F398257

General Info

Members Datasets Scaffolds Average Seq Length
305 184 610 163

Family's Representative Sequence

Representative Sequence 3300044765|Ga0466970_0215197|Ga0466970_0215197_466_1032
Length 188
Sequence LSERWAPAPGGSANRASDSWRGRRDETKRPEHLEGVDRVRAAAAERGLDIEIRPRPAANSLPEAAAILGIHPSGIVKTLVVKRSDDTYLFALIPGDRAISWPKLRAVVGVNKLQLPDPERALAATGYERGTIVPLGSTTDWPIYADEAIVGQRIAMGAGAHGYSMFVEADDLIAAYGATVADISQRLT

Samples

Sample ID Description Type Environment
1 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
6 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
16 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
17 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
18 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
19 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
20 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
21 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
22 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
23 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
24 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
25 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
26 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
27 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
28 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
29 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
30 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
31 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
32 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
33 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
42 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
43 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
45 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
48 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
61 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
62 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
63 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
64 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
65 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
66 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
67 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
68 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
69 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
70 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
71 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
72 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
73 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
74 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
75 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
76 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
77 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
78 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
79 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
80 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
81 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
82 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
83 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
84 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
85 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
86 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
87 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
88 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
89 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
90 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
91 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
92 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
93 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
94 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
95 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
96 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
97 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
98 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
99 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
100 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
101 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
102 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
103 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
104 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
105 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
106 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
107 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
108 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
109 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
110 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
111 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
112 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
113 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
114 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
115 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
116 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
117 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
123 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
124 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
125 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
126 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
127 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
128 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
129 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
130 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
132 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
133 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
134 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
135 2643221546 Microbacterium sp. Root53 Isolate Unclassified
136 2643221575 Microbacterium sp. Root61 Isolate Unclassified
137 2643221597 Microbacterium sp. Root180 Isolate Unclassified
138 2643221630 Microbacterium sp. Root322 Isolate Unclassified
139 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
140 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
141 2643221649 Leifsonia sp. Root4 Isolate Unclassified
142 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
143 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
144 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
145 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
146 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
147 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
148 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
149 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
150 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
151 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
152 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
153 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
154 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
155 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
156 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
157 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
158 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
159 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
160 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
161 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
162 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
163 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
164 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
165 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
166 2919069694 Microbacterium sp. 1154 Isolate Unclassified
167 2919395869 Microbacterium resistens 2980 Isolate Unclassified
168 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
169 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
170 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
171 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
172 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
173 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
174 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
175 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
176 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
177 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
178 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
179 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
180 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
181 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
182 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
183 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
184 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 78.69
Metatranscriptomes 3.61
Isolates 17.7

