F398274

General Info

Members Datasets Scaffolds Average Seq Length
305 208 610 175

Family's Representative Sequence

Representative Sequence 3300046462|Ga0495651_0000874|Ga0495651_0000874_10898_11461
Length 177
Sequence VVELSSGGSNLAPDAALKIAGIEIPFKSPLLLTLLAVHVLAGLVCVVTGIVAMLSRKRPGRHPRFGTIYYWGLAVLFTTATVLAATRWTEDHNLVVLGLISLAAASLGRARVHISSMGSSYIFMLIAFYVDNGKSLPLWKDLPRFTYWLLPALFGTPLIVWALVRYRRFSDAAAENE

Samples

Sample ID Description Type Environment
1 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
53 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
97 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
101 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
102 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
103 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
104 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
105 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
106 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
107 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
108 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
109 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
110 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
111 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
112 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
113 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
114 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
115 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
116 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
117 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
118 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
119 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
120 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
121 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
122 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
123 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
126 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
127 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
128 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
129 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
130 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
131 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
132 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
133 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
134 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
135 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
136 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
137 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
138 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
139 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
140 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
141 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
142 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
143 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
144 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
145 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
146 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
147 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
148 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
149 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
150 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
151 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
152 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
153 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
154 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
155 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
156 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
157 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
158 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
159 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
160 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
161 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
162 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
163 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
164 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
165 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
166 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
167 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
168 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
169 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
170 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
175 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
176 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
183 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
184 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
185 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
186 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
187 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
188 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
189 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
190 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
191 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
192 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
193 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
194 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
195 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
196 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
197 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
198 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
199 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
200 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
201 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
202 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
203 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
204 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
205 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
206 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
207 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
208 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.93
Nodule 0
Rhizoplane 6.56
Rhizosphere 86.23
Stem 0
Stem Tuber 0
Unclassified 8.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495651_0000874 3300046462 Bacteria 23391
2 Ga0065707_10088860 3300005295 Bacteria 4531
3 Ga0065707_10163977 3300005295 Bacteria 1539
4 Ga0070670_100439425 3300005331 Bacteria 1155
5 Ga0068869_100107605 3300005334 Bacteria 2117
6 Ga0070680_100865013 3300005336 Bacteria 779
7 Ga0070682_100614515 3300005337 Bacteria 860
8 Ga0068868_101051676 3300005338 Bacteria 747
9 Ga0070691_10027390 3300005341 Bacteria 2659
10 Ga0070661_100767831 3300005344 Bacteria 789
11 Ga0070692_10155101 3300005345 Bacteria 1307
12 Ga0070692_10691458 3300005345 Bacteria 685
13 Ga0070668_100188211 3300005347 Bacteria 1689
14 Ga0070669_100171667 3300005353 Bacteria 1691
15 Ga0070675_100332462 3300005354 Bacteria 1344
16 Ga0070675_100921466 3300005354 Bacteria 801
17 Ga0070659_100212579 3300005366 Bacteria 1594
18 Ga0070703_10001345 3300005406 Bacteria 7454
19 Ga0070709_10365066 3300005434 Bacteria 1070
20 Ga0070714_100066416 3300005435 Bacteria 3109
21 Ga0070714_100111762 3300005435 Bacteria 2420
22 Ga0070713_100025614 3300005436 Bacteria 4615
