F398345

General Info

Members Datasets Scaffolds Average Seq Length
305 201 611 216

Family's Representative Sequence

Representative Sequence 3300049585|Ga0501069_0025738|Ga0501069_0025738_1367_2095
Length 242
Sequence MDGASAEGGVALESGPEGETSMARQLTLYSYWRSSAAYRVRIALNLKGMDYTIQPVHLLEGGGQQHAADYRALNPQQLIPLLLDGERAIRQSVSIIEYLDEVYPETTPLLPRDLRERARVRALALSIACDIHPLGNLRVLQYLESEFAAKDKQKNAWSKHWIKTGFDALEEMLAGSPEVGRCCSGDDPTLADCCLIPQVYNARRFGLKMDAYPTISRIDAACTELDAFKRAAPEAQPDAPAK

Samples

Sample ID Description Type Environment
1 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
6 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
9 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
83 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
85 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
126 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
127 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
133 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
134 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
135 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
136 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
137 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
138 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
139 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
140 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
141 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
142 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
143 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
144 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
145 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
146 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
147 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
148 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
149 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
150 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
151 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
152 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
153 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
154 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
155 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
156 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
157 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
158 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
159 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
160 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
161 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
162 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
163 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
164 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
170 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
171 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
172 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
183 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
184 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
185 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
186 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
187 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
188 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
191 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
193 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
194 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
195 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
196 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
197 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
198 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
