F398591

General Info

Members Datasets Scaffolds Average Seq Length
306 221 612 425

Family's Representative Sequence

Representative Sequence 3300006058|Ga0075432_10010481|Ga0075432_100104813
Length 493
Sequence VSPSPTTAHRAWRDSDAAQRERDCAPRYLASKGKHKEQMSVAKEMTEMHTEKSETVNRRAFLQMVAGVAAGAVIAGAIPEIAAAQQSNRLGGHLYMQTNETRNAIIHYRWAASGALTEVDRVATGGAGSGELSPIYHIKRPNDFEGAGSVNLTPDRRFLFTTNAGDNSVSSFAVDKEGRLKLLDVKPTGNPTSGGAKSLAYAPSSRTLFVLHTFGPDHLRLMSVDNKGKLTARPERYSVNTRDWPNRVPTMAVLSPDGKFLVLGTTFDELPSRKNPDGSLILWIPRPDGTLHVIASNAPDPDGIVVFPVGGDGGLGAPSLYDAKGASPFYITFLHNRPDTFIIGYAVSDGLAMGRIDANGKVSVISPLVKIDTSAGLPSELCWLAVSPDDRFVFTTNFGYSYMSSYLIDGNVLSIAKDPAVPKVPGDGTFRAINGTVSSGPSDSWLTPDGAYLYQIYGNASKLVGYATQSDGSLKEITSVKIPYNSPQGLAGF

Samples

Sample ID Description Type Environment
1 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
7 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
8 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
9 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
61 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
63 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
65 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
66 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
82 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
83 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
87 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
88 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
89 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
90 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
91 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
92 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
93 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
94 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
95 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
96 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
97 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
98 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
99 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
100 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
101 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
102 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
103 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
104 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
105 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
106 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
107 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
108 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
109 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
110 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
119 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
120 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
121 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
122 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
123 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
124 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
125 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
126 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
127 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
128 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
129 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
130 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
131 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
132 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
133 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
134 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
155 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
156 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
157 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
