 1424
188 Ga0466967_0377210 3300045976 Bacteria 1376
189 Ga0466967_1240900 3300045976 Bacteria 742
190 Ga0495629_0080463 3300046459 Bacteria 2275
191 Ga0495629_0671832 3300046459 Bacteria 689
192 Ga0495641_0140914 3300046461 Bacteria 1077
193 Ga0495651_0129592 3300046462 Bacteria 1843
194 Ga0495651_0736225 3300046462 Bacteria 612
195 Ga0495653_0092540 3300046463 Bacteria 2207
196 Ga0495653_0218037 3300046463 Bacteria 1284
197 Ga0495582_0123202 3300046473 Bacteria 1462
198 Ga0495662_0056148 3300046476 Bacteria 1902
199 Ga0495664_0122101 3300046477 Bacteria 1575
200 Ga0495664_0167824 3300046477 Bacteria 1332
201 Ga0495664_0329896 3300046477 Bacteria 920
202 Ga0495596_0018485 3300046500 Bacteria 2871
203 Ga0495606_0567292 3300046507 Bacteria 562
204 Ga0495608_0018415 3300046511 Bacteria 4817
205 Ga0495608_0184449 3300046511 Bacteria 1319
206 Ga0495628_0210153 3300046516 Bacteria 1464
207 Ga0495630_0207746 3300046517 Bacteria 1494
208 Ga0495630_1331784 3300046517 Bacteria 541
209 Ga0495663_0287801 3300046525 Bacteria 590
210 Ga0495652_0182773 3300046529 Bacteria 1607
211 Ga0495652_1146062 3300046529 Bacteria 503
212 Ga0495640_0113236 3300046533 Bacteria 1770
213 Ga0495640_0151466 3300046533 Bacteria 1490
214 Ga0495640_0163933 3300046533 Bacteria 1423
215 Ga0495586_0129420 3300046535 Bacteria 1413
216 Ga0495587_0168848 3300046536 Bacteria 1243
217 Ga0495645_0357581 3300046543 Bacteria 939
218 Ga0495667_0143399 3300046559 Bacteria 1539
219 Ga0495634_0258300 3300046642 Bacteria 1064
220 Ga0495611_0124381 3300046648 Bacteria 1203
221 Ga0495635_0186846 3300046663 Bacteria 1407
222 Ga0495635_1090856 3300046663 Bacteria 505
223 Ga0495657_0594419 3300046675 Bacteria 641
224 Ga0495657_0626132 3300046675 Bacteria 621
225 Ga0495623_0584370 3300046679 Unclassified 582
226 Ga0495647_0109459 3300046681 Bacteria 1152
227 Ga0495658_0154065 3300046683 Bacteria 1413
228 Ga0495624_0114854 3300046690 Bacteria 1655
229 Ga0495600_0109583 3300046809 Bacteria 1798
230 Ga0495600_0301817 3300046809 Bacteria 1010
231 Ga0495600_0318106 3300046809 Bacteria 979
232 Ga0495581_0088232 3300047315 Bacteria 1799
233 Ga0495604_0558383 3300047317 Bacteria 738
234 Ga0495604_0740799 3300047317 Bacteria 622
235 Ga0495674_0213037 3300047319 Bacteria 1599
236 Ga0495674_0513567 3300047319 Unclassified 957
237 Ga0495676_0151076 3300047321 Bacteria 1653
238 Ga0495680_0029902 3300047322 Bacteria 4454
239 Ga0495680_0120719 3300047322 Bacteria 1935
240 Ga0495680_0926010 3300047322 Unclassified 561
241 Ga0495675_0041107 3300047444 Bacteria 2946
242 Ga0495684_0182715 3300047471 Bacteria 1554
243 Ga0495684_0570393 3300047471 Bacteria 768
244 Ga0495684_0790913 3300047471 Bacteria 621
245 Ga0495684_0913292 3300047471 Bacteria 564
246 Ga0495686_0120198 3300047472 Bacteria 1567
247 Ga0495593_0426422 3300047673 Bacteria 663
248 Ga0495602_0271517 3300048088 Bacteria 1253