199 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
200 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
201 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.69
Metatranscriptomes 0.33
Isolates 0.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.66
Nodule 0
Rhizoplane 7.21
Rhizosphere 88.85
Stem 0
Stem Tuber 0
Unclassified 0.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501069_0025738 3300049585 Bacteria 3217
2 JGI24752J21851_1000010 3300001976 Bacteria 20852
3 JGI24740J21852_10055935 3300001979 Bacteria 1108
4 JGI24739J22299_10022222 3300001989 Bacteria 2252
5 JGI24750J21931_1000016 3300002070 Bacteria 20913
6 JGI24748J21848_1000689 3300002074 Bacteria 3632
7 JGI24738J21930_10002279 3300002075 Bacteria 5076
8 JGI24749J21850_1001617 3300002076 Bacteria 3196
9 JGI24034J26672_10000007 3300002239 Bacteria 224370
10 rootH1_10039023 3300003316 Bacteria 3018
11 rootH1_10039023 3300003323 Bacteria 1584
12 Ga0070658_10015987 3300005327 Bacteria 6003
13 Ga0070658_10016126 3300005327 Bacteria 5976
14 Ga0070690_100000579 3300005330 Bacteria 18433
15 Ga0070666_10000017 3300005335 Bacteria 190526
16 Ga0070666_10009520 3300005335 Bacteria 6059
17 Ga0070680_100007579 3300005336 Bacteria 8278
18 Ga0070680_100028329 3300005336 Bacteria 4492
19 Ga0070682_100334289 3300005337 Bacteria 1124
20 Ga0068868_100089874 3300005338 Bacteria 2473
21 Ga0070689_100001897 3300005340 Bacteria 13508
22 Ga0070669_100000117 3300005353 Bacteria 74010
23 Ga0070671_100059187 3300005355 Bacteria 3188
24 Ga0070673_100134342 3300005364 Bacteria 2080
25 Ga0070688_100000254 3300005365 Bacteria 28113
26 Ga0070667_100141500 3300005367 Bacteria 2107
27 Ga0070709_10019250 3300005434 Bacteria 3944
28 Ga0070714_100091121 3300005435 Bacteria 2671
29 Ga0070713_100020366 3300005436 Bacteria 5084
30 Ga0070710_10053325 3300005437 Bacteria 2278
31 Ga0070711_100001157 3300005439 Bacteria 14198
32 Ga0070694_100142877 3300005444 Bacteria 1740
33 Ga0070663_100002004 3300005455 Bacteria 11374
34 Ga0070678_100000431 3300005456 Bacteria 19793
35 Ga0070681_10000484 3300005458 Bacteria 32437
36 Ga0070681_10004268 3300005458 Bacteria 13561
37 Ga0070681_10076627 3300005458 Bacteria 3302
38 Ga0070681_10218349 3300005458 Bacteria 1822
39 Ga0070681_10223647 3300005458 Bacteria 1797
40 Ga0070681_10404152 3300005458 Bacteria 1277
41 Ga0070685_10000384 3300005466 Bacteria 26547
42 Ga0070707_100976179 3300005468 Bacteria 812
43 Ga0070699_100040575 3300005518 Bacteria 4030
44 Ga0070679_100004885 3300005530 Bacteria 12365
45 Ga0070679_100032956 3300005530 Bacteria 5127
46 Ga0070679_100107578 3300005530 Bacteria 2774
47 Ga0070679_100174344 3300005530 Bacteria 2123
48 Ga0068853_100223475 3300005539 Unclassified 1720
49 Ga0068853_100529045 3300005539 Bacteria 1115
50 Ga0070686_100000014 3300005544 Bacteria 166729
51 Ga0070696_100003228 3300005546 Bacteria 10858
52 Ga0070696_100133874 3300005546 Bacteria 1806
53 Ga0070696_100281947 3300005546 Bacteria 1267
54 Ga0070696_100484157 3300005546 Bacteria 982
55 Ga0070693_100025870 3300005547 Bacteria 3161
56 Ga0070665_100000042 3300005548 Bacteria 292582
57 Ga0070665_100084684 3300005548 Bacteria 3175
58 Ga0070665_100272118 3300005548 Bacteria 1696
59 Ga0068855_100007649 3300005563 Bacteria 13069
60 Ga0068855_100049771 3300005563 Bacteria 4941
61 Ga0068855_100063359 3300005563 Bacteria 4314
62 Ga0068855_100307481 3300005563 Bacteria 1754
63 Ga0068854_100008890 3300005578 Bacteria 6468
64 Ga0068854_100012435 3300005578 Bacteria 5573
65 Ga0068856_100090481 3300005614 Bacteria 3044
66 Ga0068856_100544207 3300005614 Bacteria 1182
67 Ga0068852_101318782 3300005616 Bacteria 744
68 Ga0068859_100113798 3300005617 Bacteria 2769