Biome Distribution

Category Percentage (%)
Aerial Root 0.66
Bulb 0
Endosphere 11.48
Nodule 0
Rhizoplane 11.8
Rhizosphere 46.56
Stem 0
Stem Tuber 0.33
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466970_0215197 3300044765 Bacteria 1071
2 JGI24740J21852_10003731 3300001979 Bacteria 6630
3 JGI25154J39366_1002360 3300002738 Bacteria 4988
4 Ga0006562J51391_1092071 3300003578 Bacteria 13000
5 Ga0006562J51391_1092072 3300003578 Bacteria 8642
6 Ga0055525_1004267 3300003759 Bacteria 1235
7 Ga0055529_1000018 3300003763 Bacteria 344344
8 Ga0070658_10058632 3300005327 Bacteria 3134
9 Ga0070682_101416859 3300005337 Bacteria 595
10 Ga0070668_100495354 3300005347 Bacteria 1057
11 Ga0070659_100619626 3300005366 Bacteria 931
12 Ga0070663_100866570 3300005455 Bacteria 778
13 Ga0070663_100871685 3300005455 Bacteria 776
14 Ga0070679_100783444 3300005530 Bacteria 897
15 Ga0070665_100040366 3300005548 Bacteria 4691
16 Ga0068856_100259773 3300005614 Bacteria 1752
17 Ga0068852_101271670 3300005616 Bacteria 757
18 Ga0075365_10002428 3300006038 Bacteria 9137
19 Ga0075365_10011108 3300006038 Bacteria 5282
20 Ga0075368_10002782 3300006042 Bacteria 5774
21 Ga0075363_100316002 3300006048 Bacteria 908
22 Ga0075364_10051493 3300006051 Bacteria 2690
23 Ga0075364_10064341 3300006051 Bacteria 2407
24 Ga0075364_10416167 3300006051 Bacteria 917
25 Ga0075367_10147305 3300006178 Bacteria 1460
26 Ga0075367_10303372 3300006178 Bacteria 1005
27 Ga0075369_10003081 3300006186 Bacteria 6038
28 Ga0075369_10043594 3300006186 Bacteria 1925
29 Ga0105243_10001459 3300009148 Bacteria 20764
30 Ga0105243_10090989 3300009148 Bacteria 2512
31 Ga0105243_10811784 3300009148 Bacteria 923
32 Ga0105237_10160590 3300009545 Bacteria 2246
33 Ga0105238_11610597 3300009551 Bacteria 679
34 Ga0105238_12204516 3300009551 Bacteria 586
35 Ga0157371_10010004 3300013102 Bacteria 7423
36 Ga0157371_10031331 3300013102 Bacteria 3831
37 Ga0157370_10015774 3300013104 Bacteria 7668
38 Ga0157370_10052695 3300013104 Bacteria 3884
39 Ga0157370_10216882 3300013104 Bacteria 1773
40 Ga0157370_11161236 3300013104 Bacteria 697
41 Ga0157369_10061402 3300013105 Bacteria 4052
42 Ga0157369_10127637 3300013105 Bacteria 2696
43 Ga0157369_10442675 3300013105 Bacteria 1346
44 Ga0157369_10509842 3300013105 Bacteria 1244
45 Ga0171462_1005 3300013250 Bacteria 598379
46 Ga0157372_10049353 3300013307 Bacteria 4680
47 Ga0157372_10225319 3300013307 Bacteria 2173
48 Ga0157372_11197661 3300013307 Bacteria 878
49 Ga0157375_10759687 3300013308 Bacteria 1120
50 Ga0157375_11241671 3300013308 Bacteria 875
51 Ga0157380_10814569 3300014326 Bacteria 952
52 Ga0163161_10398917 3300017792 Bacteria 1103
53 Ga0197907_10935468 3300020069 Bacteria 1161
54 Ga0206349_1735631 3300020075 Bacteria 1062
55 Ga0206354_10226052 3300020081 Bacteria 1583
56 Ga0206354_11299699 3300020081 Bacteria 581
57 Ga0206353_10309306 3300020082 Bacteria 4782
58 Ga0206353_11068701 3300020082 Bacteria 3076
59 Ga0224712_10124987 3300022467 Bacteria 1118
60 Ga0224712_10148096 3300022467 Bacteria 1038
61 Ga0209672_100006 3300025228 Bacteria 1004497
62 Ga0209147_100868 3300025229 Bacteria 14017
63 Ga0209563_100461 3300025230 Bacteria 14011
64 Ga0207427_100329 3300025231 Bacteria 31805
65 Ga0209437_100739 3300025233 Bacteria 16245
66 Ga0209258_103255 3300025242 Bacteria 3603
67 Ga0209646_1000030 3300025246 Bacteria 384216
68 Ga0209677_100523 3300025253 Bacteria 21334
69 Ga0209148_1000015 3300025254 Bacteria 850103
70 Ga0209233_1000001 3300025261 Bacteria 2992747