158 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
159 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
160 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
161 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
162 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
163 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
164 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
165 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
166 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
167 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
168 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
169 2922368715
170 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
171 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
172 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
173 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
174 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
175 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
176 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
177 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
178 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
179 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
180 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
181 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
182 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
183 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
184 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
185 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
186 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
187 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
188 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
189 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
190 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
191 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
192 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
193 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
194 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
195 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
196 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
197 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
198 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
199 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
200 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
201 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
202 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
203 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
204 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
205 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
206 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
207 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
208 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
209 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
210 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
211 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
212 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
213 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
214 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
215 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
216 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
217 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
218 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
219 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
220 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
221 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 70.49
Metatranscriptomes 7.21
Isolates 22.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.23
Nodule 20.59
Rhizoplane 2.29
Rhizosphere 66.34
Stem 0
Stem Tuber 0
Unclassified 3.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075432_10010481 3300006058 Bacteria 3146
2 JGI25159J45721_1000440 3300002987 Bacteria 19136
3 rootH2_10072610 3300003320 Bacteria 2822
4 rootH2_10226912 3300003320 Bacteria 3493
5 rootH1_10376021 3300003323 Unclassified 1783
6 JGI25160J50197_1000624 3300003354 Bacteria 19827
7 JGI25161J50226_1000431 3300003374 Bacteria 19827
8 Ga0055542_1006849 3300003762 Bacteria 2384
9 Ga0055543_1000593 3300004625 Bacteria 19865
10 Ga0058863_11825855 3300004799 Bacteria 3707
11 Ga0058861_10016405 3300004800 Bacteria 3447
12 Ga0065165_1001916 3300005262 Bacteria 19865
13 Ga0070709_10032120 3300005434 Bacteria 3164
14 Ga0070714_100085073 3300005435 Bacteria 2761
15 Ga0070714_100107064 3300005435 Bacteria 2471
16 Ga0070714_100216756 3300005435 Bacteria 1757
17 Ga0070713_100054270 3300005436 Bacteria 3324
18 Ga0070710_10024144 3300005437 Bacteria 3204
19 Ga0070710_10053607 3300005437 Bacteria 2272
20 Ga0070711_100007615 3300005439 Bacteria 6590
21 Ga0070711_100153270 3300005439 Bacteria 1740
22 Ga0070708_100011558 3300005445 Bacteria 7187
23 Ga0070708_100015393 3300005445 Bacteria 6316
24 Ga0070708_100028271 3300005445 Bacteria 4824
25 Ga0070708_100030409 3300005445 Bacteria 4668
26 Ga0070708_100041782 3300005445 Bacteria 4021
27 Ga0070708_100085098 3300005445 Bacteria 2869
28 Ga0070708_100172853 3300005445 Bacteria 2018
29 Ga0070678_100163891 3300005456 Bacteria 1804
30 Ga0070681_10058086 3300005458 Bacteria 3848
31 Ga0070706_100018138 3300005467 Bacteria 6492
32 Ga0070706_100025360 3300005467 Bacteria 5455
33 Ga0070706_100031555 3300005467 Bacteria 4885
34 Ga0070706_100065346 3300005467 Bacteria 3364
35 Ga0070706_100087842 3300005467 Bacteria 2882
36 Ga0070706_100147540 3300005467 Bacteria 2196
37 Ga0070707_100010315 3300005468 Bacteria 8698
38 Ga0070707_100036500 3300005468 Bacteria 4690
39 Ga0070707_100036951 3300005468 Bacteria 4660
40 Ga0070707_100055839 3300005468 Bacteria 3786
41 Ga0070707_100063990 3300005468 Unclassified 3530
42 Ga0070707_100097129 3300005468 Bacteria 2853
43 Ga0070698_100009039 3300005471 Bacteria 10710
44 Ga0070698_100046107 3300005471 Unclassified 4458
45 Ga0070698_100056150 3300005471 Bacteria 3990
46 Ga0070698_100074848 3300005471 Bacteria 3391
47 Ga0070698_100086801 3300005471 Bacteria 3115
48 Ga0070699_100007117 3300005518 Bacteria 9718
49 Ga0070699_100028375 3300005518 Bacteria 4826
50 Ga0070699_100037700 3300005518 Bacteria 4185
51 Ga0070699_100078622 3300005518 Unclassified 2873
52 Ga0070699_100105473 3300005518 Bacteria 2472
53 Ga0070699_100229926 3300005518 Bacteria 1653
54 Ga0070699_100264997 3300005518 Bacteria 1537
55 Ga0070679_100160803 3300005530 Bacteria 2220
56 Ga0070697_100000584 3300005536 Bacteria 27501
57 Ga0070697_100025639 3300005536 Bacteria 4703
58 Ga0070695_100243604 3300005545 Bacteria 1305
59 Ga0070665_100232927 3300005548 Bacteria 1842
60 Ga0068864_100141669 3300005618 Bacteria 2169
61 Ga0068858_100071764 3300005842 Bacteria 3212
62 Ga0081455_10010361 3300005937 Bacteria 9471
63 Ga0081455_10014206 3300005937 Bacteria 7817
64 Ga0081455_10020353 3300005937 Bacteria 6251
65 Ga0081455_10046404 3300005937 Bacteria 3769
66 Ga0081538_10005569 3300005981 Bacteria 11304
67 Ga0081540_1001116 3300005983 Bacteria 23766
68 Ga0070717_10066432 3300006028 Bacteria 2999
69 Ga0070717_10226511 3300006028 Bacteria 1645
70 Ga0075365_10013657 3300006038 Bacteria 4868
71 Ga0075432_10016549 3300006058 Bacteria 2517
72 Ga0070715_10016833 3300006163 Bacteria 2756
73 Ga0070715_10045582 3300006163 Bacteria 1860
74 Ga0070716_100046755 3300006173 Bacteria 2437
75 Ga0070712_100069895 3300006175 Bacteria 2506
76 Ga0075367_10067041 3300006178 Bacteria 2152
77 Ga0075428_100005073 3300006844 Bacteria 14638