23 Ga0070713_100079112 3300005436 Bacteria 2800
24 Ga0070701_10021579 3300005438 Bacteria 3076
25 Ga0070705_100000280 3300005440 Bacteria 30477
26 Ga0070705_100092004 3300005440 Bacteria 1892
27 Ga0070700_100004894 3300005441 Bacteria 7041
28 Ga0070694_100004907 3300005444 Bacteria 8060
29 Ga0070708_100002986 3300005445 Bacteria 13147
30 Ga0070708_100102026 3300005445 Bacteria 2628
31 Ga0070678_100101901 3300005456 Bacteria 2227
32 Ga0070662_100282821 3300005457 Bacteria 1343
33 Ga0070681_10138412 3300005458 Bacteria 2364
34 Ga0070698_100000532 3300005471 Bacteria 40626
35 Ga0070698_100272180 3300005471 Bacteria 1625
36 Ga0070698_100571986 3300005471 Bacteria 1070
37 Ga0070699_100000255 3300005518 Bacteria 52092
38 Ga0070699_100071399 3300005518 Bacteria 3020
39 Ga0070679_100205273 3300005530 Bacteria 1935
40 Ga0070697_100285669 3300005536 Unclassified 1416
41 Ga0070695_100016098 3300005545 Bacteria 4521
42 Ga0070696_100001661 3300005546 Bacteria 14581
43 Ga0070704_100002550 3300005549 Bacteria 10262
44 Ga0070664_100680747 3300005564 Bacteria 957
45 Ga0068857_100234169 3300005577 Bacteria 1680
46 Ga0068864_100043122 3300005618 Bacteria 3862
47 Ga0068861_100093029 3300005719 Bacteria 2383
48 Ga0068861_100384104 3300005719 Bacteria 1241
49 Ga0068870_10383937 3300005840 Bacteria 910
50 Ga0068863_100207291 3300005841 Bacteria 1887
51 Ga0068858_100273438 3300005842 Bacteria 1608
52 Ga0068858_100436314 3300005842 Bacteria 1261
53 Ga0068858_100987140 3300005842 Bacteria 825
54 Ga0068858_101491047 3300005842 Bacteria 667
55 Ga0068860_100001979 3300005843 Bacteria 21661
56 Ga0068860_100731063 3300005843 Bacteria 1001
57 Ga0068860_101303823 3300005843 Bacteria 747
58 Ga0068862_100001938 3300005844 Bacteria 18791
59 Ga0068862_100034288 3300005844 Bacteria 4293
60 Ga0070717_10023760 3300006028 Bacteria 4861
61 Ga0070717_10559881 3300006028 Bacteria 1035
62 Ga0070716_100205930 3300006173 Bacteria 1311
63 Ga0070712_101210593 3300006175 Bacteria 657
64 Ga0075369_10068671 3300006186 Bacteria 1558
65 Ga0068871_100273062 3300006358 Bacteria 1477
66 Ga0068871_100981120 3300006358 Bacteria 786
67 Ga0075428_101044592 3300006844 Bacteria 864
68 Ga0075428_101178913 3300006844 Unclassified 808
69 Ga0075430_100480225 3300006846 Bacteria 1025
70 Ga0075431_100946978 3300006847 Bacteria 829
71 Ga0075429_100529790 3300006880 Bacteria 1032
72 Ga0099794_10017317 3300007265 Bacteria 3209
73 Ga0099794_10052896 3300007265 Unclassified 1958
74 Ga0099795_10270653 3300007788 Unclassified 738
75 Ga0105245_10272395 3300009098 Bacteria 1651
76 Ga0105245_10514501 3300009098 Bacteria 1215
77 Ga0114129_10075936 3300009147 Bacteria 4679
78 Ga0105243_11025354 3300009148 Bacteria 829
79 Ga0105242_10028888 3300009176 Bacteria 4418
80 Ga0105242_11238946 3300009176 Bacteria 767
81 Ga0105248_10075131 3300009177 Bacteria 3798
82 Ga0105237_10156720 3300009545 Bacteria 2274
83 Ga0105237_10318215 3300009545 Bacteria 1559
84 Ga0105238_10181338 3300009551 Bacteria 2082
85 Ga0105249_10003367 3300009553 Bacteria 13834
86 Ga0105249_10216872 3300009553 Bacteria 1881
87 Ga0105249_10476048 3300009553 Bacteria 1291
88 Ga0105249_11415560 3300009553 Bacteria 767
89 Ga0099796_10124875 3300010159 Bacteria 992
90 Ga0105239_10351732 3300010375 Bacteria 1664
91 Ga0105239_10484097 3300010375 Bacteria 1406
92 Ga0105239_10677295 3300010375 Bacteria 1179
93 Ga0105246_10156935 3300011119 Bacteria 1729
94 Ga0105246_10388468 3300011119 Unclassified 1155
95 Ga0105246_11168844 3300011119 Unclassified 706
96 Ga0157370_10228333 3300013104 Bacteria 1723
97 Ga0157378_11715960 3300013297 Bacteria 675
98 Ga0163162_10162646 3300013306 Bacteria 2354
99 Ga0163162_10880774 3300013306 Bacteria 1009