71 Ga0209233_1038978 3300025261 Bacteria 1045
72 Ga0209455_1000013 3300025272 Bacteria 850103
73 Ga0209455_1000979 3300025272 Bacteria 14449
74 Ga0207688_10300663 3300025901 Bacteria 981
75 Ga0207647_10012172 3300025904 Bacteria 6000
76 Ga0207705_10205287 3300025909 Bacteria 1494
77 Ga0207671_10297477 3300025914 Bacteria 1275
78 Ga0207657_10052228 3300025919 Bacteria 3548
79 Ga0207652_11040410 3300025921 Bacteria 718
80 Ga0207694_10611367 3300025924 Bacteria 917
81 Ga0207709_10001881 3300025935 Bacteria 13876
82 Ga0207709_10723834 3300025935 Bacteria 798
83 Ga0207678_10780693 3300026067 Bacteria 843
84 Ga0207702_10369372 3300026078 Bacteria 1377
85 Ga0207683_10412854 3300026121 Bacteria 1243
86 Ga0307408_100102412 3300031548 Bacteria 2184
87 Ga0307408_101516305 3300031548 Bacteria 634
88 Ga0307405_10138713 3300031731 Bacteria 1692
89 Ga0307413_10384943 3300031824 Bacteria 1094
90 Ga0307410_10189322 3300031852 Bacteria 1564
91 Ga0307406_10000158 3300031901 Bacteria 40639
92 Ga0307406_10007124 3300031901 Bacteria 6190
93 Ga0307406_10050514 3300031901 Bacteria 2637
94 Ga0307406_10122636 3300031901 Bacteria 1810
95 Ga0307406_10175746 3300031901 Bacteria 1554
96 Ga0307407_10203214 3300031903 Bacteria 1329
97 Ga0307412_10152608 3300031911 Bacteria 1706
98 Ga0307409_100590815 3300031995 Bacteria 1096
99 Ga0307409_100725305 3300031995 Bacteria 996
100 Ga0307416_100822321 3300032002 Bacteria 1026
101 Ga0307414_10063300 3300032004 Bacteria 2628
102 Ga0307414_10100790 3300032004 Bacteria 2173
103 Ga0307414_10133718 3300032004 Bacteria 1930
104 Ga0307414_10287364 3300032004 Bacteria 1385
105 Ga0307414_10616757 3300032004 Bacteria 975
106 Ga0307414_11499072 3300032004 Bacteria 628
107 Ga0395899_0000786 3300037312 Bacteria 31058
108 Ga0395900_0012475 3300037418 Bacteria 8689
109 Ga0395900_0474469 3300037418 Bacteria 1204
110 Ga0395898_0000752 3300037466 Bacteria 56634
111 Ga0395898_0226613 3300037466 Bacteria 1783
112 Ga0395901_0411131 3300038443 Bacteria 1389
113 Ga0439465_0052232 3300041413 Bacteria 1341
114 Ga0439465_0065504 3300041413 Bacteria 1210
115 Ga0451837_1471388 3300041494 Bacteria 931
116 Ga0451839_1467406 3300041496 Bacteria 756
117 Ga0451845_0676576 3300041501 Bacteria 660
118 Ga0451843_1680903 3300041509 Bacteria 943
119 Ga0451853_0210209 3300041512 Bacteria 2590
120 Ga0451853_0559338 3300041512 Bacteria 705
121 Ga0451853_1244616 3300041512 Bacteria 571
122 Ga0439449_0116797 3300042007 Bacteria 990
123 Ga0466972_0017810 3300044658 Bacteria 3555
124 Ga0466972_0056950 3300044658 Bacteria 1878
125 Ga0466972_0085217 3300044658 Bacteria 1502
126 Ga0466972_0247489 3300044658 Bacteria 834
127 Ga0466972_0329716 3300044658 Bacteria 713
128 Ga0466965_0148440 3300044683 Bacteria 1224
129 Ga0466961_0058153 3300044693 Bacteria 2460
130 Ga0466968_0034920 3300044735 Bacteria 2101
131 Ga0466970_0000210 3300044765 Bacteria 28413
132 Ga0466970_0011120 3300044765 Bacteria 4584
133 Ga0466970_0031042 3300044765 Bacteria 2820
134 Ga0466970_0404811 3300044765 Bacteria 779
135 Ga0466957_0209958 3300044842 Bacteria 1282
136 Ga0466957_0508909 3300044842 Bacteria 835
137 Ga0466960_0093615 3300044901 Bacteria 1536
138 Ga0466960_0554231 3300044901 Bacteria 678
139 Ga0466959_0006345 3300045049 Bacteria 8181
140 Ga0466959_0363005 3300045049 Bacteria 987
141 Ga0466959_0730594 3300045049 Bacteria 663
142 Ga0495650_0043548 3300046471 Bacteria 1904
143 Ga0495654_0097980 3300046530 Bacteria 1353
144 Ga0495645_0063882 3300046543 Bacteria 2664
