F398209

General Info

Members Datasets Scaffolds Average Seq Length
305 210 610 131

Family's Representative Sequence

Representative Sequence 3300035724|Ga0373933_0037984|Ga0373933_0037984_1301_1771
Length 156
Sequence MYVRGLPGLRDLTTPHPTFDRGVAVKIKVTRIYVNDQDEALRFYTEVLGFVKRADFSQGAFRWLTVASPEEPNGTELQLAKNDNPPARAYQQAIFEQGQPASMFYVDDVQREYERMKPLGAEFTMPPTKVTGSTIAMLKDTCGNLIQLVALDRWQG

Samples

Sample ID Description Type Environment
1 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
85 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
92 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
93 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
134 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
145 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
146 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
147 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
148 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
149 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
150 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
151 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
152 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
153 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
154 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
155 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
157 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
158 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
161 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
162 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
163 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
164 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
165 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
168 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
169 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
170 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
171 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
172 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
173 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
174 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
175 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
176 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
177 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
178 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
179 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
180 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
181 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
182 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
183 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
184 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
192 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
193 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
194 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
195 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
196 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
197 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
198 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
199 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
200 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
202 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
203 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
206 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
207 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
209 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
210 2857481737 Nocardioides sp. R-74106 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.43
Metatranscriptomes 5.25
Isolates 0.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.66
Nodule 0
Rhizoplane 0
Rhizosphere 96.72
Stem 0
Stem Tuber 0
Unclassified 8.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373933_0037984 3300035724 Bacteria 2828
2 JGI25407J50210_10047574 3300003373 Bacteria 1090
3 Ga0058863_11937962 3300004799 Bacteria 788
4 Ga0058862_12796072 3300004803 Bacteria 521
5 Ga0065704_10532621 3300005289 Bacteria 646
6 Ga0065707_10094138 3300005295 Bacteria 3533
7 Ga0070658_11552118 3300005327 Bacteria 574
8 Ga0070683_100007893 3300005329 Bacteria 9020
9 Ga0070670_100296427 3300005331 Bacteria 1414
10 Ga0070670_100905388 3300005331 Bacteria 800
11 Ga0070680_100265982 3300005336 Bacteria 1451
12 Ga0070680_100873007 3300005336 Bacteria 776
13 Ga0070682_100240120 3300005337 Bacteria 1300
14 Ga0068868_100367993 3300005338 Bacteria 1235
15 Ga0068868_101040005 3300005338 Bacteria 751
16 Ga0070660_100240333 3300005339 Bacteria 1475
17 Ga0070689_100014743 3300005340 Bacteria 5686
18 Ga0070691_10471465 3300005341 Bacteria 721
19 Ga0070661_100009261 3300005344 Bacteria 6808
20 Ga0070668_100831851 3300005347 Bacteria 822
21 Ga0070669_100370831 3300005353 Bacteria 1166
22 Ga0070674_100116418 3300005356 Bacteria 1972
23 Ga0070673_100453333 3300005364 Bacteria 1154
24 Ga0070688_100007869 3300005365 Bacteria 5759
25 Ga0070688_100633056 3300005365 Bacteria 822
26 Ga0070667_100230545 3300005367 Bacteria 1651
27 Ga0070709_10085847 3300005434 Bacteria 2065
28 Ga0070701_10629646 3300005438 Bacteria 714
29 Ga0070711_100000199 3300005439 Bacteria 31704
30 Ga0070705_100091055 3300005440 Bacteria 1900
31 Ga0070705_100492466 3300005440 Bacteria 929
32 Ga0070694_101358233 3300005444 Bacteria 599
33 Ga0070708_100382202 3300005445 Bacteria 1328
34 Ga0070708_100612263 3300005445 Bacteria 1027
35 Ga0070663_100485049 3300005455 Bacteria 1024
36 Ga0068867_100342182 3300005459 Bacteria 1246
37 Ga0070685_10271353 3300005466 Bacteria 1132
38 Ga0070706_100005520 3300005467 Bacteria 12036
39 Ga0070706_100085690 3300005467 Bacteria 2919
40 Ga0070706_100226149 3300005467 Bacteria 1746
41 Ga0070707_100172987 3300005468 Bacteria 2104
42 Ga0070707_101023173 3300005468 Bacteria 791
43 Ga0070698_100389840 3300005471 Bacteria 1326
44 Ga0070698_101216848 3300005471 Bacteria 702
45 Ga0070699_100079576 3300005518 Bacteria 2855
46 Ga0070699_100647276 3300005518 Bacteria 965
47 Ga0070679_101571941 3300005530 Unclassified 605
48 Ga0070684_100024580 3300005535 Bacteria 5055
49 Ga0070684_100025145 3300005535 Bacteria 5001
50 Ga0070684_100646644 3300005535 Unclassified 984
51 Ga0070684_101268488 3300005535 Bacteria 693
52 Ga0070697_100001713 3300005536 Unclassified 16746
53 Ga0070697_100056950 3300005536 Archaea 3181
54 Ga0070697_100068340 3300005536 Archaea 2908
55 Ga0070697_100145254 3300005536 Bacteria 1996
56 Ga0070697_100625757 3300005536 Bacteria 947
57 Ga0070672_100253638 3300005543 Bacteria 1482
58 Ga0070672_101392158 3300005543 Bacteria 627
59 Ga0070686_100015398 3300005544 Bacteria 4429