100 Ga0157379_10697140 3300014968 Bacteria 953
101 Ga0157379_11024032 3300014968 Unclassified 788
102 Ga0207653_10000609 3300025885 Bacteria 12487
103 Ga0207692_10296444 3300025898 Bacteria 983
104 Ga0207710_10268283 3300025900 Bacteria 857
105 Ga0207645_10126229 3300025907 Bacteria 1663
106 Ga0207643_10028299 3300025908 Bacteria 3112
107 Ga0207707_10094491 3300025912 Bacteria 2612
108 Ga0207671_10263896 3300025914 Bacteria 1356
109 Ga0207693_10014017 3300025915 Bacteria 6454
110 Ga0207693_11133220 3300025915 Bacteria 593
111 Ga0207660_10124017 3300025917 Bacteria 1960
112 Ga0207681_10261788 3300025923 Bacteria 1354
113 Ga0207681_10291366 3300025923 Bacteria 1288
114 Ga0207659_10696319 3300025926 Unclassified 870
115 Ga0207700_10031994 3300025928 Bacteria 3745
116 Ga0207700_10161277 3300025928 Bacteria 1862
117 Ga0207664_10206231 3300025929 Bacteria 1699
118 Ga0207664_10287151 3300025929 Unclassified 1445
119 Ga0207690_10148632 3300025932 Bacteria 1735
120 Ga0207686_10621026 3300025934 Bacteria 852
121 Ga0207709_10629019 3300025935 Bacteria 852
122 Ga0207669_10595039 3300025937 Bacteria 898
123 Ga0207665_10014191 3300025939 Bacteria 5242
124 Ga0207665_10150614 3300025939 Bacteria 1666
125 Ga0207665_10817446 3300025939 Bacteria 737
126 Ga0207689_10328895 3300025942 Bacteria 1269
127 Ga0207689_10588424 3300025942 Bacteria 936
128 Ga0207712_10004660 3300025961 Bacteria 8663
129 Ga0207712_10142840 3300025961 Bacteria 1839
130 Ga0207712_10323565 3300025961 Bacteria 1273
131 Ga0207703_11196936 3300026035 Bacteria 730
132 Ga0207708_10009199 3300026075 Bacteria 7311
133 Ga0207708_10108505 3300026075 Bacteria 2153
134 Ga0207641_10084796 3300026088 Bacteria 2759
135 Ga0207641_10696773 3300026088 Bacteria 1000
136 Ga0207676_10051881 3300026095 Bacteria 3204
137 Ga0207674_10223822 3300026116 Bacteria 1830
138 Ga0207674_10559348 3300026116 Bacteria 1105
139 Ga0207675_100233548 3300026118 Bacteria 1775
140 Ga0207683_10066729 3300026121 Bacteria 3173
141 Ga0207428_10424120 3300027907 Bacteria 972
142 Ga0265356_1000907 3300028017 Plasmid 4801
143 Ga0268265_10001918 3300028380 Bacteria 16534
144 Ga0268265_10082792 3300028380 Bacteria 2538
145 Ga0268264_10001803 3300028381 Bacteria 19576
146 Ga0265334_10104164 3300028573 Bacteria 1024
147 Ga0265325_10019623 3300031241 Bacteria 3734
148 Ga0265340_10057941 3300031247 Bacteria 1861
149 Ga0307509_10098946 3300031507 Bacteria 2959
150 Ga0307508_10000010 3300031616 Bacteria 255747
151 Ga0307516_10004439 3300031730 Bacteria 17302
152 Ga0307507_10201477 3300033179 Bacteria 1376
153 Ga0373928_0081990 3300035084 Bacteria 815
154 Ga0373934_0089930 3300035086 Bacteria 1237
155 Ga0373940_0088805 3300035088 Bacteria 923
156 Ga0373951_0088031 3300035091 Bacteria 812
157 Ga0373952_0009455 3300035092 Unclassified 1867
158 Ga0373923_0218511 3300035111 Unclassified 885
159 Ga0373932_0032304 3300035112 Unclassified 1463
160 Ga0373954_0011530 3300035118 Bacteria 3919
161 Ga0373954_0065841 3300035118 Bacteria 1715
162 Ga0373956_0043009 3300035119 Bacteria 2010
163 Ga0373957_0006606 3300035120 Bacteria 3664
164 Ga0373946_0066206 3300035171 Bacteria 1549
165 Ga0373955_0004930 3300035172 Bacteria 5956
166 Ga0373955_0124600 3300035172 Unclassified 1500
167 Ga0373955_0150044 3300035172 Bacteria 1372
168 Ga0373924_0040442 3300035410 Bacteria 1908
169 Ga0373931_0008384 3300035691 Bacteria 4900
170 Ga0373931_0016583 3300035691 Bacteria 3628
171 Ga0373935_0006262 3300035692 Bacteria 7084
172 Ga0373935_0504114 3300035692 Bacteria 879
173 Ga0373927_0002323 3300035695 Bacteria 13888
174 Ga0373927_0012655 3300035695 Bacteria 5613
175 Ga0373927_0016694 3300035695 Bacteria 4843