145 Ga0495645_0221112 3300046543 Bacteria 1274
146 Ga0495625_0069303 3300046660 Bacteria 2478
147 Ga0495649_0075299 3300046694 Bacteria 1808
148 Ga0495649_0466229 3300046694 Bacteria 630
149 Ga0496100_0076639 3300048903 Bacteria 2245
150 Ga0496100_0163226 3300048903 Bacteria 1598
151 Ga0496101_0013105 3300048904 Bacteria 5545
152 Ga0496101_0064501 3300048904 Bacteria 2668
153 Ga0496101_0197374 3300048904 Bacteria 1555
154 Ga0496102_0013098 3300048905 Bacteria 7175
155 Ga0496102_0064573 3300048905 Bacteria 3353
156 Ga0496104_0017486 3300048907 Bacteria 6530
157 Ga0496104_0028377 3300048907 Bacteria 5187
158 Ga0496104_0079996 3300048907 Bacteria 3115
159 Ga0496104_0621696 3300048907 Bacteria 990
160 Ga0496105_0006411 3300048908 Bacteria 9045
161 Ga0496105_0198395 3300048908 Bacteria 1638
162 Ga0496105_0380308 3300048908 Bacteria 1123
163 Ga0496107_0108526 3300048910 Bacteria 2038
164 Ga0496108_0078676 3300048911 Bacteria 2791
165 Ga0496109_0019769 3300048912 Bacteria 5941
166 Ga0496109_0034978 3300048912 Bacteria 4529
167 Ga0496110_0024247 3300048913 Bacteria 5168
168 Ga0496111_0012925 3300048914 Bacteria 5665
169 Ga0496112_0038802 3300048915 Bacteria 4652
170 Ga0496112_0231826 3300048915 Bacteria 1801
171 Ga0496113_0028312 3300048916 Bacteria 4028
172 Ga0496114_0078704 3300048917 Bacteria 2781
173 Ga0496114_0228195 3300048917 Bacteria 1635
174 Ga0496114_0242972 3300048917 Bacteria 1584
175 Ga0496114_0288523 3300048917 Bacteria 1448
176 Ga0496114_0313024 3300048917 Bacteria 1387
177 Ga0496114_0829351 3300048917 Bacteria 804
178 Ga0496115_0005263 3300048918 Bacteria 9402
179 Ga0496115_0010135 3300048918 Bacteria 7032
180 Ga0496115_0032163 3300048918 Bacteria 4138
181 Ga0496115_0062273 3300048918 Bacteria 3009
182 Ga0496115_0541356 3300048918 Bacteria 931
183 Ga0496115_0543595 3300048918 Bacteria 929
184 Ga0496115_1111562 3300048918 Bacteria 598
185 Ga0496116_0002319 3300048919 Bacteria 20173
186 Ga0496117_0000994 3300048920 Bacteria 43381
187 Ga0496117_0117706 3300048920 Bacteria 1639
188 Ga0496117_0359890 3300048920 Bacteria 748
189 Ga0496118_0003660 3300048921 Bacteria 19090
190 Ga0496118_0008668 3300048921 Bacteria 10458
191 Ga0496118_0148746 3300048921 Bacteria 1470
192 Ga0496118_0160774 3300048921 Bacteria 1389
193 Ga0496119_0003039 3300048922 Bacteria 17763
194 Ga0496119_0015733 3300048922 Bacteria 5801
195 Ga0496119_0016488 3300048922 Bacteria 5620
196 Ga0496119_0020876 3300048922 Bacteria 4754
197 Ga0496119_0021662 3300048922 Bacteria 4633
198 Ga0496119_0144210 3300048922 Bacteria 1283
199 Ga0496119_0515719 3300048922 Bacteria 554
200 Ga0496120_0003241 3300048923 Bacteria 15065
201 Ga0496120_0003732 3300048923 Bacteria 13518
202 Ga0496122_0000065 3300048925 Bacteria 235242
203 Ga0496122_0000270 3300048925 Bacteria 116104
204 Ga0496122_0005365 3300048925 Bacteria 15309
205 Ga0496122_0013626 3300048925 Bacteria 7938
206 Ga0496122_0030862 3300048925 Bacteria 4478
207 Ga0496122_0178989 3300048925 Bacteria 1267
208 Ga0496123_0000006 3300048926 Bacteria 647258
209 Ga0496123_0000036 3300048926 Bacteria 265722
210 Ga0496123_0005530 3300048926 Bacteria 12686
211 Ga0496123_0081759 3300048926 Bacteria 1961
212 Ga0496124_0013524 3300048927 Bacteria 7960
213 Ga0496124_0034807 3300048927 Bacteria 4413
214 Ga0496124_0135413 3300048927 Bacteria 1951
215 Ga0496124_0254220 3300048927 Bacteria 1297
216 Ga0496124_0266772 3300048927 Bacteria 1256
217 Ga0496125_0001428 3300048928 Bacteria 34818
218 Ga0496125_0002305 3300048928 Bacteria 25185
