F398203

General Info

Members Datasets Scaffolds Average Seq Length
305 161 305 223

Family's Representative Sequence

Representative Sequence 3300035113|Ga0373936_0001631|Ga0373936_0001631_1048_1722
Length 208
Sequence MSDAHPPLRSYGRLKTRTIKPRQAALMETLLPRLRPPAEPFDPLTLMPQAAEVWLEIGFGGGEHMAAQAGRRPDVLIIGAEPFQNGVASALRHIDEAALTNVRVLDGDARELPDPWPKSRHNKRRIVQAETVAEFARLLKPGGRLRFASDWADYVDWSLERFLASPAFRWTADRADDWRTPPADHITTRYEEKRLGDCAPVFLDFVRA

Samples

Sample ID Description Type Environment
1 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
31 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
50 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
83 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
84 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
85 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
86 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
87 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
88 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
89 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
90 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
91 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
96 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
97 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
98 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
99 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
100 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
101 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
102 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
103 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
104 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
105 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
106 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
107 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
108 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
109 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
110 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
111 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
112 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
113 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
114 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
115 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
116 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
117 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
118 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
119 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
120 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
121 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
122 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
123 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
124 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
125 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
126 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
127 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
128 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
129 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
130 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
131 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
136 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
137 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
138 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
139 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
140 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
141 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
142 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
143 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
144 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
145 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
146 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
147 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
148 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
149 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
150 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
151 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
152 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
153 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
154 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
155 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
156 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
157 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
158 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
159 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
160 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
161 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.48
Nodule 0
Rhizoplane 5.57
Rhizosphere 77.38
Stem 0
Stem Tuber 0
Unclassified 5.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065165_1016811 3300005262 Bacteria 2723
2 Ga0070658_10688084 3300005327 Bacteria 887
3 Ga0070670_100000007 3300005331 Bacteria 318672
4 Ga0070670_100012304 3300005331 Bacteria 7323
5 Ga0070670_100016139 3300005331 Bacteria 6411
6 Ga0068869_100113234 3300005334 Bacteria 2066
7 Ga0070666_10134769 3300005335 Bacteria 1718
8 Ga0070680_100017002 3300005336 Bacteria 5727
9 Ga0070680_100241287 3300005336 Bacteria 1527
10 Ga0070689_100418045 3300005340 Bacteria 1136