176 Ga0373927_0028284 3300035695 Bacteria 3656
177 Ga0373947_0034874 3300035725 Bacteria 2977
178 Ga0373947_0138175 3300035725 Bacteria 1561
179 Ga0373947_0206043 3300035725 Bacteria 1288
180 Ga0373947_0485897 3300035725 Bacteria 838
181 Ga0373937_0020243 3300036401 Bacteria 5964
182 Ga0373937_0783214 3300036401 Bacteria 901
183 Ga0373925_0045213 3300037068 Bacteria 3271
184 Ga0373925_0082561 3300037068 Bacteria 2446
185 Ga0373925_0419359 3300037068 Unclassified 1093
186 Ga0495592_0030082 3300046454 Plasmid 4107
187 Ga0495592_0035763 3300046454 Bacteria 3742
188 Ga0495592_0330352 3300046454 Bacteria 983
189 Ga0495603_0039842 3300046455 Bacteria 2814
190 Ga0495590_0074815 3300046457 Bacteria 1191
191 Ga0495629_0007385 3300046459 Bacteria 8103
192 Ga0495629_0070005 3300046459 Bacteria 2448
193 Ga0495638_0424849 3300046460 Unclassified 684
194 Ga0495651_0143528 3300046462 Bacteria 1728
195 Ga0495651_0164597 3300046462 Bacteria 1585
196 Ga0495653_0006643 3300046463 Bacteria 9493
197 Ga0495653_0048162 3300046463 Bacteria 3292
198 Ga0495580_0127499 3300046472 Unclassified 1766
199 Ga0495580_0212589 3300046472 Bacteria 1330
200 Ga0495582_0000859 3300046473 Bacteria 16886
201 Ga0495582_0235341 3300046473 Bacteria 1049
202 Ga0495639_0001781 3300046475 Bacteria 9543
203 Ga0495664_0013052 3300046477 Bacteria 4710
204 Ga0495664_0025353 3300046477 Bacteria 3452
205 Ga0495664_0247798 3300046477 Unclassified 1077
206 Ga0495664_0400744 3300046477 Bacteria 824
207 Ga0495608_0013602 3300046511 Bacteria 5644
208 Ga0495618_0490735 3300046514 Bacteria 741
209 Ga0495628_0047265 3300046516 Bacteria 3415
210 Ga0495628_0347415 3300046516 Bacteria 1091
211 Ga0495630_0013969 3300046517 Bacteria 5842
212 Ga0495630_0576196 3300046517 Unclassified 863
213 Ga0495632_0057625 3300046519 Bacteria 1896
214 Ga0495652_0037745 3300046529 Bacteria 4188
215 Ga0495652_0057474 3300046529 Bacteria 3298
216 Ga0495665_0004272 3300046531 Bacteria 7722
217 Ga0495587_0543397 3300046536 Bacteria 641
218 Ga0495645_0003528 3300046543 Bacteria 10584
219 Ga0495645_0056643 3300046543 Bacteria 2846
220 Ga0495622_0042629 3300046557 Bacteria 2110
221 Ga0495667_0008963 3300046559 Bacteria 6802
222 Ga0495656_0672125 3300046615 Unclassified 556
223 Ga0495668_0161996 3300046616 Bacteria 1225
224 Ga0495634_0330200 3300046642 Unclassified 916
225 Ga0495611_0063407 3300046648 Bacteria 1682
226 Ga0495611_0079891 3300046648 Bacteria 1503
227 Ga0495635_0006411 3300046663 Bacteria 8203
228 Ga0495635_0041212 3300046663 Bacteria 3190
229 Ga0495588_0003343 3300046674 Bacteria 6968
230 Ga0495657_0192465 3300046675 Unclassified 1246
231 Ga0495599_0040302 3300046678 Bacteria 2933
232 Ga0495599_0054793 3300046678 Bacteria 2498
233 Ga0495623_0000956 3300046679 Bacteria 19478
234 Ga0495646_0008028 3300046680 Bacteria 6710
235 Ga0495647_0004163 3300046681 Bacteria 4685
236 Ga0495613_0314405 3300046689 Bacteria 1082
237 Ga0495613_0772343 3300046689 Unclassified 628
238 Ga0495624_0000644 3300046690 Bacteria 27325
239 Ga0495624_0001338 3300046690 Bacteria 19256
240 Ga0495604_0007489 3300047317 Bacteria 8639
241 Ga0495636_0416567 3300047318 Bacteria 642
242 Ga0495674_0012712 3300047319 Bacteria 7932
243 Ga0495674_0020266 3300047319 Bacteria 6158
244 Ga0495674_0372966 3300047319 Bacteria 1155
245 Ga0495676_0178912 3300047321 Bacteria 1488
246 Ga0495680_0000742 3300047322 Bacteria 36551
247 Ga0495680_0106485 3300047322 Bacteria 2084
248 Ga0495680_0160864 3300047322 Bacteria 1630
249 Ga0495675_0007171 3300047444 Bacteria 6863
250 Ga0495675_0037717 3300047444 Bacteria 3078
251 Ga0495684_0007761 3300047471 Bacteria 8307
252 Ga0495684_0078626 3300047471 Bacteria 2503
253 Ga0495593_0054192 3300047673 Bacteria 2114