219 Ga0496125_0007892 3300048928 Bacteria 11240
220 Ga0496125_0011558 3300048928 Bacteria 8819
221 Ga0496125_0017938 3300048928 Bacteria 6728
222 Ga0496125_0020336 3300048928 Bacteria 6229
223 Ga0496125_0030074 3300048928 Bacteria 4865
224 Ga0496125_0171169 3300048928 Bacteria 1460
225 Ga0496126_0002302 3300048929 Bacteria 26269
226 Ga0496126_0006099 3300048929 Bacteria 13515
227 Ga0496126_0007511 3300048929 Bacteria 11940
228 Ga0496126_0084652 3300048929 Bacteria 2797
229 Ga0496126_0198467 3300048929 Bacteria 1695
230 Ga0496126_0202091 3300048929 Bacteria 1677
231 Ga0496126_0259105 3300048929 Bacteria 1447
232 Ga0496126_0977289 3300048929 Bacteria 637
233 Ga0501032_0889242 3300049569 Bacteria 561
234 Ga0501033_0327416 3300049570 Bacteria 1075
235 Ga0501034_0019539 3300049571 Bacteria 6928
236 Ga0501034_0033525 3300049571 Bacteria 5209
237 Ga0501037_0136111 3300049573 Bacteria 1760
238 Ga0501038_0064313 3300049574 Bacteria 3128
239 Ga0501070_0001516 3300049586 Bacteria 20688
240 Ga0501071_0432241 3300049587 Bacteria 1007
241 nmdc:mga03n38_16154_c2 3300050490 Bacteria 1948
242 nmdc:mga00v17_152659_c1 3300050491 Bacteria 1484
243 nmdc:mga00v17_156795_c1 3300050491 Bacteria 1464
244 nmdc:mga00v17_167163_c1 3300050491 Bacteria 1417
245 nmdc:mga00v17_90626_c1 3300050491 Bacteria 1920
246 nmdc:mga0yw44_516552_c1 3300050492 Bacteria 811
247 nmdc:mga06z11_20116_c1 3300050494 Bacteria 3081
248 nmdc:mga0sz30_10636_c1 3300050516 Bacteria 3529
249 nmdc:mga0sz30_199735_c1 3300050516 Bacteria 888
250 Ga0500559_0000849 3300053136 Bacteria 19693
251 Ga0587091_014318 3300059511 Bacteria 1290
252 2555228841 2554235227 Bacteria 3637389
253 2587862589 2585428094 Bacteria 3604039
254 2588107543 2585428157 Bacteria 3018951
255 2643735288 2643221542 Bacteria 3563959
256 2643752357 2643221546 Bacteria 2910897
257 2643887520 2643221575 Bacteria 4022601
258 2643997358 2643221597 Bacteria 3347721
259 2644172128 2643221630 Bacteria 3601215
260 2644183297 2643221632 Bacteria 3406696
261 2644199119 2643221635 Bacteria 2632343
262 2644279330 2643221649 Bacteria 3867359
263 2644678396 2643221724 Bacteria 3593515
264 2655033306 2654587600 Bacteria 3911798
265 2723642333 2721755702 Bacteria 4373124
266 2730227907 2728369380 Bacteria 3620317
267 2747954072 2747842429 Bacteria 3914386
268 2774397455 2773857763 Bacteria 4180068
269 2808629421 2808606306 Bacteria 3608896
270 2808884350 2808606368 Bacteria 3174172
271 2809225821 2808606447 Bacteria 3572005
272 2812325207 2811994872 Bacteria 4121241
273 2821271862 2821268502 Bacteria 3750023
274 2833712910 2833709550 Bacteria 4008291
275 2842889236 2842888712 Bacteria 4279094
276 2852635303 2852632344 Bacteria 3463163
277 2852649679 2852646457 Bacteria 3408613
278 2852666764 2852663356 Bacteria 4090475
279 2857722676 2857720070 Bacteria 3189373
280 2857726065 2857723135 Bacteria 4217853
281 2862995853 2862993130 Bacteria 3860849
282 2870628660 2870628048 Bacteria 3696012
283 2884765322 2884763398 Bacteria 4091164
284 2904512299 2904509784 Bacteria 3520416
285 2906802619 2906799679 Bacteria 4031749
286 2908679556 2908678064 Bacteria 3482747
287 2919070202 2919069694 Bacteria 3622919
288 2919398422 2919395869 Bacteria 3704152
289 2919524405 2919523602 Bacteria 3788128
290 2928093440 2928090899 Bacteria 3158267
291 2946035628 2946033335 Bacteria 3835514
292 2946042168 2946041624 Bacteria 4191385
293 2946083043 2946080515 Bacteria 4310960
294 2974295463 2974294766 Bacteria 3767688