78 Ga0075431_100063227 3300006847 Bacteria 3819
79 Ga0075433_10002868 3300006852 Bacteria 13211
80 Ga0075433_10003488 3300006852 Bacteria 12150
81 Ga0075433_10033022 3300006852 Bacteria 4435
82 Ga0075434_100003971 3300006871 Bacteria 13247
83 Ga0075434_100004273 3300006871 Bacteria 12816
84 Ga0075429_100066166 3300006880 Bacteria 3146
85 Ga0068865_100023345 3300006881 Unclassified 4049
86 Ga0075436_100008022 3300006914 Bacteria 7229
87 Ga0075436_100038695 3300006914 Unclassified 3292
88 Ga0099823_1026356 3300006944 Bacteria 5141
89 Ga0075435_100013197 3300007076 Bacteria 6139
90 Ga0099794_10000043 3300007265 Bacteria 49721
91 Ga0099794_10013257 3300007265 Bacteria 3583
92 Ga0114129_10077105 3300009147 Bacteria 4638
93 Ga0114129_10108788 3300009147 Bacteria 3826
94 Ga0114129_10218521 3300009147 Bacteria 2573
95 Ga0105248_10011648 3300009177 Bacteria 9688
96 Ga0105248_10393004 3300009177 Bacteria 1561
97 Ga0105238_10068732 3300009551 Bacteria 3543
98 Ga0105239_10418990 3300010375 Bacteria 1517
99 Ga0157370_10127989 3300013104 Bacteria 2370
100 Ga0157374_10000262 3300013296 Bacteria 48624
101 Ga0157378_10121732 3300013297 Bacteria 2406
102 Ga0163162_10030243 3300013306 Bacteria 5366
103 Ga0163162_10121383 3300013306 Bacteria 2718
104 Ga0157375_10002088 3300013308 Bacteria 17267
105 Ga0157375_10204336 3300013308 Bacteria 2131
106 Ga0157376_10026041 3300014969 Bacteria 4615
107 Ga0209148_1000480 3300025254 Bacteria 42052
108 Ga0209233_1000722 3300025261 Bacteria 15278
109 Ga0209455_1000604 3300025272 Bacteria 22805
110 Ga0209130_1000288 3300025284 Bacteria 61556
111 Ga0209564_1011487 3300025295 Bacteria 3962
112 Ga0209758_1000899 3300025297 Bacteria 40410
113 Ga0207426_1000481 3300025302 Bacteria 60584
114 Ga0207692_10028018 3300025898 Bacteria 2659
115 Ga0207692_10074512 3300025898 Bacteria 1799
116 Ga0207685_10079656 3300025905 Bacteria 1352
117 Ga0207684_10000307 3300025910 Bacteria 69402
118 Ga0207684_10002917 3300025910 Bacteria 16956
119 Ga0207684_10006143 3300025910 Bacteria 10983
120 Ga0207684_10024289 3300025910 Bacteria 5168
121 Ga0207684_10041714 3300025910 Bacteria 3890
122 Ga0207684_10069454 3300025910 Bacteria 2994
123 Ga0207707_10039019 3300025912 Bacteria 4151
124 Ga0207693_10015501 3300025915 Bacteria 6115
125 Ga0207693_10033219 3300025915 Bacteria 4072
126 Ga0207693_10103795 3300025915 Unclassified 2229
127 Ga0207693_10136874 3300025915 Bacteria 1926
128 Ga0207663_10010518 3300025916 Bacteria 4930
129 Ga0207663_10019973 3300025916 Bacteria 3786
130 Ga0207660_10200347 3300025917 Bacteria 1559
131 Ga0207646_10000473 3300025922 Bacteria 53710
132 Ga0207646_10001038 3300025922 Bacteria 35444
133 Ga0207646_10004896 3300025922 Bacteria 14338
134 Ga0207646_10007713 3300025922 Bacteria 10894
135 Ga0207646_10007891 3300025922 Bacteria 10743
136 Ga0207646_10035008 3300025922 Bacteria 4538
137 Ga0207646_10036108 3300025922 Bacteria 4462
138 Ga0207646_10078442 3300025922 Bacteria 2952
139 Ga0207665_10042299 3300025939 Bacteria 3045
140 Ga0207665_10095373 3300025939 Bacteria 2067
141 Ga0207689_10015161 3300025942 Bacteria 6530
142 Ga0207658_10124362 3300025986 Bacteria 2062
143 Ga0207703_10039393 3300026035 Bacteria 3777
144 Ga0207676_10278862 3300026095 Unclassified 1517
145 Ga0207674_10234128 3300026116 Bacteria 1784
146 Ga0207683_10181316 3300026121 Bacteria 1909
147 Ga0209389_1012813 3300027296 Bacteria 7616
148 Ga0209489_102408 3300027361 Bacteria 38192
149 Ga0209588_1000061 3300027671 Bacteria 38272
150 Ga0209588_1007108 3300027671 Bacteria 3282
151 Ga0268266_10159641 3300028379 Bacteria 2039
152 Ga0268264_10080542 3300028381 Bacteria 2781
153 Ga0307508_10011570 3300031616 Bacteria 8061
154 Ga0307507_10204463 3300033179 Bacteria 1360
155 Ga0395900_0084226 3300037418 Bacteria 3267
156 Ga0395905_0027753 3300037471 Bacteria 5338