254 Ga0495602_0011859 3300048088 Bacteria 8994
255 Ga0495614_0030790 3300048089 Bacteria 2310
256 Ga0496100_0527892 3300048903 Bacteria 911
257 Ga0496102_0001085 3300048905 Bacteria 25158
258 Ga0496102_0122610 3300048905 Bacteria 2428
259 Ga0496103_0017523 3300048906 Bacteria 4288
260 Ga0496103_0124795 3300048906 Bacteria 1641
261 Ga0496104_0178640 3300048907 Bacteria 2033
262 Ga0496105_0047136 3300048908 Bacteria 3556
263 Ga0496105_0292513 3300048908 Bacteria 1311
264 Ga0496106_0001339 3300048909 Bacteria 18478
265 Ga0496106_0001736 3300048909 Bacteria 16280
266 Ga0496106_0348681 3300048909 Bacteria 1189
267 Ga0496106_0698282 3300048909 Unclassified 809
268 Ga0496107_0003878 3300048910 Bacteria 10054
269 Ga0496107_0168044 3300048910 Bacteria 1627
270 Ga0496108_0159770 3300048911 Bacteria 1947
271 Ga0496108_0530395 3300048911 Bacteria 1028
272 Ga0496111_0275840 3300048914 Bacteria 1247
273 Ga0496112_0393765 3300048915 Bacteria 1325
274 Ga0496113_0026779 3300048916 Bacteria 4126
275 Ga0496114_0081755 3300048917 Bacteria 2729
276 Ga0496117_0013398 3300048920 Bacteria 7157
277 Ga0496118_0028067 3300048921 Bacteria 4749
278 Ga0496121_0000398 3300048924 Bacteria 87272
279 Ga0496124_0000524 3300048927 Bacteria 65208
280 Ga0496125_0382820 3300048928 Unclassified 829
281 Ga0496126_0016614 3300048929 Bacteria 7355
282 Ga0501072_0402414 3300049588 Unclassified 1086
283 Ga0501079_0618262 3300049741 Bacteria 853
284 nmdc:mga05p37_71965_c1 3300050507 Bacteria 4254
285 nmdc:mga09592_183405_c1 3300050508 Bacteria 1811
286 nmdc:mga0qj67_31973_c1 3300050509 Plasmid 4102
287 nmdc:mga0qj67_594200_c1 3300050509 Bacteria 886
288 nmdc:mga06r32_2683_c1 3300050510 Bacteria 15920
289 nmdc:mga0n895_649997_c1 3300050512 Bacteria 1053
290 nmdc:mga0n895_707424_c1 3300050512 Bacteria 1003
291 Ga0495612_0005277 3300053078 Bacteria 5337
292 Ga0495612_0050362 3300053078 Bacteria 1710
293 Ga0495595_0002948 3300053084 Bacteria 6717
294 Ga0495619_0495298 3300053085 Bacteria 840
295 Ga0500643_056528 3300053087 Bacteria 1109
296 Ga0500647_0077367 3300053091 Bacteria 1596
297 Ga0500595_069711 3300053119 Bacteria 1045
298 Ga0500642_0153771 3300053130 Bacteria 1080
299 Ga0500658_0240922 3300053134 Bacteria 831
300 Ga0500559_0015415 3300053136 Bacteria 3227
301 Ga0500573_0006005 3300053140 Bacteria 6536
302 Ga0500590_039513 3300053148 Bacteria 2433
303 Ga0500619_118582 3300053154 Bacteria 902
304 Ga0500636_0099087 3300053177 Bacteria 1659
305 Ga0500596_000990 3300053735 Bacteria 5687
306 Ga0495651_0000874
307 Ga0065707_10088860
308 Ga0065707_10163977
309 Ga0070670_100439425
310 Ga0068869_100107605
311 Ga0070680_100865013
312 Ga0070682_100614515
313 Ga0068868_101051676
314 Ga0070691_10027390
315 Ga0070661_100767831
316 Ga0070692_10155101
317 Ga0070692_10691458
318 Ga0070668_100188211
319 Ga0070669_100171667
320 Ga0070675_100332462
321 Ga0070675_100921466
322 Ga0070659_100212579
323 Ga0070703_10001345
324 Ga0070709_10365066
325 Ga0070714_100066416
326 Ga0070714_100111762
327 Ga0070713_100025614
328 Ga0070713_100079112
329 Ga0070701_10021579
330 Ga0070705_100000280
331 Ga0070705_100092004
332 Ga0070700_100004894
333 Ga0070694_100004907
334 Ga0070708_100002986
335 Ga0070708_100102026
336 Ga0070678_100101901
337 Ga0070662_100282821
338 Ga0070681_10138412
339 Ga0070698_100000532
340 Ga0070698_100272180
341 Ga0070698_100571986
342 Ga0070699_100000255
343 Ga0070699_100071399
344 Ga0070679_100205273
345 Ga0070697_100285669
346 Ga0070695_100016098
347 Ga0070696_100001661
348 Ga0070704_100002550
349 Ga0070664_100680747
350 Ga0068857_100234169
351 Ga0068864_100043122
352 Ga0068861_100093029
353 Ga0068861_100384104
354 Ga0068870_10383937
355 Ga0068863_100207291