295 2974324734 2974324384 Bacteria 3750535
296 2977229760 2977228692 Bacteria 3450105
297 2977238194 2977236895 Bacteria 3569373
298 2977252662 2977251589 Bacteria 2952848
299 2984544022 2984542743 Bacteria 3569378
300 2984582914 2984580707 Bacteria 3351387
301 2995729148 2995726249 Bacteria 3470435
302 8004021527 8004021418 Bacteria 4313954
303 8004182796 8004182704 Bacteria 3391155
304 8004215522 8004212874 Bacteria 2861420
305 8016255671 8016254467 Bacteria 3797036
306 Ga0466970_0215197
307 JGI24740J21852_10003731
308 JGI25154J39366_1002360
309 Ga0006562J51391_1092071
310 Ga0006562J51391_1092072
311 Ga0055525_1004267
312 Ga0055529_1000018
313 Ga0070658_10058632
314 Ga0070682_101416859
315 Ga0070668_100495354
316 Ga0070659_100619626
317 Ga0070663_100866570
318 Ga0070663_100871685
319 Ga0070679_100783444
320 Ga0070665_100040366
321 Ga0068856_100259773
322 Ga0068852_101271670
323 Ga0075365_10002428
324 Ga0075365_10011108
325 Ga0075368_10002782
326 Ga0075363_100316002
327 Ga0075364_10051493
328 Ga0075364_10064341
329 Ga0075364_10416167
330 Ga0075367_10147305
331 Ga0075367_10303372
332 Ga0075369_10003081
333 Ga0075369_10043594
334 Ga0105243_10001459
335 Ga0105243_10090989
336 Ga0105243_10811784
337 Ga0105237_10160590
338 Ga0105238_11610597
339 Ga0105238_12204516
340 Ga0157371_10010004
341 Ga0157371_10031331
342 Ga0157370_10015774
343 Ga0157370_10052695
344 Ga0157370_10216882
345 Ga0157370_11161236
346 Ga0157369_10061402
347 Ga0157369_10127637
348 Ga0157369_10442675
349 Ga0157369_10509842
350 Ga0171462_1005
351 Ga0157372_10049353
352 Ga0157372_10225319
353 Ga0157372_11197661
354 Ga0157375_10759687
355 Ga0157375_11241671
356 Ga0157380_10814569
357 Ga0163161_10398917
358 Ga0197907_10935468
359 Ga0206349_1735631
360 Ga0206354_10226052
361 Ga0206354_11299699
362 Ga0206353_10309306
363 Ga0206353_11068701
364 Ga0224712_10124987
365 Ga0224712_10148096
366 Ga0209672_100006
367 Ga0209147_100868
368 Ga0209563_100461
369 Ga0207427_100329
370 Ga0209437_100739
371 Ga0209258_103255
372 Ga0209646_1000030
373 Ga0209677_100523
374 Ga0209148_1000015
375 Ga0209233_1000001
376 Ga0209233_1038978
377 Ga0209455_1000013
378 Ga0209455_1000979
379 Ga0207688_10300663
380 Ga0207647_10012172
381 Ga0207705_10205287
382 Ga0207671_10297477
383 Ga0207657_10052228
384 Ga0207652_11040410
385 Ga0207694_10611367
386 Ga0207709_10001881
387 Ga0207709_10723834
388 Ga0207678_10780693
389 Ga0207702_10369372
390 Ga0207683_10412854
391 Ga0307408_100102412
392 Ga0307408_101516305
393 Ga0307405_10138713
394 Ga0307413_10384943
395 Ga0307410_10189322
396 Ga0307406_10000158
397 Ga0307406_10007124
398 Ga0307406_10050514
399 Ga0307406_10122636
400 Ga0307406_10175746
401 Ga0307407_10203214
402 Ga0307412_10152608
403 Ga0307409_100590815
404 Ga0307409_100725305
405 Ga0307416_100822321
406 Ga0307414_10063300
407 Ga0307414_10100790
408 Ga0307414_10133718
409 Ga0307414_10287364
410 Ga0307414_10616757
411 Ga0307414_11499072
412 Ga0395899_0000786
413 Ga0395900_0012475
414 Ga0395900_0474469
415 Ga0395898_0000752
416 Ga0395898_0226613
417 Ga0395901_0411131
418 Ga0439465_0052232
419 Ga0439465_0065504
420 Ga0451837_1471388
421 Ga0451839_1467406
422 Ga0451845_0676576
423 Ga0451843_1680903
424 Ga0451853_0210209
425 Ga0451853_0559338
426 Ga0451853_1244616
427 Ga0439449_0116797
428 Ga0466972_0017810
429 Ga0466972_0056950
430 Ga0466972_0085217
431 Ga0466972_0247489
432 Ga0466972_0329716
433 Ga0466965_0148440
434 Ga0466961_0058153
435 Ga0466968_0034920
436 Ga0466970_0000210
437 Ga0466970_0011120