69 Ga0068859_100175950 3300005617 Bacteria 2221
70 Ga0068866_10015876 3300005718 Bacteria 3354
71 Ga0068861_100108642 3300005719 Bacteria 2219
72 Ga0068863_100000068 3300005841 Bacteria 117128
73 Ga0068863_100003269 3300005841 Bacteria 16000
74 Ga0068858_100003970 3300005842 Bacteria 14593
75 Ga0068858_100063161 3300005842 Bacteria 3426
76 Ga0068860_100000062 3300005843 Bacteria 190526
77 Ga0068862_100000283 3300005844 Bacteria 56661
78 Ga0068862_100335748 3300005844 Bacteria 1399
79 Ga0068862_100456509 3300005844 Bacteria 1205
80 Ga0081455_10021531 3300005937 Bacteria 6045
81 Ga0070716_100018274 3300006173 Bacteria 3649
82 Ga0070712_100054437 3300006175 Bacteria 2797
83 Ga0097621_100002855 3300006237 Bacteria 11861
84 Ga0097621_100337839 3300006237 Bacteria 1337
85 Ga0068871_100052462 3300006358 Bacteria 3302
86 Ga0075430_100137434 3300006846 Bacteria 2036
87 Ga0097620_100113806 3300006931 Bacteria 2769
88 Ga0097620_100175952 3300006931 Bacteria 2221
89 Ga0105240_10004000 3300009093 Bacteria 22715
90 Ga0105240_10023231 3300009093 Bacteria 8209
91 Ga0105240_10062082 3300009093 Bacteria 4654
92 Ga0105240_10103863 3300009093 Bacteria 3451
93 Ga0105240_10249464 3300009093 Bacteria 2054
94 Ga0105240_10421264 3300009093 Bacteria 1500
95 Ga0105245_10020991 3300009098 Bacteria 5727
96 Ga0105247_10035804 3300009101 Bacteria 3027
97 Ga0105247_10263432 3300009101 Bacteria 1183
98 Ga0105243_11088627 3300009148 Bacteria 807
99 Ga0105241_10026163 3300009174 Bacteria 4339
100 Ga0105241_10105737 3300009174 Bacteria 2245
101 Ga0105242_10000954 3300009176 Bacteria 22585
102 Ga0105242_10325222 3300009176 Bacteria 1412
103 Ga0105248_10005763 3300009177 Bacteria 13609
104 Ga0105248_10042437 3300009177 Bacteria 5101
105 Ga0105237_10031435 3300009545 Bacteria 5383
106 Ga0105237_10061039 3300009545 Bacteria 3770
107 Ga0105237_10128502 3300009545 Bacteria 2528
108 Ga0105238_10002527 3300009551 Bacteria 18281
109 Ga0105238_10028634 3300009551 Bacteria 5674
110 Ga0105238_10319271 3300009551 Bacteria 1539
111 Ga0105249_10000012 3300009553 Bacteria 292640
112 Ga0105239_10069146 3300010375 Bacteria 3880
113 Ga0105239_10079410 3300010375 Bacteria 3611
114 Ga0105239_10128641 3300010375 Bacteria 2816
115 Ga0105239_10188275 3300010375 Bacteria 2310
116 Ga0157371_10011285 3300013102 Bacteria 6898
117 Ga0157371_10020987 3300013102 Bacteria 4802
118 Ga0157371_10120471 3300013102 Bacteria 1865
119 Ga0157370_10003419 3300013104 Bacteria 18642
120 Ga0157370_10003442 3300013104 Bacteria 18575
121 Ga0157370_10069648 3300013104 Bacteria 3322
122 Ga0157369_10020386 3300013105 Bacteria 7411
123 Ga0157378_10023828 3300013297 Bacteria 5385
124 Ga0163162_10336279 3300013306 Bacteria 1642
125 Ga0157372_10003229 3300013307 Bacteria 17609
126 Ga0163163_10268443 3300014325 Bacteria 1757
127 Ga0157380_10004510 3300014326 Bacteria 9657
128 Ga0157379_10084494 3300014968 Bacteria 2844
129 Ga0157379_10385984 3300014968 Bacteria 1285
130 Ga0157376_10049112 3300014969 Bacteria 3494
131 Ga0163161_10000025 3300017792 Bacteria 201127
132 Ga0206356_11237949 3300020070 Bacteria 2326
133 Ga0213876_10058204 3300021384 Bacteria 2040
134 Ga0207672_1000368 3300025223 Bacteria 5896
135 Ga0209233_1029676 3300025261 Bacteria 1297
136 Ga0207692_10004019 3300025898 Bacteria 5788
137 Ga0207642_10002286 3300025899 Bacteria 5971
138 Ga0207680_10000012 3300025903 Bacteria 293810
139 Ga0207680_10225157 3300025903 Bacteria 1287
140 Ga0207699_10058343 3300025906 Bacteria 2309
141 Ga0207699_10248279 3300025906 Bacteria 1225
142 Ga0207654_10026002 3300025911 Bacteria 3165
143 Ga0207707_10000020 3300025912 Bacteria 205480
144 Ga0207707_10001408 3300025912 Bacteria 22278