157 Ga0395901_0185343 3300038443 Bacteria 2183
158 Ga0395901_0203278 3300038443 Bacteria 2076
159 Ga0439450_000294 3300042008 Bacteria 6197
160 Ga0453683_0082581 3300044673 Bacteria 2013
161 Ga0453683_0145103 3300044673 Bacteria 1498
162 Ga0453684_0007315 3300044712 Bacteria 20420
163 Ga0466959_0068672 3300045049 Bacteria 2568
164 Ga0451576_0092768 3300045051 Bacteria 3140
165 Ga0495606_0069198 3300046507 Bacteria 2230
166 Ga0495628_0012578 3300046516 Bacteria 7131
167 Ga0495640_0002605 3300046533 Bacteria 14499
168 Ga0495600_0013019 3300046809 Bacteria 5217
169 Ga0495604_0109379 3300047317 Bacteria 2017
170 Ga0495676_0006984 3300047321 Bacteria 10361
171 Ga0496101_0128667 3300048904 Bacteria 1921
172 Ga0496104_0130970 3300048907 Bacteria 2409
173 Ga0496105_0112558 3300048908 Bacteria 2246
174 Ga0496110_0062543 3300048913 Bacteria 3288
175 Ga0496112_0047155 3300048915 Unclassified 4227
176 Ga0496112_0232910 3300048915 Bacteria 1796
177 Ga0496114_0151682 3300048917 Bacteria 2011
178 Ga0496122_0035520 3300048925 Bacteria 4052
179 Ga0496126_0041227 3300048929 Bacteria 4274
180 Ga0496126_0090662 3300048929 Bacteria 2689
181 Ga0501032_0111106 3300049569 Bacteria 1813
182 Ga0501033_0002153 3300049570 Bacteria 17030
183 Ga0501036_0037478 3300049572 Bacteria 4101
184 Ga0501038_0000585 3300049574 Bacteria 32370
185 Ga0501043_0033985 3300049579 Bacteria 4011
186 Ga0501046_0016098 3300049580 Bacteria 6270
187 Ga0501047_0130523 3300049581 Bacteria 2393
188 Ga0501048_0095602 3300049582 Bacteria 2095
189 Ga0501069_0007802 3300049585 Bacteria 5619
190 Ga0501070_0001733 3300049586 Bacteria 19283
191 Ga0501073_0008375 3300049589 Bacteria 7670
192 Ga0501074_0054432 3300049590 Bacteria 2885
193 Ga0501080_0004740 3300049742 Bacteria 12124
194 Ga0501035_0003193 3300049822 Bacteria 15717
195 nmdc:mga05p37_13345_c1 3300050507 Bacteria 9843
196 nmdc:mga05p37_367716_c1 3300050507 Bacteria 1689
197 nmdc:mga05p37_53683_c1 3300050507 Bacteria 4957
198 nmdc:mga05p37_61074_c1 3300050507 Unclassified 4640
199 nmdc:mga05p37_66226_c1 3300050507 Bacteria 4443
200 nmdc:mga09592_925_c1 3300050508 Bacteria 23011
201 nmdc:mga06r32_3848_c1 3300050510 Bacteria 13432
202 nmdc:mga08y16_235556_c1 3300050511 Unclassified 1893
203 nmdc:mga08y16_35623_c1 3300050511 Bacteria 5226
204 nmdc:mga0n895_28119_c1 3300050512 Bacteria 5348
205 nmdc:mga0n895_355168_c1 3300050512 Bacteria 1484
206 nmdc:mga0n895_54181_c1 3300050512 Bacteria 3944
207 nmdc:mga0n895_8326_c1 3300050512 Bacteria 8975
208 nmdc:mga0rr50_11889_c1 3300050513 Bacteria 5595
209 nmdc:mga0rr50_1364_c1 3300050513 Bacteria 13360
210 nmdc:mga0rr50_4081_c1 3300050513 Bacteria 8528
211 nmdc:mga08x19_5162_c1 3300050514 Bacteria 7721
212 nmdc:mga0a205_11405_c1 3300050515 Bacteria 8181
213 nmdc:mga0a205_171983_c1 3300050515 Bacteria 2062
214 nmdc:mga0a205_7245_c1 3300050515 Bacteria 10030
215 Ga0500616_0072582 3300053153 Bacteria 1749
216 Ga0501084_0241291 3300054114 Bacteria 1525
217 Ga0587070_001265 3300059491 Bacteria 2560
218 Ga0587073_0001883 3300059492 Bacteria 2578
219 Ga0587080_001648 3300059503 Bacteria 2474
220 Ga0587082_001260 3300059504 Bacteria 2561
221 Ga0587083_0001538 3300059505 Bacteria 2627
222 Ga0587085_005448 3300059506 Bacteria 1499
223 Ga0587086_001245 3300059507 Bacteria 2147
224 Ga0587088_000140 3300059508 Bacteria 4524
225 Ga0587092_001041 3300059512 Bacteria 2565
226 Ga0587094_000820 3300059513 Bacteria 2678
227 Ga0587106_004165 3300059605 Bacteria 1572
228 Ga0587109_003991 3300059624 Bacteria 2010
229 Ga0587115_003055 3300059626 Bacteria 1728
230 Ga0587067_003908 3300059640 Bacteria 1899
231 Ga0587069_002402 3300059642 Bacteria 1884
232 Ga0587075_001009 3300059644 Bacteria 2577
233 Ga0587076_005530 3300059645 Bacteria 1639
234 Ga0587078_000262 3300059646 Bacteria 3583