438 Ga0466970_0031042
439 Ga0466970_0404811
440 Ga0466957_0209958
441 Ga0466957_0508909
442 Ga0466960_0093615
443 Ga0466960_0554231
444 Ga0466959_0006345
445 Ga0466959_0363005
446 Ga0466959_0730594
447 Ga0495650_0043548
448 Ga0495654_0097980
449 Ga0495645_0063882
450 Ga0495645_0221112
451 Ga0495625_0069303
452 Ga0495649_0075299
453 Ga0495649_0466229
454 Ga0496100_0076639
455 Ga0496100_0163226
456 Ga0496101_0013105
457 Ga0496101_0064501
458 Ga0496101_0197374
459 Ga0496102_0013098
460 Ga0496102_0064573
461 Ga0496104_0017486
462 Ga0496104_0028377
463 Ga0496104_0079996
464 Ga0496104_0621696
465 Ga0496105_0006411
466 Ga0496105_0198395
467 Ga0496105_0380308
468 Ga0496107_0108526
469 Ga0496108_0078676
470 Ga0496109_0019769
471 Ga0496109_0034978
472 Ga0496110_0024247
473 Ga0496111_0012925
474 Ga0496112_0038802
475 Ga0496112_0231826
476 Ga0496113_0028312
477 Ga0496114_0078704
478 Ga0496114_0228195
479 Ga0496114_0242972
480 Ga0496114_0288523
481 Ga0496114_0313024
482 Ga0496114_0829351
483 Ga0496115_0005263
484 Ga0496115_0010135
485 Ga0496115_0032163
486 Ga0496115_0062273
487 Ga0496115_0541356
488 Ga0496115_0543595
489 Ga0496115_1111562
490 Ga0496116_0002319
491 Ga0496117_0000994
492 Ga0496117_0117706
493 Ga0496117_0359890
494 Ga0496118_0003660
495 Ga0496118_0008668
496 Ga0496118_0148746
497 Ga0496118_0160774
498 Ga0496119_0003039
499 Ga0496119_0015733
500 Ga0496119_0016488
501 Ga0496119_0020876
502 Ga0496119_0021662
503 Ga0496119_0144210
504 Ga0496119_0515719
505 Ga0496120_0003241
506 Ga0496120_0003732
507 Ga0496122_0000065
508 Ga0496122_0000270
509 Ga0496122_0005365
510 Ga0496122_0013626
511 Ga0496122_0030862
512 Ga0496122_0178989
513 Ga0496123_0000006
514 Ga0496123_0000036
515 Ga0496123_0005530
516 Ga0496123_0081759
517 Ga0496124_0013524
518 Ga0496124_0034807
519 Ga0496124_0135413
520 Ga0496124_0254220
521 Ga0496124_0266772
522 Ga0496125_0001428
523 Ga0496125_0002305
524 Ga0496125_0007892
525 Ga0496125_0011558
526 Ga0496125_0017938
527 Ga0496125_0020336
528 Ga0496125_0030074
529 Ga0496125_0171169
530 Ga0496126_0002302
531 Ga0496126_0006099
532 Ga0496126_0007511
533 Ga0496126_0084652
534 Ga0496126_0198467
535 Ga0496126_0202091
536 Ga0496126_0259105
537 Ga0496126_0977289
538 Ga0501032_0889242
539 Ga0501033_0327416
540 Ga0501034_0019539
541 Ga0501034_0033525
542 Ga0501037_0136111
543 Ga0501038_0064313
544 Ga0501070_0001516
545 Ga0501071_0432241
546 nmdc:mga03n38_16154_c2
547 nmdc:mga00v17_152659_c1
548 nmdc:mga00v17_156795_c1
549 nmdc:mga00v17_167163_c1
550 nmdc:mga00v17_90626_c1
551 nmdc:mga0yw44_516552_c1
552 nmdc:mga06z11_20116_c1
553 nmdc:mga0sz30_10636_c1
554 nmdc:mga0sz30_199735_c1
555 Ga0500559_0000849
556 Ga0587091_014318
557 2555228841
558 2587862589
559 2588107543
560 2643735288
561 2643752357
562 2643887520
563 2643997358
564 2644172128
565 2644183297
566 2644199119
567 2644279330
568 2644678396
569 2655033306
570 2723642333
571 2730227907
572 2747954072
573 2774397455
574 2808629421
575 2808884350
576 2809225821
577 2812325207
578 2821271862
579 2833712910
580 2842889236
581 2852635303
582 2852649679
583 2852666764
584 2857722676
585 2857726065
586 2862995853
587 2870628660
588 2884765322
589 2904512299
590 2906802619
591 2908679556
592 2919070202
593 2919398422
594 2919524405
595 2928093440
596 2946035628
597 2946042168
598 2946083043
599 2974295463
600 2974324734
601 2977229760
602 2977238194
603 2977252662
604 2984544022
605 2984582914
606 2995729148
607 8004021527
608 8004182796
609 8004215522
610 8016255671