145 Ga0207707_10113655 3300025912 Bacteria 2366
146 Ga0207707_10138373 3300025912 Bacteria 2129
147 Ga0207707_10222270 3300025912 Bacteria 1644
148 Ga0207695_10019794 3300025913 Bacteria 7736
149 Ga0207695_10037246 3300025913 Bacteria 5249
150 Ga0207695_10040372 3300025913 Bacteria 5005
151 Ga0207695_10090560 3300025913 Bacteria 3074
152 Ga0207695_10218385 3300025913 Bacteria 1814
153 Ga0207695_10465498 3300025913 Bacteria 1147
154 Ga0207695_10823005 3300025913 Bacteria 809
155 Ga0207671_10182684 3300025914 Bacteria 1633
156 Ga0207693_10000074 3300025915 Bacteria 88611
157 Ga0207663_10050832 3300025916 Bacteria 2578
158 Ga0207660_10001345 3300025917 Bacteria 16457
159 Ga0207660_10030756 3300025917 Bacteria 3691
160 Ga0207652_10000037 3300025921 Bacteria 134369
161 Ga0207652_10003570 3300025921 Bacteria 12828
162 Ga0207652_10079283 3300025921 Bacteria 2869
163 Ga0207681_10000182 3300025923 Bacteria 51520
164 Ga0207694_10001241 3300025924 Bacteria 22055
165 Ga0207694_10103778 3300025924 Bacteria 2255
166 Ga0207694_10295797 3300025924 Bacteria 1332
167 Ga0207694_10365150 3300025924 Bacteria 1197
168 Ga0207650_10077489 3300025925 Bacteria 2513
169 Ga0207700_10013206 3300025928 Bacteria 5363
170 Ga0207700_10286462 3300025928 Bacteria 1419
171 Ga0207664_10078621 3300025929 Bacteria 2676
172 Ga0207644_10005017 3300025931 Bacteria 8640
173 Ga0207644_10012651 3300025931 Bacteria 5608
174 Ga0207670_10004685 3300025936 Bacteria 7416
175 Ga0207665_10006110 3300025939 Bacteria 7998
176 Ga0207711_10025781 3300025941 Bacteria 4929
177 Ga0207711_10090285 3300025941 Bacteria 2693
178 Ga0207667_10048652 3300025949 Bacteria 4482
179 Ga0207667_10401373 3300025949 Bacteria 1396
180 Ga0207651_10026462 3300025960 Bacteria 3625
181 Ga0207712_10000021 3300025961 Bacteria 292649
182 Ga0207640_10004756 3300025981 Bacteria 7369
183 Ga0207658_10006420 3300025986 Bacteria 8026
184 Ga0207658_10041744 3300025986 Bacteria 3323
185 Ga0207677_10317431 3300026023 Bacteria 1293
186 Ga0207703_10000738 3300026035 Bacteria 32194
187 Ga0207703_10364510 3300026035 Bacteria 1333
188 Ga0207639_10154776 3300026041 Bacteria 1924
189 Ga0207639_10453484 3300026041 Unclassified 1165
190 Ga0207678_10017607 3300026067 Bacteria 6273
191 Ga0207702_10021183 3300026078 Bacteria 5380
192 Ga0207702_10187004 3300026078 Bacteria 1911
193 Ga0207702_10379657 3300026078 Bacteria 1359
194 Ga0207641_10000037 3300026088 Bacteria 206551
195 Ga0207641_10029082 3300026088 Bacteria 4569
196 Ga0207676_10001119 3300026095 Bacteria 20319
197 Ga0207675_100000088 3300026118 Bacteria 71728
198 Ga0207683_10001847 3300026121 Bacteria 18723
199 Ga0207698_10887858 3300026142 Bacteria 898
200 Ga0268266_10000054 3300028379 Bacteria 292717
201 Ga0268266_10064349 3300028379 Bacteria 3168
202 Ga0268266_10127970 3300028379 Bacteria 2268
203 Ga0268265_10000092 3300028380 Bacteria 114086
204 Ga0268265_10104120 3300028380 Bacteria 2299
205 Ga0268265_11088484 3300028380 Bacteria 793
206 Ga0268264_10000074 3300028381 Bacteria 259555
207 Ga0307416_100052898 3300032002 Bacteria 3254
208 Ga0307416_101340246 3300032002 Bacteria 821
209 Ga0307415_100144575 3300032126 Bacteria 1821
210 Ga0373954_0072005 3300035118 Bacteria 1643
211 Ga0373943_0024331 3300035170 Bacteria 2823
212 Ga0373937_0123868 3300036401 Bacteria 2410
213 Ga0373925_0061809 3300037068 Bacteria 2814
214 Ga0395901_0594218 3300038443 Bacteria 1117
215 Ga0436365_0284105 3300039437 Bacteria 5988
216 Ga0436361_0265990 3300039447 Bacteria 3177
217 Ga0436363_0273076 3300039450 Bacteria 3920
218 Ga0436362_0044789 3300039453 Bacteria 7722
219 Ga0436362_0627928 3300039453 Bacteria 1453
220 Ga0439466_0138887 3300041411 Bacteria 746