60 Ga0070696_100004520 3300005546 Bacteria 9283
61 Ga0070693_100991943 3300005547 Bacteria 635
62 Ga0070704_100270199 3300005549 Bacteria 1404
63 Ga0068856_100852558 3300005614 Bacteria 930
64 Ga0070702_100283017 3300005615 Bacteria 1139
65 Ga0068859_100476611 3300005617 Bacteria 1343
66 Ga0068859_101001689 3300005617 Bacteria 917
67 Ga0068864_100217873 3300005618 Bacteria 1760
68 Ga0068864_100491545 3300005618 Bacteria 1179
69 Ga0068864_101834564 3300005618 Bacteria 612
70 Ga0068866_10026547 3300005718 Bacteria 2736
71 Ga0068866_11008552 3300005718 Bacteria 592
72 Ga0068851_10825755 3300005834 Bacteria 577
73 Ga0068863_100244291 3300005841 Bacteria 1733
74 Ga0068863_101059031 3300005841 Bacteria 815
75 Ga0068860_100030175 3300005843 Bacteria 5215
76 Ga0068860_101234446 3300005843 Bacteria 768
77 Ga0068860_101938264 3300005843 Unclassified 611
78 Ga0081455_10290886 3300005937 Bacteria 1176
79 Ga0070717_10308664 3300006028 Bacteria 1407
80 Ga0070717_10384063 3300006028 Bacteria 1259
81 Ga0070716_100656525 3300006173 Bacteria 796
82 Ga0070712_100097309 3300006175 Bacteria 2169
83 Ga0097621_100912541 3300006237 Bacteria 819
84 Ga0068871_100494645 3300006358 Bacteria 1101
85 Ga0068871_101156680 3300006358 Bacteria 725
86 Ga0075434_101463077 3300006871 Bacteria 693
87 Ga0068865_100287232 3300006881 Bacteria 1312
88 Ga0097620_100476613 3300006931 Bacteria 1343
89 Ga0097620_101001692 3300006931 Bacteria 917
90 Ga0075435_100229376 3300007076 Bacteria 1577
91 Ga0099794_10207750 3300007265 Unclassified 1004
92 Ga0099794_10407507 3300007265 Unclassified 710
93 Ga0099794_10494639 3300007265 Bacteria 643
94 Ga0099794_10555674 3300007265 Unclassified 606
95 Ga0105240_10042185 3300009093 Bacteria 5816
96 Ga0105240_10055252 3300009093 Bacteria 4972
97 Ga0105240_10401885 3300009093 Unclassified 1543
98 Ga0105245_10513917 3300009098 Bacteria 1215
99 Ga0105245_10693135 3300009098 Bacteria 1051
100 Ga0114129_11395246 3300009147 Bacteria 865
101 Ga0114129_11431652 3300009147 Bacteria 852
102 Ga0105243_10709608 3300009148 Bacteria 981
103 Ga0105241_11075551 3300009174 Bacteria 756
104 Ga0105248_10034437 3300009177 Bacteria 5662
105 Ga0105248_10296377 3300009177 Bacteria 1821
106 Ga0105237_10008807 3300009545 Bacteria 10880
107 Ga0105249_11120873 3300009553 Bacteria 857
108 Ga0105239_11995513 3300010375 Bacteria 673
109 Ga0105246_10069010 3300011119 Bacteria 2481
110 Ga0157373_10030257 3300013100 Bacteria 3896
111 Ga0157370_10018251 3300013104 Bacteria 7057
112 Ga0157370_10045154 3300013104 Bacteria 4229
113 Ga0157370_10556897 3300013104 Bacteria 1051
114 Ga0157370_10897532 3300013104 Bacteria 804
115 Ga0157369_10447122 3300013105 Bacteria 1338
116 Ga0157369_10618863 3300013105 Bacteria 1117
117 Ga0157369_10791644 3300013105 Bacteria 974
118 Ga0157378_10005847 3300013297 Bacteria 10781
119 Ga0157378_10177352 3300013297 Bacteria 2002
120 Ga0163162_10185132 3300013306 Bacteria 2209
121 Ga0157375_13649135 3300013308 Unclassified 512
122 Ga0163163_11842011 3300014325 Bacteria 665
123 Ga0157376_11169092 3300014969 Bacteria 797
124 Ga0197907_10311602 3300020069 Bacteria 785
125 Ga0206356_11902211 3300020070 Bacteria 1133
126 Ga0206349_1902168 3300020075 Bacteria 1015
127 Ga0206355_1088279 3300020076 Bacteria 567
128 Ga0206355_1320381 3300020076 Unclassified 569
129 Ga0206351_10466932 3300020077 Bacteria 736