356 Ga0068858_100273438
357 Ga0068858_100436314
358 Ga0068858_100987140
359 Ga0068858_101491047
360 Ga0068860_100001979
361 Ga0068860_100731063
362 Ga0068860_101303823
363 Ga0068862_100001938
364 Ga0068862_100034288
365 Ga0070717_10023760
366 Ga0070717_10559881
367 Ga0070716_100205930
368 Ga0070712_101210593
369 Ga0075369_10068671
370 Ga0068871_100273062
371 Ga0068871_100981120
372 Ga0075428_101044592
373 Ga0075428_101178913
374 Ga0075430_100480225
375 Ga0075431_100946978
376 Ga0075429_100529790
377 Ga0099794_10017317
378 Ga0099794_10052896
379 Ga0099795_10270653
380 Ga0105245_10272395
381 Ga0105245_10514501
382 Ga0114129_10075936
383 Ga0105243_11025354
384 Ga0105242_10028888
385 Ga0105242_11238946
386 Ga0105248_10075131
387 Ga0105237_10156720
388 Ga0105237_10318215
389 Ga0105238_10181338
390 Ga0105249_10003367
391 Ga0105249_10216872
392 Ga0105249_10476048
393 Ga0105249_11415560
394 Ga0099796_10124875
395 Ga0105239_10351732
396 Ga0105239_10484097
397 Ga0105239_10677295
398 Ga0105246_10156935
399 Ga0105246_10388468
400 Ga0105246_11168844
401 Ga0157370_10228333
402 Ga0157378_11715960
403 Ga0163162_10162646
404 Ga0163162_10880774
405 Ga0157379_10697140
406 Ga0157379_11024032
407 Ga0207653_10000609
408 Ga0207692_10296444
409 Ga0207710_10268283
410 Ga0207645_10126229
411 Ga0207643_10028299
412 Ga0207707_10094491
413 Ga0207671_10263896
414 Ga0207693_10014017
415 Ga0207693_11133220
416 Ga0207660_10124017
417 Ga0207681_10261788
418 Ga0207681_10291366
419 Ga0207659_10696319
420 Ga0207700_10031994
421 Ga0207700_10161277
422 Ga0207664_10206231
423 Ga0207664_10287151
424 Ga0207690_10148632
425 Ga0207686_10621026
426 Ga0207709_10629019
427 Ga0207669_10595039
428 Ga0207665_10014191
429 Ga0207665_10150614
430 Ga0207665_10817446
431 Ga0207689_10328895
432 Ga0207689_10588424
433 Ga0207712_10004660
434 Ga0207712_10142840
435 Ga0207712_10323565
436 Ga0207703_11196936
437 Ga0207708_10009199
438 Ga0207708_10108505
439 Ga0207641_10084796
440 Ga0207641_10696773
441 Ga0207676_10051881
442 Ga0207674_10223822
443 Ga0207674_10559348
444 Ga0207675_100233548
445 Ga0207683_10066729
446 Ga0207428_10424120
447 Ga0265356_1000907
448 Ga0268265_10001918
449 Ga0268265_10082792
450 Ga0268264_10001803
451 Ga0265334_10104164
452 Ga0265325_10019623
453 Ga0265340_10057941
454 Ga0307509_10098946
455 Ga0307508_10000010
456 Ga0307516_10004439
457 Ga0307507_10201477
458 Ga0373928_0081990
459 Ga0373934_0089930
460 Ga0373940_0088805
461 Ga0373951_0088031
462 Ga0373952_0009455
463 Ga0373923_0218511
464 Ga0373932_0032304
465 Ga0373954_0011530
466 Ga0373954_0065841
467 Ga0373956_0043009
468 Ga0373957_0006606
469 Ga0373946_0066206
470 Ga0373955_0004930
471 Ga0373955_0124600
472 Ga0373955_0150044
473 Ga0373924_0040442
474 Ga0373931_0008384
475 Ga0373931_0016583
476 Ga0373935_0006262
477 Ga0373935_0504114
478 Ga0373927_0002323
479 Ga0373927_0012655
480 Ga0373927_0016694
481 Ga0373927_0028284
482 Ga0373947_0034874
483 Ga0373947_0138175
484 Ga0373947_0206043
485 Ga0373947_0485897
486 Ga0373937_0020243
487 Ga0373937_0783214
488 Ga0373925_0045213
489 Ga0373925_0082561
490 Ga0373925_0419359
491 Ga0495592_0030082
492 Ga0495592_0035763
493 Ga0495592_0330352
494 Ga0495603_0039842
495 Ga0495590_0074815
496 Ga0495629_0007385
497 Ga0495629_0070005
498 Ga0495638_0424849
499 Ga0495651_0143528
500 Ga0495651_0164597
501 Ga0495653_0006643
502 Ga0495653_0048162
503 Ga0495580_0127499
504 Ga0495580_0212589
505 Ga0495582_0000859
506 Ga0495582_0235341
507 Ga0495639_0001781
508 Ga0495664_0013052
509 Ga0495664_0025353
510 Ga0495664_0247798
511 Ga0495664_0400744
512 Ga0495608_0013602
513 Ga0495618_0490735
514 Ga0495628_0047265
515 Ga0495628_0347415
516 Ga0495630_0013969