235 Ga0587079_001593 3300059647 Bacteria 2589
236 Ga0587071_002235 3300060344 Bacteria 2598
237 Ga0501082_0064573 3300060353 Bacteria 3152
238 2513675803 2513237098 Bacteria 9902361
239 2528851358 2528768022 Bacteria 10457665
240 2617347180 2617270735 Bacteria 9163226
241 2824611054 2824609381 Bacteria 8672835
242 2824663717 2824661429 Bacteria 9877870
243 2824707815 2824704595 Bacteria 9667483
244 2824757826 2824753945 Bacteria 9787441
245 2824768663 2824763712 Bacteria 9792355
246 2847937797 2847930680 Bacteria 9342022
247 2879100975 2879099564 Bacteria 10442239
248 2879106598 2879099564 Bacteria 10442239
249 2888422194 2888419890 Bacteria 7857137
250 2904695098 2904690495 Bacteria 9412302
251 2904711674 2904711408 Bacteria 9771557
252 2908756888 2908756301 Bacteria 8864324
253 2922377502
254 2929622292 2929615660 Bacteria 9193770
255 2929630062 2929624759 Bacteria 9339455
256 2932788005 2932784394 Bacteria 9704911
257 2932813380 2932809354 Bacteria 9135765
258 2932820077 2932818245 Bacteria 9955613
259 2932832859 2932828146 Bacteria 9745859
260 2933584094 2933577622 Bacteria 9116884
261 2935620343 2935616580 Bacteria 9032984
262 2935640668 2935638405 Bacteria 10015038
263 2935650232 2935648319 Bacteria 8801166
264 2935658379 2935656913 Bacteria 8965014
265 2935668861 2935665750 Bacteria 9571747
266 2935680969 2935675223 Bacteria 9928132
267 2935681414 2935675223 Bacteria 9928132
268 2935687168 2935684952 Bacteria 9590419
269 2935696861 2935694250 Bacteria 9291695
270 2935709048 2935703347 Bacteria 10242284
271 2935716856 2935713505 Bacteria 9608509
272 2935723019 2935722832 Bacteria 9608746
273 2935734576 2935732158 Bacteria 9706831
274 2935744633 2935741537 Bacteria 9707219
275 2935753134 2935750917 Bacteria 9590372
276 2935767539 2935760218 Bacteria 9817913
277 2935783614 2935777560 Bacteria 8077691
278 2935804778 2935801545 Bacteria 9301974
279 2935815927 2935810662 Bacteria 9401221
280 2935832175 2935827899 Bacteria 10038562
281 2935840995 2935837841 Bacteria 9454360
282 2935859229 2935855204 Bacteria 9035059
283 2935864413 2935864058 Bacteria 9784707
284 2935875235 2935873716 Bacteria 9632195
285 2935888128 2935883170 Bacteria 7964738
286 2935995791 2935992306 Bacteria 9802711
287 2936005702 2936002035 Bacteria 9362176
288 2936013209 2936011229 Bacteria 8801034
289 2936021704 2936019824 Bacteria 8804134
290 2936030502 2936028420 Bacteria 8965941
291 2936041830 2936037263 Bacteria 9446081
292 2936047898 2936046547 Bacteria 8903709
293 2936057900 2936055302 Bacteria 8785755
294 2940559047 2940556831 Bacteria 9590747
295 2941533310 2941531003 Bacteria 7653939
296 2941541743 2941538514 Bacteria 9402094
297 8016609858 8016603502 Bacteria 8731218
298 8016615082 8016613128 Bacteria 8794220
299 8017059253 8017057580 Bacteria 10023680
300 8019545510 8019538911 Bacteria 7872763
301 8019560238 8019555841 Bacteria 9642137
302 8019570338 8019565922 Bacteria 9639779
303 8019594254 8019586578 Bacteria 10212056
304 8019607313 8019597564 Bacteria 10041141
305 8055743459 8055742211 Bacteria 9226248
306 8056689531 8056681323 Bacteria 8472857
307 Ga0075432_10010481
308 JGI25159J45721_1000440
309 rootH2_10072610
310 rootH2_10226912
311 rootH1_10376021
312 JGI25160J50197_1000624
313 JGI25161J50226_1000431
314 Ga0055542_1006849
315 Ga0055543_1000593
316 Ga0058863_11825855
317 Ga0058861_10016405
318 Ga0065165_1001916
319 Ga0070709_10032120
320 Ga0070714_100085073
321 Ga0070714_100107064
322 Ga0070714_100216756
323 Ga0070713_100054270
324 Ga0070710_10024144
325 Ga0070710_10053607
326 Ga0070711_100007615
327 Ga0070711_100153270
328 Ga0070708_100011558
329 Ga0070708_100015393
330 Ga0070708_100028271
331 Ga0070708_100030409
332 Ga0070708_100041782
333 Ga0070708_100085098
334 Ga0070708_100172853
335 Ga0070678_100163891
336 Ga0070681_10058086