130 Ga0206352_10945150 3300020078 Bacteria 817
131 Ga0206350_10893395 3300020080 Bacteria 918
132 Ga0206350_11158642 3300020080 Unclassified 843
133 Ga0206354_10502201 3300020081 Bacteria 732
134 Ga0206353_12008973 3300020082 Bacteria 709
135 Ga0154015_1355595 3300020610 Bacteria 644
136 Ga0213873_10132982 3300021358 Bacteria 738
137 Ga0213876_10126541 3300021384 Bacteria 1357
138 Ga0224712_10269777 3300022467 Bacteria 790
139 Ga0207642_10434869 3300025899 Bacteria 792
140 Ga0207645_10476832 3300025907 Bacteria 843
141 Ga0207684_10053570 3300025910 Bacteria 3424
142 Ga0207684_10180968 3300025910 Bacteria 1818
143 Ga0207684_10463132 3300025910 Bacteria 1088
144 Ga0207654_10791403 3300025911 Bacteria 685
145 Ga0207707_10014058 3300025912 Bacteria 6978
146 Ga0207695_10536105 3300025913 Bacteria 1052
147 Ga0207671_10044316 3300025914 Bacteria 3290
148 Ga0207693_10114039 3300025915 Bacteria 2120
149 Ga0207663_10054228 3300025916 Bacteria 2509
150 Ga0207660_10001655 3300025917 Bacteria 14931
151 Ga0207660_10648651 3300025917 Bacteria 861
152 Ga0207662_10019681 3300025918 Bacteria 3845
153 Ga0207657_10229669 3300025919 Bacteria 1484
154 Ga0207649_10010248 3300025920 Bacteria 5145
155 Ga0207649_10152363 3300025920 Bacteria 1594
156 Ga0207652_10011529 3300025921 Bacteria 7126
157 Ga0207652_11449720 3300025921 Unclassified 590
158 Ga0207646_10000001 3300025922 Bacteria 1242027
159 Ga0207646_10000006 3300025922 Bacteria 510716
160 Ga0207646_10000017 3300025922 Bacteria 324386
161 Ga0207646_10031145 3300025922 Bacteria 4830
162 Ga0207646_10052022 3300025922 Unclassified 3665
163 Ga0207646_10376609 3300025922 Bacteria 1282
164 Ga0207694_11355146 3300025924 Bacteria 601
165 Ga0207650_10529878 3300025925 Bacteria 986
166 Ga0207650_10556216 3300025925 Bacteria 962
167 Ga0207664_10122086 3300025929 Bacteria 2182
168 Ga0207709_10707492 3300025935 Bacteria 807
169 Ga0207670_10220128 3300025936 Bacteria 1452
170 Ga0207669_10194296 3300025937 Bacteria 1467
171 Ga0207691_10400495 3300025940 Bacteria 1171
172 Ga0207711_10068530 3300025941 Bacteria 3073
173 Ga0207711_10230547 3300025941 Bacteria 1696
174 Ga0207711_10384024 3300025941 Bacteria 1303
175 Ga0207661_11844524 3300025944 Unclassified 550
176 Ga0207667_10145977 3300025949 Bacteria 2435
177 Ga0207651_10504894 3300025960 Bacteria 1046
178 Ga0207712_11348797 3300025961 Bacteria 638
179 Ga0207668_10387503 3300025972 Bacteria 1178
180 Ga0207640_10003083 3300025981 Bacteria 8975
181 Ga0207658_10231010 3300025986 Bacteria 1562
182 Ga0207658_10291956 3300025986 Bacteria 1402
183 Ga0207677_10027517 3300026023 Bacteria 3582
184 Ga0207677_10763274 3300026023 Bacteria 863
185 Ga0207641_10058930 3300026088 Bacteria 3269
186 Ga0207641_10577493 3300026088 Bacteria 1099
187 Ga0207641_10755076 3300026088 Bacteria 960
188 Ga0207648_10172419 3300026089 Bacteria 1913
189 Ga0207676_10200199 3300026095 Bacteria 1764
190 Ga0207674_10329102 3300026116 Bacteria 1477
191 Ga0209588_1008908 3300027671 Archaea 2987
192 Ga0209588_1245377 3300027671 Unclassified 548
193 Ga0268266_10401647 3300028379 Bacteria 1296
194 Ga0268264_10020380 3300028381 Bacteria 5420
195 Ga0268264_11737366 3300028381 Bacteria 634
196 Ga0268264_12610222 3300028381 Unclassified 510
197 Ga0307408_100383955 3300031548 Bacteria 1201
198 Ga0307508_10069188 3300031616 Bacteria 3101
199 Ga0307516_10052096 3300031730 Bacteria 4009