249 Ga0495602_0344325 3300048088 Bacteria 1077
250 Ga0495614_0154304 3300048089 Bacteria 1025
251 Ga0495614_0475048 3300048089 Bacteria 593
252 Ga0496101_0596046 3300048904 Bacteria 874
253 Ga0496102_1926017 3300048905 Bacteria 508
254 Ga0496104_1626388 3300048907 Bacteria 549
255 Ga0496105_0126573 3300048908 Bacteria 2106
256 Ga0496105_0181028 3300048908 Bacteria 1726
257 Ga0496105_0402202 3300048908 Bacteria 1087
258 Ga0496108_0174623 3300048911 Bacteria 1860
259 Ga0496108_0260715 3300048911 Bacteria 1508
260 Ga0496110_0563038 3300048913 Bacteria 1035
261 Ga0496110_1516054 3300048913 Bacteria 580
262 Ga0496111_0375643 3300048914 Bacteria 1051
263 Ga0496124_0040649 3300048927 Bacteria 4021
264 Ga0501036_0445980 3300049572 Bacteria 1078
265 Ga0501037_0567574 3300049573 Bacteria 764
266 Ga0501041_0195539 3300049577 Bacteria 1267
267 Ga0501042_0228729 3300049578 Bacteria 1341
268 Ga0501043_0227745 3300049579 Bacteria 1440
269 Ga0501046_0166371 3300049580 Bacteria 1657
270 Ga0501068_0134107 3300049584 Bacteria 1550
271 Ga0501068_0320022 3300049584 Bacteria 994
272 Ga0501069_0243693 3300049585 Bacteria 1048
273 Ga0501070_1341178 3300049586 Bacteria 545
274 Ga0501070_1393007 3300049586 Bacteria 533
275 Ga0501071_0091640 3300049587 Bacteria 2233
276 Ga0501071_0250477 3300049587 Bacteria 1337
277 Ga0501072_0194842 3300049588 Bacteria 1616
278 Ga0501076_0192973 3300049592 Bacteria 1662
279 Ga0501076_1067823 3300049592 Bacteria 665
280 Ga0501077_0056614 3300049593 Bacteria 2489
281 Ga0501202_241564 3300049652 Bacteria 505
282 Ga0501209_135288 3300049656 Bacteria 737
283 Ga0501223_077147 3300049663 Bacteria 664
284 Ga0501225_0132951 3300049705 Bacteria 747
285 Ga0501079_0322112 3300049741 Bacteria 1210
286 Ga0501045_0054135 3300049824 Bacteria 2933
287 Ga0495601_0355951 3300053077 Bacteria 951
288 Ga0495612_0053194 3300053078 Bacteria 1667
289 Ga0495612_0437608 3300053078 Unclassified 597
290 Ga0495655_0030211 3300053083 Bacteria 1309
291 Ga0495655_0087960 3300053083 Bacteria 900
292 Ga0495595_0051218 3300053084 Bacteria 1913
293 Ga0495595_0103555 3300053084 Bacteria 1375
294 Ga0495619_0097878 3300053085 Bacteria 1994
295 Ga0500641_0063458 3300053096 Bacteria 1542
296 Ga0500556_0006584 3300053104 Bacteria 3301
297 Ga0500616_0001582 3300053153 Bacteria 21267
298 Ga0500616_0002730 3300053153 Bacteria 14303
299 Ga0500616_0006837 3300053153 Bacteria 7373
300 Ga0500616_0064585 3300053153 Bacteria 1884
301 Ga0500616_0343740 3300053153 Bacteria 608
302 Ga0501084_1509382 3300054114 Bacteria 562
303 Ga0590071_147202 3300059421 Bacteria 609
304 Ga0501082_0343228 3300060353 Bacteria 1301
305 Ga0466962_0068942 3300061719 Bacteria 1689
306 2837274711 2837268691 Bacteria 7850704
307 Ga0105246_10036378
308 CNAas_1001803
309 JGI25406J46586_10015756
310 JGI25406J46586_10176277
311 Ga0070658_11041828
312 Ga0070683_100451174