337 Ga0070706_100018138
338 Ga0070706_100025360
339 Ga0070706_100031555
340 Ga0070706_100065346
341 Ga0070706_100087842
342 Ga0070706_100147540
343 Ga0070707_100010315
344 Ga0070707_100036500
345 Ga0070707_100036951
346 Ga0070707_100055839
347 Ga0070707_100063990
348 Ga0070707_100097129
349 Ga0070698_100009039
350 Ga0070698_100046107
351 Ga0070698_100056150
352 Ga0070698_100074848
353 Ga0070698_100086801
354 Ga0070699_100007117
355 Ga0070699_100028375
356 Ga0070699_100037700
357 Ga0070699_100078622
358 Ga0070699_100105473
359 Ga0070699_100229926
360 Ga0070699_100264997
361 Ga0070679_100160803
362 Ga0070697_100000584
363 Ga0070697_100025639
364 Ga0070695_100243604
365 Ga0070665_100232927
366 Ga0068864_100141669
367 Ga0068858_100071764
368 Ga0081455_10010361
369 Ga0081455_10014206
370 Ga0081455_10020353
371 Ga0081455_10046404
372 Ga0081538_10005569
373 Ga0081540_1001116
374 Ga0070717_10066432
375 Ga0070717_10226511
376 Ga0075365_10013657
377 Ga0075432_10016549
378 Ga0070715_10016833
379 Ga0070715_10045582
380 Ga0070716_100046755
381 Ga0070712_100069895
382 Ga0075367_10067041
383 Ga0075428_100005073
384 Ga0075431_100063227
385 Ga0075433_10002868
386 Ga0075433_10003488
387 Ga0075433_10033022
388 Ga0075434_100003971
389 Ga0075434_100004273
390 Ga0075429_100066166
391 Ga0068865_100023345
392 Ga0075436_100008022
393 Ga0075436_100038695
394 Ga0099823_1026356
395 Ga0075435_100013197
396 Ga0099794_10000043
397 Ga0099794_10013257
398 Ga0114129_10077105
399 Ga0114129_10108788
400 Ga0114129_10218521
401 Ga0105248_10011648
402 Ga0105248_10393004
403 Ga0105238_10068732
404 Ga0105239_10418990
405 Ga0157370_10127989
406 Ga0157374_10000262
407 Ga0157378_10121732
408 Ga0163162_10030243
409 Ga0163162_10121383
410 Ga0157375_10002088
411 Ga0157375_10204336
412 Ga0157376_10026041
413 Ga0209148_1000480
414 Ga0209233_1000722
415 Ga0209455_1000604
416 Ga0209130_1000288
417 Ga0209564_1011487
418 Ga0209758_1000899
419 Ga0207426_1000481
420 Ga0207692_10028018
421 Ga0207692_10074512
422 Ga0207685_10079656
423 Ga0207684_10000307
424 Ga0207684_10002917
425 Ga0207684_10006143
426 Ga0207684_10024289
427 Ga0207684_10041714
428 Ga0207684_10069454
429 Ga0207707_10039019
430 Ga0207693_10015501
431 Ga0207693_10033219
432 Ga0207693_10103795
433 Ga0207693_10136874
434 Ga0207663_10010518
435 Ga0207663_10019973
436 Ga0207660_10200347
437 Ga0207646_10000473
438 Ga0207646_10001038
439 Ga0207646_10004896
440 Ga0207646_10007713
441 Ga0207646_10007891
442 Ga0207646_10035008
443 Ga0207646_10036108
444 Ga0207646_10078442
445 Ga0207665_10042299
446 Ga0207665_10095373
447 Ga0207689_10015161
448 Ga0207658_10124362
449 Ga0207703_10039393
450 Ga0207676_10278862
451 Ga0207674_10234128
452 Ga0207683_10181316
453 Ga0209389_1012813
454 Ga0209489_102408
455 Ga0209588_1000061
456 Ga0209588_1007108
457 Ga0268266_10159641
458 Ga0268264_10080542
459 Ga0307508_10011570
460 Ga0307507_10204463
461 Ga0395900_0084226
462 Ga0395905_0027753
463 Ga0395901_0185343
464 Ga0395901_0203278
465 Ga0439450_000294
466 Ga0453683_0082581
467 Ga0453683_0145103
468 Ga0453684_0007315
469 Ga0466959_0068672
470 Ga0451576_0092768
471 Ga0495606_0069198
472 Ga0495628_0012578
473 Ga0495640_0002605
474 Ga0495600_0013019
475 Ga0495604_0109379
476 Ga0495676_0006984
477 Ga0496101_0128667
478 Ga0496104_0130970
479 Ga0496105_0112558
480 Ga0496110_0062543
481 Ga0496112_0047155
482 Ga0496112_0232910
483 Ga0496114_0151682
484 Ga0496122_0035520
485 Ga0496126_0041227
486 Ga0496126_0090662
487 Ga0501032_0111106
488 Ga0501033_0002153
489 Ga0501036_0037478
490 Ga0501038_0000585
491 Ga0501043_0033985
492 Ga0501046_0016098
493 Ga0501047_0130523
494 Ga0501048_0095602
495 Ga0501069_0007802
496 Ga0501070_0001733
497 Ga0501073_0008375
498 Ga0501074_0054432
499 Ga0501080_0004740
500 Ga0501035_0003193
501 nmdc:mga05p37_13345_c1