200 Ga0307405_10011044 3300031731 Bacteria 4713
201 Ga0307413_10039728 3300031824 Bacteria 2739
202 Ga0307410_10011418 3300031852 Bacteria 5079
203 Ga0307406_10032792 3300031901 Bacteria 3173
204 Ga0307407_10017856 3300031903 Bacteria 3572
205 Ga0307412_10234848 3300031911 Bacteria 1414
206 Ga0307409_100000245 3300031995 Bacteria 21848
207 Ga0307416_100001142 3300032002 Bacteria 14249
208 Ga0307414_10067906 3300032004 Bacteria 2556
209 Ga0307411_10011024 3300032005 Bacteria 4854
210 Ga0307415_100000249 3300032126 Bacteria 23267
211 Ga0307415_100689174 3300032126 Bacteria 921
212 Ga0373934_0309180 3300035086 Bacteria 656
213 Ga0373936_0047915 3300035113 Bacteria 1725
214 Ga0373943_0110556 3300035170 Bacteria 1449
215 Ga0373946_0157083 3300035171 Bacteria 1065
216 Ga0316574_0528227 3300035398 Bacteria 734
217 Ga0373927_0006648 3300035695 Bacteria 7868
218 Ga0373927_0277207 3300035695 Bacteria 1103
219 Ga0373927_0282860 3300035695 Bacteria 1091
220 Ga0373933_0005053 3300035724 Bacteria 7198
221 Ga0373947_0167156 3300035725 Bacteria 1425
222 Ga0373937_0009778 3300036401 Bacteria 8360
223 Ga0316582_0242553 3300036647 Archaea 1235
224 Ga0373925_0031642 3300037068 Bacteria 3889
225 Ga0436364_0711788 3300037853 Bacteria 7823
226 Ga0436365_0979945 3300039437 Bacteria 31914
227 Ga0436362_0889982 3300039453 Bacteria 738
228 Ga0466967_0090903 3300045976 Bacteria 2774
229 Ga0495592_0604020 3300046454 Bacteria 669
230 Ga0495651_0070303 3300046462 Bacteria 2664
231 Ga0495580_0018921 3300046472 Bacteria 5123
232 Ga0495580_0668002 3300046472 Bacteria 682
233 Ga0495580_0928410 3300046472 Bacteria 558
234 Ga0495582_0143722 3300046473 Bacteria 1353
235 Ga0495639_0262062 3300046475 Bacteria 856
236 Ga0495594_0121942 3300046499 Bacteria 1474
237 Ga0495594_0168663 3300046499 Bacteria 1245
238 Ga0495594_0233336 3300046499 Bacteria 1049
239 Ga0495630_0008125 3300046517 Bacteria 7539
240 Ga0495630_0520359 3300046517 Bacteria 912
241 Ga0495652_0046466 3300046529 Bacteria 3728
242 Ga0495652_0234992 3300046529 Unclassified 1368
243 Ga0495665_0559796 3300046531 Bacteria 573
244 Ga0495586_0016902 3300046535 Bacteria 3880
245 Ga0495645_0000477 3300046543 Bacteria 27714
246 Ga0495645_0620844 3300046543 Unclassified 663
247 Ga0495667_0002140 3300046559 Bacteria 13164
248 Ga0495588_0049849 3300046674 Bacteria 2154
249 Ga0495599_0015138 3300046678 Bacteria 4783
250 Ga0495623_0126769 3300046679 Bacteria 1532
251 Ga0495646_0427916 3300046680 Bacteria 686
252 Ga0495613_0219616 3300046689 Bacteria 1335
253 Ga0495600_0089061 3300046809 Bacteria 2013
254 Ga0495600_0442093 3300046809 Bacteria 805
255 Ga0495581_0031231 3300047315 Bacteria 3086
256 Ga0495581_0363803 3300047315 Bacteria 844
257 Ga0495674_0029849 3300047319 Bacteria 4962
258 Ga0495674_0128532 3300047319 Bacteria 2136
259 Ga0495675_0013237 3300047444 Bacteria 5206
260 Ga0495675_0210385 3300047444 Bacteria 1181
261 Ga0495684_0145256 3300047471 Bacteria 1777
262 Ga0496119_0074359 3300048922 Bacteria 1979
263 Ga0496120_0014553 3300048923 Bacteria 5237
264 Ga0501037_1001187 3300049573 Bacteria 544
265 Ga0501039_0217261 3300049575 Bacteria 1503
266 Ga0501040_0012833 3300049576 Bacteria 5502
267 Ga0501040_0140644 3300049576 Unclassified 1700
268 Ga0501040_0345440 3300049576 Bacteria 1066
269 Ga0501041_0027833 3300049577 Bacteria 3408
270 Ga0501042_0077906 3300049578 Unclassified 2374