313 Ga0070670_100152399
314 Ga0070682_100129646
315 Ga0070682_101616853
316 Ga0068868_100743712
317 Ga0070661_100336315
318 Ga0070668_101227290
319 Ga0070668_102283703
320 Ga0070674_100367392
321 Ga0070673_102187218
322 Ga0070667_101568956
323 Ga0070709_10034663
324 Ga0070714_100162984
325 Ga0070714_101165718
326 Ga0070714_101707484
327 Ga0070713_100042432
328 Ga0070713_100247649
329 Ga0070713_100317252
330 Ga0070713_101146937
331 Ga0070713_101565568
332 Ga0070710_10064289
333 Ga0070710_10226091
334 Ga0070710_10524977
335 Ga0070701_10161598
336 Ga0070711_100035401
337 Ga0070700_100117539
338 Ga0070663_100074351
339 Ga0070663_100438765
340 Ga0070678_100224907
341 Ga0070678_100655983
342 Ga0070706_100988417
343 Ga0070679_101179345
344 Ga0070684_100071020
345 Ga0070684_101317086
346 Ga0070696_100458504
347 Ga0070664_100199861
348 Ga0068857_100135695
349 Ga0068856_100364261
350 Ga0068852_100352355
351 Ga0068864_100195520
352 Ga0068864_100268611
353 Ga0068861_101094339
354 Ga0068851_11006670
355 Ga0068870_10157359
356 Ga0068862_102632897
357 Ga0081455_10893729
358 Ga0081538_10040229
359 Ga0081538_10074334
360 Ga0081538_10092225
361 Ga0081538_10167713
362 Ga0081538_10219042
363 Ga0081538_10383363
364 Ga0081539_10027838
365 Ga0081539_10119255
366 Ga0070717_10012728
367 Ga0070717_10033671
368 Ga0070717_10189268
369 Ga0070717_10815806
370 Ga0070715_10017960
371 Ga0070716_100089238
372 Ga0070716_100193441
373 Ga0070712_100485204
374 Ga0075428_101122486
375 Ga0105245_10250464
376 Ga0105247_10420673
377 Ga0105243_12310265
378 Ga0105248_10761897
379 Ga0105248_12414047
380 Ga0105238_12191428
381 Ga0105239_11462438
382 Ga0105239_11646532
383 Ga0157369_10588116
384 Ga0157374_10312859
385 Ga0157372_11971588
386 Ga0163163_10361277
387 Ga0163163_11530895
388 Ga0182008_10732494
389 Ga0157377_10217951
390 Ga0163161_10400314
391 Ga0163161_12059435
392 Ga0206354_10094454
393 Ga0206353_10215166
394 Ga0213874_10031830
395 Ga0213874_10070610
396 Ga0213876_10018712
397 Ga0213876_10020214
398 Ga0213875_10051318
399 Ga0207692_10044418
400 Ga0207692_10549262
401 Ga0207685_10019934
402 Ga0207643_10134626
403 Ga0207654_11397935
404 Ga0207707_11469699
405 Ga0207663_10028669
406 Ga0207663_11010953
407 Ga0207649_10373369
408 Ga0207694_10521567
409 Ga0207650_10174354
410 Ga0207687_11311088
411 Ga0207700_10055294
412 Ga0207700_10336081
413 Ga0207700_10337827
414 Ga0207700_11085245
415 Ga0207664_10025945
416 Ga0207664_10287902
417 Ga0207664_10317515
418 Ga0207664_11037563
419 Ga0207644_11039753
420 Ga0207669_11436669
421 Ga0207669_11717531
422 Ga0207704_10709159
423 Ga0207665_10045971
424 Ga0207661_10240078
425 Ga0207679_10214509
426 Ga0207651_10973013
427 Ga0207677_10199350
428 Ga0207678_10079354
429 Ga0207678_10093846
430 Ga0207708_10043575
431 Ga0207708_10821920
432 Ga0207702_10337112
433 Ga0207702_11427829
434 Ga0207648_11148374
435 Ga0207676_10185719