502 nmdc:mga05p37_367716_c1
503 nmdc:mga05p37_53683_c1
504 nmdc:mga05p37_61074_c1
505 nmdc:mga05p37_66226_c1
506 nmdc:mga09592_925_c1
507 nmdc:mga06r32_3848_c1
508 nmdc:mga08y16_235556_c1
509 nmdc:mga08y16_35623_c1
510 nmdc:mga0n895_28119_c1
511 nmdc:mga0n895_355168_c1
512 nmdc:mga0n895_54181_c1
513 nmdc:mga0n895_8326_c1
514 nmdc:mga0rr50_11889_c1
515 nmdc:mga0rr50_1364_c1
516 nmdc:mga0rr50_4081_c1
517 nmdc:mga08x19_5162_c1
518 nmdc:mga0a205_11405_c1
519 nmdc:mga0a205_171983_c1
520 nmdc:mga0a205_7245_c1
521 Ga0500616_0072582
522 Ga0501084_0241291
523 Ga0587070_001265
524 Ga0587073_0001883
525 Ga0587080_001648
526 Ga0587082_001260
527 Ga0587083_0001538
528 Ga0587085_005448
529 Ga0587086_001245
530 Ga0587088_000140
531 Ga0587092_001041
532 Ga0587094_000820
533 Ga0587106_004165
534 Ga0587109_003991
535 Ga0587115_003055
536 Ga0587067_003908
537 Ga0587069_002402
538 Ga0587075_001009
539 Ga0587076_005530
540 Ga0587078_000262
541 Ga0587079_001593
542 Ga0587071_002235
543 Ga0501082_0064573
544 2513675803
545 2528851358
546 2617347180
547 2824611054
548 2824663717
549 2824707815
550 2824757826
551 2824768663
552 2847937797
553 2879100975
554 2879106598
555 2888422194
556 2904695098
557 2904711674
558 2908756888
559 2922377502
560 2929622292
561 2929630062
562 2932788005
563 2932813380
564 2932820077
565 2932832859
566 2933584094
567 2935620343
568 2935640668
569 2935650232
570 2935658379
571 2935668861
572 2935680969
573 2935681414
574 2935687168
575 2935696861
576 2935709048
577 2935716856
578 2935723019
579 2935734576
580 2935744633
581 2935753134
582 2935767539
583 2935783614
584 2935804778
585 2935815927
586 2935832175
587 2935840995
588 2935859229
589 2935864413
590 2935875235
591 2935888128
592 2935995791
593 2936005702
594 2936013209
595 2936021704
596 2936030502
597 2936041830
598 2936047898
599 2936057900
600 2940559047
601 2941533310
602 2941541743
603 8016609858
604 8016615082
605 8017059253
606 8019545510
607 8019560238
608 8019570338
609 8019594254
610 8019607313
611 8055743459
612 8056689531

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10282

Lactonase

Lactonase, 7-bladed beta-propeller

84

244

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
8evx-assembly1.cif.gz_A ddla from pseudomonas aeruginosa pao1 in complex with adp and phosphorylated d-cycloserine 0.8455 89 107
6nau-assembly3.cif.gz_C 1.55 angstrom resolution crystal structure of 6-phosphogluconolactonase from klebsiella pneumoniae 0.8396 9 403
6utu-assembly1.cif.gz_F crystal structure of minor pseudopilin ternary complex of xcpvwx from the type 2 secretion system of pseudomonas aeruginosa in the p3 space group 0.82 77 107
1ri6-assembly1.cif.gz_A structure of a putative isomerase from e. coli 0.8198 15 403
6nau-assembly3.cif.gz_C 1.55 angstrom resolution crystal structure of 6-phosphogluconolactonase from klebsiella pneumoniae 0.8044 9 403
ID Description Score Start End Superfamily
af_Q0ISH6_1_91_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8525 371 402 3.30.420.10
af_P52697_1_331_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8192 15 411 2.130.10.10
af_Q10438_192_398_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.7895 89 112 3.30.470.20
af_P52697_1_331_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7872 15 411 2.130.10.10
af_Q9W040_2_135_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7851 301 405 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A1W9GYL4-F1-model_v4 3-carboxymuconate cyclase 0.9466 13 414 GO:0017057
AF-A0A1I5EY34-F1-model_v4 DUF5709 domain-containing protein 0.9453 58 414
AF-A0A1H5L9L0-F1-model_v4 Tat (Twin-arginine translocation) pathway signal sequence 0.9438 6 414
AF-A0A1W9GYL4-F1-model_v4 3-carboxymuconate cyclase 0.9372 13 414 GO:0017057
AF-A0A4Q0Q7U1-F1-model_v4 deleted 0.9317 125 275

Map