271 Ga0501047_0320814 3300049581 Bacteria 1389
272 Ga0501048_0298774 3300049582 Bacteria 1145
273 Ga0501071_0151259 3300049587 Bacteria 1731
274 Ga0501072_0005859 3300049588 Bacteria 9362
275 Ga0501072_0045664 3300049588 Unclassified 3446
276 Ga0501072_0177924 3300049588 Bacteria 1697
277 Ga0501074_0241999 3300049590 Bacteria 1283
278 Ga0501074_0968076 3300049590 Bacteria 598
279 Ga0501075_0029279 3300049591 Bacteria 4071
280 Ga0501075_0128347 3300049591 Unclassified 1931
281 Ga0501075_0338533 3300049591 Bacteria 1146
282 Ga0501076_0064223 3300049592 Bacteria 2925
283 Ga0501076_0077071 3300049592 Unclassified 2674
284 Ga0501077_0059053 3300049593 Bacteria 2435
285 Ga0501077_0339903 3300049593 Bacteria 957
286 Ga0501079_0094221 3300049741 Unclassified 2320
287 Ga0501079_0927703 3300049741 Unclassified 686
288 Ga0501081_0084331 3300049743 Bacteria 2228
289 Ga0501083_0330066 3300049744 Bacteria 992
290 Ga0501035_0047632 3300049822 Bacteria 3847
291 Ga0501045_0180179 3300049824 Bacteria 1574
292 Ga0501045_0276412 3300049824 Bacteria 1250
293 nmdc:mga06z11_879698_c1 3300050494 Bacteria 546
294 nmdc:mga05p37_1070580_c1 3300050507 Bacteria 848
295 nmdc:mga05p37_45077_c1 3300050507 Bacteria 5425
296 nmdc:mga0n895_991934_c1 3300050512 Bacteria 821
297 Ga0500596_095901 3300053735 Bacteria 529
298 Ga0501084_0038474 3300054114 Bacteria 3999
299 Ga0501084_0552197 3300054114 Bacteria 973
300 Ga0587111_0118020 3300060346 Bacteria 680
301 Ga0501082_0193010 3300060353 Bacteria 1771
302 Ga0501082_0420150 3300060353 Bacteria 1168
303 Ga0530510_0150230 3300061734 Unclassified 1720
304 Ga0530510_0755641 3300061734 Bacteria 741
305 2857483172 2857481737 Bacteria 4761446
306 Ga0373933_0037984
307 JGI25407J50210_10047574
308 Ga0058863_11937962
309 Ga0058862_12796072
310 Ga0065704_10532621
311 Ga0065707_10094138
312 Ga0070658_11552118
313 Ga0070683_100007893
314 Ga0070670_100296427
315 Ga0070670_100905388
316 Ga0070680_100265982
317 Ga0070680_100873007
318 Ga0070682_100240120
319 Ga0068868_100367993
320 Ga0068868_101040005
321 Ga0070660_100240333
322 Ga0070689_100014743
323 Ga0070691_10471465
324 Ga0070661_100009261
325 Ga0070668_100831851
326 Ga0070669_100370831
327 Ga0070674_100116418
328 Ga0070673_100453333
329 Ga0070688_100007869
330 Ga0070688_100633056
331 Ga0070667_100230545
332 Ga0070709_10085847
333 Ga0070701_10629646
334 Ga0070711_100000199
335 Ga0070705_100091055
336 Ga0070705_100492466
337 Ga0070694_101358233
338 Ga0070708_100382202
339 Ga0070708_100612263
340 Ga0070663_100485049
341 Ga0068867_100342182
342 Ga0070685_10271353
343 Ga0070706_100005520
344 Ga0070706_100085690
345 Ga0070706_100226149
346 Ga0070707_100172987
347 Ga0070707_101023173
348 Ga0070698_100389840
349 Ga0070698_101216848
350 Ga0070699_100079576
351 Ga0070699_100647276
352 Ga0070679_101571941
353 Ga0070684_100024580
354 Ga0070684_100025145
355 Ga0070684_100646644
356 Ga0070684_101268488
357 Ga0070697_100001713
358 Ga0070697_100056950
359 Ga0070697_100068340
360 Ga0070697_100145254
361 Ga0070697_100625757
362 Ga0070672_100253638
363 Ga0070672_101392158
364 Ga0070686_100015398
365 Ga0070696_100004520
366 Ga0070693_100991943
367 Ga0070704_100270199
368 Ga0068856_100852558
369 Ga0070702_100283017
370 Ga0068859_100476611
371 Ga0068859_101001689
372 Ga0068864_100217873
373 Ga0068864_100491545
374 Ga0068864_101834564