221 Ga0451853_3080526 3300041512 Bacteria 1004
222 Ga0466966_0000598 3300044684 Bacteria 22864
223 Ga0466961_0000605 3300044693 Bacteria 22610
224 Ga0466964_0000421 3300044706 Bacteria 12803
225 Ga0466971_0000838 3300044719 Bacteria 12502
226 Ga0466970_0000143 3300044765 Bacteria 32924
227 Ga0466957_0027248 3300044842 Unclassified 3395
228 Ga0466959_0081716 3300045049 Bacteria 2328
229 Ga0466958_0272526 3300045836 Bacteria 1084
230 Ga0495629_0655652 3300046459 Bacteria 699
231 Ga0495580_0058125 3300046472 Bacteria 2721
232 Ga0495639_0213181 3300046475 Bacteria 948
233 Ga0495628_0163126 3300046516 Bacteria 1693
234 Ga0495665_0119467 3300046531 Bacteria 1381
235 Ga0495587_0044151 3300046536 Bacteria 2652
236 Ga0495621_0022374 3300046539 Bacteria 2094
237 Ga0495674_0160224 3300047319 Bacteria 1883
238 Ga0496100_0041736 3300048903 Bacteria 2926
239 Ga0496100_0540948 3300048903 Bacteria 900
240 Ga0496101_0017182 3300048904 Bacteria 4903
241 Ga0496101_0184855 3300048904 Bacteria 1606
242 Ga0496102_0010114 3300048905 Bacteria 8114
243 Ga0496102_0252329 3300048905 Bacteria 1663
244 Ga0496102_0889093 3300048905 Bacteria 812
245 Ga0496103_0002043 3300048906 Bacteria 12947
246 Ga0496104_0049069 3300048907 Bacteria 3981
247 Ga0496104_0071377 3300048907 Bacteria 3301
248 Ga0496105_0332207 3300048908 Bacteria 1216
249 Ga0496106_0024828 3300048909 Bacteria 4456
250 Ga0496107_0013579 3300048910 Bacteria 5694
251 Ga0496107_0253090 3300048910 Bacteria 1310
252 Ga0496108_0007042 3300048911 Bacteria 9105
253 Ga0496109_0001788 3300048912 Bacteria 17869
254 Ga0496110_0025633 3300048913 Bacteria 5041
255 Ga0496111_0417699 3300048914 Bacteria 991
256 Ga0496112_0008358 3300048915 Bacteria 9269
257 Ga0496113_0047140 3300048916 Bacteria 3202
258 Ga0496114_0012593 3300048917 Bacteria 6775
259 Ga0496115_0108217 3300048918 Bacteria 2282
260 Ga0496116_0043142 3300048919 Bacteria 3076
261 Ga0496117_0029540 3300048920 Bacteria 4224
262 Ga0496124_0338639 3300048927 Bacteria 1069
263 Ga0501031_0389919 3300049568 Bacteria 901
264 Ga0501031_0448687 3300049568 Bacteria 833
265 Ga0501032_0164838 3300049569 Bacteria 1454
266 Ga0501033_0338652 3300049570 Bacteria 1055
267 Ga0501033_0500888 3300049570 Bacteria 840
268 Ga0501034_0050359 3300049571 Bacteria 4201
269 Ga0501037_0012414 3300049573 Bacteria 6274
270 Ga0501038_0371831 3300049574 Bacteria 1110
271 Ga0501042_0214685 3300049578 Bacteria 1388
272 Ga0501042_0281535 3300049578 Bacteria 1201
273 Ga0501043_0494402 3300049579 Bacteria 914
274 Ga0501046_0045684 3300049580 Bacteria 3478
275 Ga0501047_0000341 3300049581 Bacteria 53185
276 Ga0501047_0016380 3300049581 Bacteria 7076
277 Ga0501069_0001525 3300049585 Bacteria 11454
278 Ga0501069_0005191 3300049585 Bacteria 6767
279 Ga0501070_0000811 3300049586 Bacteria 28388
280 Ga0501070_0639185 3300049586 Bacteria 845
281 Ga0501071_0004620 3300049587 Bacteria 8738
282 Ga0501072_0031797 3300049588 Bacteria 4132
283 Ga0501073_0004523 3300049589 Bacteria 10455
284 Ga0501073_0007523 3300049589 Bacteria 8090
285 Ga0501074_0001055 3300049590 Bacteria 17996
286 Ga0501074_0002146 3300049590 Bacteria 13641
287 Ga0501077_0167852 3300049593 Bacteria 1394
288 Ga0501079_0007767 3300049741 Bacteria 8119
289 Ga0501080_0003154 3300049742 Bacteria 14524
290 Ga0501080_0149017 3300049742 Bacteria 2163
291 Ga0501080_0550616 3300049742 Bacteria 1027
292 Ga0501080_0824182 3300049742 Bacteria 812
293 Ga0501083_0000773 3300049744 Bacteria 20959
294 Ga0501083_0046419 3300049744 Bacteria 2937
295 Ga0501035_0204586 3300049822 Bacteria 1691
296 Ga0501044_0008885 3300049823 Bacteria 10983
297 Ga0501044_0051363 3300049823 Bacteria 4251
298 nmdc:mga0qj67_118516_c1 3300050509 Bacteria 2140