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04073

tRNA_edit

Aminoacyl-tRNA editing domain

55

175

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cx5-assembly3.cif.gz_C crystal structure of a putative trans-editing enzyme for prolyl trna synthetase 0.8987 17 168
3rij-assembly2.cif.gz_B epitope backbone grafting by computational design for improved presentation of linear epitopes on scaffold proteins 0.8941 17 168
3rij-assembly3.cif.gz_C epitope backbone grafting by computational design for improved presentation of linear epitopes on scaffold proteins 0.8938 17 168
3ri0-assembly1.cif.gz_A epitope backbone grafting by computational design for improved presentation of linear epitopes on scaffold proteins 0.8913 17 168
1wdv-assembly2.cif.gz_B crystal structure of hypothetical protein ape2540 0.8864 21 168
ID Description Score Start End Superfamily
af_Q4DLP0_103_258_3.90.960.10 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.9155 42 166 3.90.960.10
af_Q6H6L7_57_230_3.90.960.10 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.8981 27 166 3.90.960.10
3rijC00 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.8938 17 168 3.90.960.10
af_Q55EP8_34_206_3.90.960.10 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.889 17 160 3.90.960.10
1wdvB00 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.8855 21 168 3.90.960.10
ID Description Score Start End GO Terms
AF-A0A7W7BMR6-F1-model_v4 Cys-tRNA(Pro) deacylase 0.9963 31 170 GO:0002161
AF-A0A840XDZ1-F1-model_v4 Cys-tRNA(Pro) deacylase 0.9946 21 170 GO:0002161
AF-A0A166I470-F1-model_v4 Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK (EC 4.2.-.-) 0.9929 18 170 GO:0002161
GO:0016829
AF-A0A2V1HNQ9-F1-model_v4 YbaK/aminoacyl-tRNA synthetase-associated domain-containing protein 0.9899 18 168 GO:0002161
AF-A0A6F8Y425-F1-model_v4 YbaK/aminoacyl-tRNA synthetase-associated domain-containing protein 0.9879 76 170 GO:0002161

Map