375 Ga0068866_10026547
376 Ga0068866_11008552
377 Ga0068851_10825755
378 Ga0068863_100244291
379 Ga0068863_101059031
380 Ga0068860_100030175
381 Ga0068860_101234446
382 Ga0068860_101938264
383 Ga0081455_10290886
384 Ga0070717_10308664
385 Ga0070717_10384063
386 Ga0070716_100656525
387 Ga0070712_100097309
388 Ga0097621_100912541
389 Ga0068871_100494645
390 Ga0068871_101156680
391 Ga0075434_101463077
392 Ga0068865_100287232
393 Ga0097620_100476613
394 Ga0097620_101001692
395 Ga0075435_100229376
396 Ga0099794_10207750
397 Ga0099794_10407507
398 Ga0099794_10494639
399 Ga0099794_10555674
400 Ga0105240_10042185
401 Ga0105240_10055252
402 Ga0105240_10401885
403 Ga0105245_10513917
404 Ga0105245_10693135
405 Ga0114129_11395246
406 Ga0114129_11431652
407 Ga0105243_10709608
408 Ga0105241_11075551
409 Ga0105248_10034437
410 Ga0105248_10296377
411 Ga0105237_10008807
412 Ga0105249_11120873
413 Ga0105239_11995513
414 Ga0105246_10069010
415 Ga0157373_10030257
416 Ga0157370_10018251
417 Ga0157370_10045154
418 Ga0157370_10556897
419 Ga0157370_10897532
420 Ga0157369_10447122
421 Ga0157369_10618863
422 Ga0157369_10791644
423 Ga0157378_10005847
424 Ga0157378_10177352
425 Ga0163162_10185132
426 Ga0157375_13649135
427 Ga0163163_11842011
428 Ga0157376_11169092
429 Ga0197907_10311602
430 Ga0206356_11902211
431 Ga0206349_1902168
432 Ga0206355_1088279
433 Ga0206355_1320381
434 Ga0206351_10466932
435 Ga0206352_10945150
436 Ga0206350_10893395
437 Ga0206350_11158642
438 Ga0206354_10502201
439 Ga0206353_12008973
440 Ga0154015_1355595
441 Ga0213873_10132982
442 Ga0213876_10126541
443 Ga0224712_10269777
444 Ga0207642_10434869
445 Ga0207645_10476832
446 Ga0207684_10053570
447 Ga0207684_10180968
448 Ga0207684_10463132
449 Ga0207654_10791403
450 Ga0207707_10014058
451 Ga0207695_10536105
452 Ga0207671_10044316
453 Ga0207693_10114039
454 Ga0207663_10054228
455 Ga0207660_10001655
456 Ga0207660_10648651
457 Ga0207662_10019681
458 Ga0207657_10229669
459 Ga0207649_10010248
460 Ga0207649_10152363
461 Ga0207652_10011529
462 Ga0207652_11449720
463 Ga0207646_10000001
464 Ga0207646_10000006
465 Ga0207646_10000017
466 Ga0207646_10031145
467 Ga0207646_10052022
468 Ga0207646_10376609
469 Ga0207694_11355146
470 Ga0207650_10529878
471 Ga0207650_10556216
472 Ga0207664_10122086
473 Ga0207709_10707492
474 Ga0207670_10220128
475 Ga0207669_10194296
476 Ga0207691_10400495
477 Ga0207711_10068530
478 Ga0207711_10230547
479 Ga0207711_10384024
480 Ga0207661_11844524
481 Ga0207667_10145977
482 Ga0207651_10504894
483 Ga0207712_11348797
484 Ga0207668_10387503
485 Ga0207640_10003083
486 Ga0207658_10231010
487 Ga0207658_10291956
488 Ga0207677_10027517
489 Ga0207677_10763274
490 Ga0207641_10058930
491 Ga0207641_10577493
492 Ga0207641_10755076
493 Ga0207648_10172419
494 Ga0207676_10200199
495 Ga0207674_10329102
496 Ga0209588_1008908
497 Ga0209588_1245377
498 Ga0268266_10401647
499 Ga0268264_10020380
500 Ga0268264_11737366
501 Ga0268264_12610222
502 Ga0307408_100383955
503 Ga0307508_10069188
504 Ga0307516_10052096
505 Ga0307405_10011044
506 Ga0307413_10039728
507 Ga0307410_10011418
508 Ga0307406_10032792
509 Ga0307407_10017856
510 Ga0307412_10234848
511 Ga0307409_100000245
512 Ga0307416_100001142
513 Ga0307414_10067906
514 Ga0307411_10011024
515 Ga0307415_100000249
516 Ga0307415_100689174
517 Ga0373934_0309180
518 Ga0373936_0047915
519 Ga0373943_0110556