299 Ga0495619_0064529 3300053085 Bacteria 2442
300 Ga0500637_0055811 3300053178 Bacteria 2257
301 Ga0501084_0117116 3300054114 Bacteria 2240
302 Ga0501082_0005025 3300060353 Bacteria 11542
303 Ga0466962_0011558 3300061719 Bacteria 4252
304 2643894647 2643221577 Bacteria 3710843
305 2644476796 2643221685 Bacteria 3673288
306 2883293156 2883291878 Bacteria 5894118
307 Ga0501069_0025738
308 JGI24752J21851_1000010
309 JGI24740J21852_10055935
310 JGI24739J22299_10022222
311 JGI24750J21931_1000016
312 JGI24748J21848_1000689
313 JGI24738J21930_10002279
314 JGI24749J21850_1001617
315 JGI24034J26672_10000007
316 rootH1_10039023
317 Ga0070658_10015987
318 Ga0070658_10016126
319 Ga0070690_100000579
320 Ga0070666_10000017
321 Ga0070666_10009520
322 Ga0070680_100007579
323 Ga0070680_100028329
324 Ga0070682_100334289
325 Ga0068868_100089874
326 Ga0070689_100001897
327 Ga0070669_100000117
328 Ga0070671_100059187
329 Ga0070673_100134342
330 Ga0070688_100000254
331 Ga0070667_100141500
332 Ga0070709_10019250
333 Ga0070714_100091121
334 Ga0070713_100020366
335 Ga0070710_10053325
336 Ga0070711_100001157
337 Ga0070694_100142877
338 Ga0070663_100002004
339 Ga0070678_100000431
340 Ga0070681_10000484
341 Ga0070681_10004268
342 Ga0070681_10076627
343 Ga0070681_10218349
344 Ga0070681_10223647
345 Ga0070681_10404152
346 Ga0070685_10000384
347 Ga0070707_100976179
348 Ga0070699_100040575
349 Ga0070679_100004885
350 Ga0070679_100032956
351 Ga0070679_100107578
352 Ga0070679_100174344
353 Ga0068853_100223475
354 Ga0068853_100529045
355 Ga0070686_100000014
356 Ga0070696_100003228
357 Ga0070696_100133874
358 Ga0070696_100281947
359 Ga0070696_100484157
360 Ga0070693_100025870
361 Ga0070665_100000042
362 Ga0070665_100084684
363 Ga0070665_100272118
364 Ga0068855_100007649
365 Ga0068855_100049771
366 Ga0068855_100063359
367 Ga0068855_100307481
368 Ga0068854_100008890
369 Ga0068854_100012435
370 Ga0068856_100090481
371 Ga0068856_100544207
372 Ga0068852_101318782
373 Ga0068859_100113798
374 Ga0068859_100175950
375 Ga0068866_10015876
376 Ga0068861_100108642
377 Ga0068863_100000068
378 Ga0068863_100003269
379 Ga0068858_100003970
380 Ga0068858_100063161
381 Ga0068860_100000062
382 Ga0068862_100000283
383 Ga0068862_100335748
384 Ga0068862_100456509
385 Ga0081455_10021531
386 Ga0070716_100018274
387 Ga0070712_100054437
388 Ga0097621_100002855
389 Ga0097621_100337839
390 Ga0068871_100052462
391 Ga0075430_100137434
392 Ga0097620_100113806
393 Ga0097620_100175952
394 Ga0105240_10004000
395 Ga0105240_10023231
396 Ga0105240_10062082
397 Ga0105240_10103863
398 Ga0105240_10249464
399 Ga0105240_10421264
400 Ga0105245_10020991
401 Ga0105247_10035804
402 Ga0105247_10263432
403 Ga0105243_11088627
404 Ga0105241_10026163
405 Ga0105241_10105737
406 Ga0105242_10000954
407 Ga0105242_10325222
408 Ga0105248_10005763
409 Ga0105248_10042437
410 Ga0105237_10031435
411 Ga0105237_10061039
412 Ga0105237_10128502
413 Ga0105238_10002527
414 Ga0105238_10028634
415 Ga0105238_10319271
416 Ga0105249_10000012
417 Ga0105239_10069146
418 Ga0105239_10079410
419 Ga0105239_10128641
420 Ga0105239_10188275
421 Ga0157371_10011285
422 Ga0157371_10020987
423 Ga0157371_10120471
424 Ga0157370_10003419
425 Ga0157370_10003442
426 Ga0157370_10069648
427 Ga0157369_10020386
428 Ga0157378_10023828
429 Ga0163162_10336279
430 Ga0157372_10003229
431 Ga0163163_10268443
432 Ga0157380_10004510
433 Ga0157379_10084494
434 Ga0157379_10385984
435 Ga0157376_10049112
436 Ga0163161_10000025
437 Ga0206356_11237949
438 Ga0213876_10058204
439 Ga0207672_1000368
440 Ga0209233_1029676
441 Ga0207692_10004019
442 Ga0207642_10002286
443 Ga0207680_10000012
444 Ga0207680_10225157
445 Ga0207699_10058343
446 Ga0207699_10248279