517 Ga0495630_0576196
518 Ga0495632_0057625
519 Ga0495652_0037745
520 Ga0495652_0057474
521 Ga0495665_0004272
522 Ga0495587_0543397
523 Ga0495645_0003528
524 Ga0495645_0056643
525 Ga0495622_0042629
526 Ga0495667_0008963
527 Ga0495656_0672125
528 Ga0495668_0161996
529 Ga0495634_0330200
530 Ga0495611_0063407
531 Ga0495611_0079891
532 Ga0495635_0006411
533 Ga0495635_0041212
534 Ga0495588_0003343
535 Ga0495657_0192465
536 Ga0495599_0040302
537 Ga0495599_0054793
538 Ga0495623_0000956
539 Ga0495646_0008028
540 Ga0495647_0004163
541 Ga0495613_0314405
542 Ga0495613_0772343
543 Ga0495624_0000644
544 Ga0495624_0001338
545 Ga0495604_0007489
546 Ga0495636_0416567
547 Ga0495674_0012712
548 Ga0495674_0020266
549 Ga0495674_0372966
550 Ga0495676_0178912
551 Ga0495680_0000742
552 Ga0495680_0106485
553 Ga0495680_0160864
554 Ga0495675_0007171
555 Ga0495675_0037717
556 Ga0495684_0007761
557 Ga0495684_0078626
558 Ga0495593_0054192
559 Ga0495602_0011859
560 Ga0495614_0030790
561 Ga0496100_0527892
562 Ga0496102_0001085
563 Ga0496102_0122610
564 Ga0496103_0017523
565 Ga0496103_0124795
566 Ga0496104_0178640
567 Ga0496105_0047136
568 Ga0496105_0292513
569 Ga0496106_0001339
570 Ga0496106_0001736
571 Ga0496106_0348681
572 Ga0496106_0698282
573 Ga0496107_0003878
574 Ga0496107_0168044
575 Ga0496108_0159770
576 Ga0496108_0530395
577 Ga0496111_0275840
578 Ga0496112_0393765
579 Ga0496113_0026779
580 Ga0496114_0081755
581 Ga0496117_0013398
582 Ga0496118_0028067
583 Ga0496121_0000398
584 Ga0496124_0000524
585 Ga0496125_0382820
586 Ga0496126_0016614
587 Ga0501072_0402414
588 Ga0501079_0618262
589 nmdc:mga05p37_71965_c1
590 nmdc:mga09592_183405_c1
591 nmdc:mga0qj67_31973_c1
592 nmdc:mga0qj67_594200_c1
593 nmdc:mga06r32_2683_c1
594 nmdc:mga0n895_649997_c1
595 nmdc:mga0n895_707424_c1
596 Ga0495612_0005277
597 Ga0495612_0050362
598 Ga0495595_0002948
599 Ga0495619_0495298
600 Ga0500643_056528
601 Ga0500647_0077367
602 Ga0500595_069711
603 Ga0500642_0153771
604 Ga0500658_0240922
605 Ga0500559_0015415
606 Ga0500573_0006005
607 Ga0500590_039513
608 Ga0500619_118582
609 Ga0500636_0099087
610 Ga0500596_000990

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6r6m-assembly1.cif.gz_A kusta0087/kusta0088 complex purified from kuenenia stuttgartiensis 0.6045 27 142
7ah0-assembly1.cif.gz_A crystal structure of the de novo designed two-heme binding protein, 4d2 0.5884 27 123
8ccr-assembly1.cif.gz_A crystal structure of the t19d mutant of the de novo diheme binding 4d2 0.5843 27 124
7lpc-assembly1.cif.gz_C cryo-em structure of full-length trpv1 at 48 degrees celsius 0.5637 16 134
6r6m-assembly1.cif.gz_A kusta0087/kusta0088 complex purified from kuenenia stuttgartiensis 0.5636 27 142
ID Description Score Start End Superfamily
af_Q54B34_128_250_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.6929 19 82 3.30.40.10
af_P27732_1254_1382_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.6904 20 125 1.20.120.350
af_A0A0R4I9E2_978_1100_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.6473 20 121 1.20.120.350
af_P56945_734_870_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.6133 14 129 1.20.120.230
af_Q8K424_423_581_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.6085 25 146 1.20.120.350
ID Description Score Start End GO Terms
AF-A0A1W2AI25-F1-model_v4 DUF2306 domain-containing protein 0.9603 20 165 GO:0016020
AF-A0A1M6XBR9-F1-model_v4 DUF2306 domain-containing protein 0.956 16 165 GO:0016020
AF-A0A7W9NKJ3-F1-model_v4 DUF2306 domain-containing protein 0.9481 14 166 GO:0016020
AF-A0A6N7ZKL6-F1-model_v4 Alpha/beta-hydrolase family protein 0.9448 17 165 GO:0016020
AF-A0A5S4GC67-F1-model_v4 DUF2306 domain-containing protein 0.944 14 166 GO:0016020

Map