520 Ga0373946_0157083
521 Ga0316574_0528227
522 Ga0373927_0006648
523 Ga0373927_0277207
524 Ga0373927_0282860
525 Ga0373933_0005053
526 Ga0373947_0167156
527 Ga0373937_0009778
528 Ga0316582_0242553
529 Ga0373925_0031642
530 Ga0436364_0711788
531 Ga0436365_0979945
532 Ga0436362_0889982
533 Ga0466967_0090903
534 Ga0495592_0604020
535 Ga0495651_0070303
536 Ga0495580_0018921
537 Ga0495580_0668002
538 Ga0495580_0928410
539 Ga0495582_0143722
540 Ga0495639_0262062
541 Ga0495594_0121942
542 Ga0495594_0168663
543 Ga0495594_0233336
544 Ga0495630_0008125
545 Ga0495630_0520359
546 Ga0495652_0046466
547 Ga0495652_0234992
548 Ga0495665_0559796
549 Ga0495586_0016902
550 Ga0495645_0000477
551 Ga0495645_0620844
552 Ga0495667_0002140
553 Ga0495588_0049849
554 Ga0495599_0015138
555 Ga0495623_0126769
556 Ga0495646_0427916
557 Ga0495613_0219616
558 Ga0495600_0089061
559 Ga0495600_0442093
560 Ga0495581_0031231
561 Ga0495581_0363803
562 Ga0495674_0029849
563 Ga0495674_0128532
564 Ga0495675_0013237
565 Ga0495675_0210385
566 Ga0495684_0145256
567 Ga0496119_0074359
568 Ga0496120_0014553
569 Ga0501037_1001187
570 Ga0501039_0217261
571 Ga0501040_0012833
572 Ga0501040_0140644
573 Ga0501040_0345440
574 Ga0501041_0027833
575 Ga0501042_0077906
576 Ga0501047_0320814
577 Ga0501048_0298774
578 Ga0501071_0151259
579 Ga0501072_0005859
580 Ga0501072_0045664
581 Ga0501072_0177924
582 Ga0501074_0241999
583 Ga0501074_0968076
584 Ga0501075_0029279
585 Ga0501075_0128347
586 Ga0501075_0338533
587 Ga0501076_0064223
588 Ga0501076_0077071
589 Ga0501077_0059053
590 Ga0501077_0339903
591 Ga0501079_0094221
592 Ga0501079_0927703
593 Ga0501081_0084331
594 Ga0501083_0330066
595 Ga0501035_0047632
596 Ga0501045_0180179
597 Ga0501045_0276412
598 nmdc:mga06z11_879698_c1
599 nmdc:mga05p37_1070580_c1
600 nmdc:mga05p37_45077_c1
601 nmdc:mga0n895_991934_c1
602 Ga0500596_095901
603 Ga0501084_0038474
604 Ga0501084_0552197
605 Ga0587111_0118020
606 Ga0501082_0193010
607 Ga0501082_0420150
608 Ga0530510_0150230
609 Ga0530510_0755641
610 2857483172

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

26

148

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4g6x-assembly1.cif.gz_A-2 crystal structure of glyoxalase/bleomycin resistance protein from catenulispora acidiphila. 0.9607 1 128
4g6x-assembly1.cif.gz_A-2 crystal structure of glyoxalase/bleomycin resistance protein from catenulispora acidiphila. 0.9534 1 128
6cky-assembly1.cif.gz_B crystal structure of ucms2 0.8589 1 128
5umw-assembly2.cif.gz_B crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8569 2 125
6cky-assembly1.cif.gz_B crystal structure of ucms2 0.8528 1 128
ID Description Score Start End Superfamily
4g6xA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9544 2 125 3.10.180.10
4g6xA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9322 2 125 3.10.180.10
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.882 80 126 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8735 80 128 3.30.720.110
4hc5C00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8173 1 128 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A4V1HEH1-F1-model_v4 VOC family protein 0.9942 3 127
AF-A0A2M9K9G3-F1-model_v4 VOC family protein 0.9917 3 128
AF-H0K715-F1-model_v4 deleted 0.9916 3 126
AF-A0A3N6DXG1-F1-model_v4 deleted 0.9915 3 128
AF-A0A7K0RU01-F1-model_v4 deleted 0.9905 3 127

Map