447 Ga0207654_10026002
448 Ga0207707_10000020
449 Ga0207707_10001408
450 Ga0207707_10113655
451 Ga0207707_10138373
452 Ga0207707_10222270
453 Ga0207695_10019794
454 Ga0207695_10037246
455 Ga0207695_10040372
456 Ga0207695_10090560
457 Ga0207695_10218385
458 Ga0207695_10465498
459 Ga0207695_10823005
460 Ga0207671_10182684
461 Ga0207693_10000074
462 Ga0207663_10050832
463 Ga0207660_10001345
464 Ga0207660_10030756
465 Ga0207652_10000037
466 Ga0207652_10003570
467 Ga0207652_10079283
468 Ga0207681_10000182
469 Ga0207694_10001241
470 Ga0207694_10103778
471 Ga0207694_10295797
472 Ga0207694_10365150
473 Ga0207650_10077489
474 Ga0207700_10013206
475 Ga0207700_10286462
476 Ga0207664_10078621
477 Ga0207644_10005017
478 Ga0207644_10012651
479 Ga0207670_10004685
480 Ga0207665_10006110
481 Ga0207711_10025781
482 Ga0207711_10090285
483 Ga0207667_10048652
484 Ga0207667_10401373
485 Ga0207651_10026462
486 Ga0207712_10000021
487 Ga0207640_10004756
488 Ga0207658_10006420
489 Ga0207658_10041744
490 Ga0207677_10317431
491 Ga0207703_10000738
492 Ga0207703_10364510
493 Ga0207639_10154776
494 Ga0207639_10453484
495 Ga0207678_10017607
496 Ga0207702_10021183
497 Ga0207702_10187004
498 Ga0207702_10379657
499 Ga0207641_10000037
500 Ga0207641_10029082
501 Ga0207676_10001119
502 Ga0207675_100000088
503 Ga0207683_10001847
504 Ga0207698_10887858
505 Ga0268266_10000054
506 Ga0268266_10064349
507 Ga0268266_10127970
508 Ga0268265_10000092
509 Ga0268265_10104120
510 Ga0268265_11088484
511 Ga0268264_10000074
512 Ga0307416_100052898
513 Ga0307416_101340246
514 Ga0307415_100144575
515 Ga0373954_0072005
516 Ga0373943_0024331
517 Ga0373937_0123868
518 Ga0373925_0061809
519 Ga0395901_0594218
520 Ga0436365_0284105
521 Ga0436361_0265990
522 Ga0436363_0273076
523 Ga0436362_0044789
524 Ga0436362_0627928
525 Ga0439466_0138887
526 Ga0451853_3080526
527 Ga0466966_0000598
528 Ga0466961_0000605
529 Ga0466964_0000421
530 Ga0466971_0000838
531 Ga0466970_0000143
532 Ga0466957_0027248
533 Ga0466959_0081716
534 Ga0466958_0272526
535 Ga0495629_0655652
536 Ga0495580_0058125
537 Ga0495639_0213181
538 Ga0495628_0163126
539 Ga0495665_0119467
540 Ga0495587_0044151
541 Ga0495621_0022374
542 Ga0495674_0160224
543 Ga0496100_0041736
544 Ga0496100_0540948
545 Ga0496101_0017182
546 Ga0496101_0184855
547 Ga0496102_0010114
548 Ga0496102_0252329
549 Ga0496102_0889093
550 Ga0496103_0002043
551 Ga0496104_0049069
552 Ga0496104_0071377
553 Ga0496105_0332207
554 Ga0496106_0024828
555 Ga0496107_0013579
556 Ga0496107_0253090
557 Ga0496108_0007042
558 Ga0496109_0001788
559 Ga0496110_0025633
560 Ga0496111_0417699
561 Ga0496112_0008358
562 Ga0496113_0047140
563 Ga0496114_0012593
564 Ga0496115_0108217
565 Ga0496116_0043142
566 Ga0496117_0029540
567 Ga0496124_0338639
568 Ga0501031_0389919
569 Ga0501031_0448687
570 Ga0501032_0164838
571 Ga0501033_0338652
572 Ga0501033_0500888
573 Ga0501034_0050359
574 Ga0501037_0012414
575 Ga0501038_0371831
576 Ga0501042_0214685
577 Ga0501042_0281535
578 Ga0501043_0494402
579 Ga0501046_0045684
580 Ga0501047_0000341
581 Ga0501047_0016380
582 Ga0501069_0001525
583 Ga0501069_0005191
584 Ga0501070_0000811
585 Ga0501070_0639185
586 Ga0501071_0004620
587 Ga0501072_0031797
588 Ga0501073_0004523
589 Ga0501073_0007523
590 Ga0501074_0001055
591 Ga0501074_0002146
592 Ga0501077_0167852
593 Ga0501079_0007767
594 Ga0501080_0003154
595 Ga0501080_0149017
596 Ga0501080_0550616
597 Ga0501080_0824182
598 Ga0501083_0000773
599 Ga0501083_0046419
600 Ga0501035_0204586
601 Ga0501044_0008885
602 Ga0501044_0051363
603 nmdc:mga0qj67_118516_c1
604 Ga0495619_0064529
605 Ga0500637_0055811
606 Ga0501084_0117116
607 Ga0501082_0005025
608 Ga0466962_0011558
609 2643894647
610 2644476796
611 2883293156