436 Ga0207676_10239629
437 Ga0207674_10113896
438 Ga0207674_11740088
439 Ga0207675_100557932
440 Ga0207675_100567432
441 Ga0207675_102036214
442 Ga0207683_10198354
443 Ga0207698_11312348
444 Ga0207428_10768500
445 Ga0207428_11082198
446 Ga0307408_101490411
447 Ga0316579_10362788
448 Ga0307405_10214367
449 Ga0307410_10081169
450 Ga0307406_10152490
451 Ga0307412_10338021
452 Ga0307409_100101214
453 Ga0307409_100318084
454 Ga0307416_100295481
455 Ga0307416_101588262
456 Ga0307411_10217035
457 Ga0307415_100151116
458 Ga0307415_100409351
459 Ga0373943_0451718
460 Ga0373947_0450320
461 Ga0316582_0061841
462 Ga0395898_0327743
463 Ga0436364_0162438
464 Ga0436364_0858425
465 Ga0395901_1810357
466 Ga0436365_0121821
467 Ga0436365_0911667
468 Ga0436365_1186239
469 Ga0436363_0525043
470 Ga0436363_1023853
471 Ga0436362_0209136
472 Ga0436362_0395858
473 Ga0451791_0692209
474 Ga0451797_0221507
475 Ga0451800_0525470
476 Ga0451847_0690015
477 Ga0451853_0185689
478 Ga0451853_2207603
479 Ga0451853_2593848
480 Ga0466972_0076301
481 Ga0466971_0544943
482 Ga0466968_0132335
483 Ga0466968_0304458
484 Ga0466968_0402234
485 Ga0466970_0105157
486 Ga0466957_0397862
487 Ga0466957_0507684
488 Ga0466960_0189226
489 Ga0466960_0640055
490 Ga0466959_0233264
491 Ga0466959_0676260
492 Ga0466958_0160652
493 Ga0466967_0352609
494 Ga0466967_0377210
495 Ga0466967_1240900
496 Ga0495629_0080463
497 Ga0495629_0671832
498 Ga0495641_0140914
499 Ga0495651_0129592
500 Ga0495651_0736225
501 Ga0495653_0092540
502 Ga0495653_0218037
503 Ga0495582_0123202
504 Ga0495662_0056148
505 Ga0495664_0122101
506 Ga0495664_0167824
507 Ga0495664_0329896
508 Ga0495596_0018485
509 Ga0495606_0567292
510 Ga0495608_0018415
511 Ga0495608_0184449
512 Ga0495628_0210153
513 Ga0495630_0207746
514 Ga0495630_1331784
515 Ga0495663_0287801
516 Ga0495652_0182773
517 Ga0495652_1146062
518 Ga0495640_0113236
519 Ga0495640_0151466
520 Ga0495640_0163933
521 Ga0495586_0129420
522 Ga0495587_0168848
523 Ga0495645_0357581
524 Ga0495667_0143399
525 Ga0495634_0258300
526 Ga0495611_0124381
527 Ga0495635_0186846
528 Ga0495635_1090856
529 Ga0495657_0594419
530 Ga0495657_0626132
531 Ga0495623_0584370
532 Ga0495647_0109459
533 Ga0495658_0154065
534 Ga0495624_0114854
535 Ga0495600_0109583
536 Ga0495600_0301817
537 Ga0495600_0318106
538 Ga0495581_0088232
539 Ga0495604_0558383
540 Ga0495604_0740799
541 Ga0495674_0213037
542 Ga0495674_0513567
543 Ga0495676_0151076
544 Ga0495680_0029902
545 Ga0495680_0120719
546 Ga0495680_0926010
547 Ga0495675_0041107
548 Ga0495684_0182715
549 Ga0495684_0570393
550 Ga0495684_0790913
551 Ga0495684_0913292
552 Ga0495686_0120198
553 Ga0495593_0426422
554 Ga0495602_0271517
555 Ga0495602_0344325
556 Ga0495614_0154304
557 Ga0495614_0475048
558 Ga0496101_0596046
559 Ga0496102_1926017
560 Ga0496104_1626388
561 Ga0496105_0126573
562 Ga0496105_0181028
563 Ga0496105_0402202