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

28

107

0.95

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

33

102

0.93

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

24

101

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jl4-assembly1.cif.gz_B holo structure of maleyl pyruvate isomerase, a bacterial glutathione- s-transferase in zeta class 0.9842 7 215
3niv-assembly1.cif.gz_B the crystal structure of glutathione s-transferase from legionella pneumophila 0.9733 7 211
2cz3-assembly1.cif.gz_A crystal structure of glutathione transferase zeta 1-1 (maleylacetoacetate isomerase) from mus musculus (form-2 crystal) 0.9728 4 215
1fw1-assembly1.cif.gz_A-2 glutathione transferase zeta/maleylacetoacetate isomerase 0.9699 5 215
2cz2-assembly1.cif.gz_A-2 crystal structure of glutathione transferase zeta 1-1 (maleylacetoacetate isomerase) from mus musculus (form-1 crystal) 0.9677 4 215
ID Description Score Start End Superfamily
2v6kB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9908 9 82 3.40.30.10
af_A0A1D6HAW8_13_80_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9855 9 74 3.40.30.10
4yh2C01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9833 5 81 3.40.30.10
af_Q7JVZ8_6_81_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9771 8 81 3.40.30.10
2v6kB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9755 88 215 1.20.1050.10
ID Description Score Start End GO Terms
AF-A0A519X888-F1-model_v4 deleted 0.9977 6 180
AF-A0A2H6B0J6-F1-model_v4 Maleylpyruvate isomerase (EC 5.2.1.4) 0.991 5 215 GO:0004364
GO:0005737
GO:0006559
GO:0006749
GO:0016034
GO:0050077
AF-A0A5P9NJ34-F1-model_v4 Maleylacetoacetate isomerase (EC 5.2.1.2) 0.991 7 214 GO:0004364
GO:0005737
GO:0006559
GO:0006749
GO:0016034
AF-A0A1N6Q2M5-F1-model_v4 Maleylpyruvate isomerase 0.9907 5 208 GO:0004364
GO:0005737
GO:0006559
GO:0006749
GO:0016034
AF-A0A2E2NTZ1-F1-model_v4 deleted 0.9906 5 215

Map