564 Ga0496108_0174623
565 Ga0496108_0260715
566 Ga0496110_0563038
567 Ga0496110_1516054
568 Ga0496111_0375643
569 Ga0496124_0040649
570 Ga0501036_0445980
571 Ga0501037_0567574
572 Ga0501041_0195539
573 Ga0501042_0228729
574 Ga0501043_0227745
575 Ga0501046_0166371
576 Ga0501068_0134107
577 Ga0501068_0320022
578 Ga0501069_0243693
579 Ga0501070_1341178
580 Ga0501070_1393007
581 Ga0501071_0091640
582 Ga0501071_0250477
583 Ga0501072_0194842
584 Ga0501076_0192973
585 Ga0501076_1067823
586 Ga0501077_0056614
587 Ga0501202_241564
588 Ga0501209_135288
589 Ga0501223_077147
590 Ga0501225_0132951
591 Ga0501079_0322112
592 Ga0501045_0054135
593 Ga0495601_0355951
594 Ga0495612_0053194
595 Ga0495612_0437608
596 Ga0495655_0030211
597 Ga0495655_0087960
598 Ga0495595_0051218
599 Ga0495595_0103555
600 Ga0495619_0097878
601 Ga0500641_0063458
602 Ga0500556_0006584
603 Ga0500616_0001582
604 Ga0500616_0002730
605 Ga0500616_0006837
606 Ga0500616_0064585
607 Ga0500616_0343740
608 Ga0501084_1509382
609 Ga0590071_147202
610 Ga0501082_0343228
611 Ga0466962_0068942
612 2837274711

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01527

HTH_Tnp_1

Transposase

21

93

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3vfz-assembly3.cif.gz_B crystal structure of -35 promoter binding domain of sigd of mycobacterium tuberculosis 0.8501 9 41
6ywy-assembly1.cif.gz_66 the structure of the mitoribosome from neurospora crassa with bound trna at the p-site 0.8413 8 51
6zj2-assembly3.cif.gz_M structure of rcsb from salmonella enterica serovar typhimurium bound to promoter rpra in the presence of phosphomimetic bef3- 0.8297 12 52
2x48-assembly1.cif.gz_A orf 55 from sulfolobus islandicus rudivirus 1 0.8267 10 45
6zj2-assembly2.cif.gz_C structure of rcsb from salmonella enterica serovar typhimurium bound to promoter rpra in the presence of phosphomimetic bef3- 0.8231 12 48
ID Description Score Start End Superfamily
af_B0S4Z6_67_179_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.9358 5 45 1.10.472.10
2pmiD00 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.9054 24 48 1.10.472.10
af_Q8LJ71_199_305_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.9031 7 44 1.10.472.10
af_Q65WX7_129_225_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.8879 11 47 1.10.472.10
af_A0A0P0Y3M7_58_149_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.8747 5 45 1.10.472.10
ID Description Score Start End GO Terms
AF-A0A6J3CCD6-F1-model_v4 Uncharacterized protein LOC113521013 0.9794 6 49
AF-A0A1W4WAP5-F1-model_v4 Uncharacterized protein LOC108734152 (Uncharacterized protein LOC112905761) 0.9588 6 49 GO:0003677
GO:0005634
AF-A0A6P7G0L9-F1-model_v4 Uncharacterized protein LOC114332591 0.9577 8 53 GO:0003677
GO:0005634
AF-A0A7W0UET5-F1-model_v4 Transposase 0.9557 1 79 GO:0003677
GO:0004803
GO:0006313
AF-A0A2N3ZLB4-F1-model_v4 deleted 0.941 6 88

Map