11 Ga0070661_100206920 3300005344 Bacteria 1501
12 Ga0070668_100001382 3300005347 Bacteria 17415
13 Ga0070668_100001424 3300005347 Bacteria 17257
14 Ga0070668_100090836 3300005347 Bacteria 2406
15 Ga0070669_100048689 3300005353 Bacteria 3094
16 Ga0070671_100003609 3300005355 Bacteria 12108
17 Ga0070671_100208989 3300005355 Bacteria 1655
18 Ga0070673_100135604 3300005364 Bacteria 2071
19 Ga0070659_100115311 3300005366 Bacteria 2171
20 Ga0070667_100000293 3300005367 Bacteria 56352
21 Ga0070667_100005167 3300005367 Bacteria 10917
22 Ga0070667_100051881 3300005367 Bacteria 3459
23 Ga0070678_100298320 3300005456 Bacteria 1369
24 Ga0070681_10038631 3300005458 Bacteria 4785
25 Ga0070681_10227262 3300005458 Bacteria 1781
26 Ga0070681_10352714 3300005458 Bacteria 1381
27 Ga0070679_100144915 3300005530 Bacteria 2353
28 Ga0070665_100001912 3300005548 Bacteria 23543
29 Ga0070665_100004154 3300005548 Bacteria 15237
30 Ga0070665_100231556 3300005548 Bacteria 1847
31 Ga0068855_100121878 3300005563 Bacteria 2984
32 Ga0068855_100346607 3300005563 Bacteria 1637
33 Ga0068855_100889485 3300005563 Bacteria 941
34 Ga0068857_100576732 3300005577 Bacteria 1061
35 Ga0068854_100457872 3300005578 Bacteria 1067
36 Ga0068852_100278820 3300005616 Bacteria 1611
37 Ga0068859_100000811 3300005617 Bacteria 31785
38 Ga0068859_100083263 3300005617 Bacteria 3242
39 Ga0068859_100277059 3300005617 Bacteria 1770
40 Ga0068859_100291199 3300005617 Bacteria 1726
41 Ga0068859_101100951 3300005617 Bacteria 874
42 Ga0068864_100002694 3300005618 Bacteria 14634
43 Ga0068864_100006635 3300005618 Bacteria 9474
44 Ga0068864_100150351 3300005618 Bacteria 2109
45 Ga0068864_100302083 3300005618 Bacteria 1499
46 Ga0068861_100097711 3300005719 Bacteria 2330
47 Ga0068861_100241928 3300005719 Bacteria 1535
48 Ga0068863_100000663 3300005841 Bacteria 34691
49 Ga0068863_100001917 3300005841 Bacteria 20674
50 Ga0068863_100002318 3300005841 Bacteria 18932
51 Ga0068863_100027950 3300005841 Bacteria 5384
52 Ga0068863_100086882 3300005841 Bacteria 2963
53 Ga0068863_100110501 3300005841 Bacteria 2618
54 Ga0068863_100464667 3300005841 Bacteria 1243
55 Ga0068858_100001006 3300005842 Bacteria 29047
56 Ga0068858_100008697 3300005842 Bacteria 9747
57 Ga0068858_100035160 3300005842 Bacteria 4647
58 Ga0068858_100296436 3300005842 Bacteria 1542
59 Ga0068858_100721113 3300005842 Bacteria 971
60 Ga0068860_100000047 3300005843 Bacteria 213287
61 Ga0068860_100001901 3300005843 Bacteria 22162
62 Ga0068860_100032863 3300005843 Bacteria 4983
63 Ga0068860_100097126 3300005843 Bacteria 2808
64 Ga0068862_100000396 3300005844 Bacteria 47054
65 Ga0068862_100014066 3300005844 Bacteria 6638
66 Ga0068862_100022932 3300005844 Bacteria 5226
67 Ga0068862_100089367 3300005844 Bacteria 2681
68 Ga0068862_100403355 3300005844 Bacteria 1279
69 Ga0075368_10018064 3300006042 Bacteria 2646
70 Ga0075362_10057465 3300006177 Bacteria 1753
71 Ga0075367_10002614 3300006178 Bacteria 8272
72 Ga0075366_10019047 3300006195 Bacteria 3967
73 Ga0068865_100000389 3300006881 Bacteria 24391
74 Ga0097620_100000811 3300006931 Bacteria 31785
75 Ga0097620_100083262 3300006931 Bacteria 3242
76 Ga0097620_100277083 3300006931 Bacteria 1770
77 Ga0097620_100291188 3300006931 Bacteria 1726
78 Ga0097620_101101031 3300006931 Bacteria 874
79 Ga0105240_10050780 3300009093 Bacteria 5226
80 Ga0105240_10152483 3300009093 Bacteria 2751
81 Ga0105240_10269488 3300009093 Bacteria 1961
82 Ga0105241_10317003 3300009174 Bacteria 1343
83 Ga0105248_10000170 3300009177 Bacteria 75642
84 Ga0105248_10022121 3300009177 Bacteria 7046
85 Ga0105248_10029455 3300009177 Bacteria 6123
86 Ga0105248_10030024 3300009177 Bacteria 6067
87 Ga0105248_10043455 3300009177 Bacteria 5038
88 Ga0105248_10404334 3300009177 Bacteria 1537
89 Ga0105238_10040354 3300009551 Bacteria 4730
90 Ga0105238_10156771 3300009551 Bacteria 2252
91 Ga0105238_10427936 3300009551 Bacteria 1319
92 Ga0105238_10820334 3300009551 Bacteria 946
93 Ga0105249_10001104 3300009553 Bacteria 23992
94 Ga0105239_10243085 3300010375 Bacteria 2020
95 Ga0105239_11502853 3300010375 Bacteria 778
96 Ga0157370_10032275 3300013104 Bacteria 5115
97 Ga0157370_10589920 3300013104 Bacteria 1018
98 Ga0163162_10010062 3300013306 Bacteria 9196
99 Ga0157372_10054941 3300013307 Bacteria 4445
100 Ga0157372_10841976 3300013307 Bacteria 1065
101 Ga0163163_10012776 3300014325 Bacteria 7662
102 Ga0163163_10081481 3300014325 Bacteria 3238
103 Ga0163163_10127535 3300014325 Bacteria 2583
104 Ga0157380_10188015 3300014326 Bacteria 1821
105 Ga0157379_10017448 3300014968 Bacteria 6321
106 Ga0157379_10024067 3300014968 Bacteria 5404
107 Ga0157379_10051954 3300014968 Bacteria 3659
108 Ga0163161_10295206 3300017792 Bacteria 1275
109 Ga0213876_10094210 3300021384 Bacteria 1586
110 Ga0213876_10160973 3300021384 Bacteria 1194
111 Ga0209257_1003844 3300025304 Bacteria 12300
112 Ga0207680_10141250 3300025903 Bacteria 1597
113 Ga0207680_10148894 3300025903 Bacteria 1559
114 Ga0207705_10003453 3300025909 Bacteria 12024
115 Ga0207707_10018494 3300025912 Bacteria 6074
116 Ga0207707_10368250 3300025912 Bacteria 1236
117 Ga0207695_10011899 3300025913 Bacteria 10484
118 Ga0207695_10018076 3300025913 Bacteria 8160
119 Ga0207695_10066392 3300025913 Bacteria 3705
120 Ga0207660_10002946 3300025917 Bacteria 11127
121 Ga0207660_10053132 3300025917 Bacteria 2887
122 Ga0207660_10129999 3300025917 Bacteria 1916
123 Ga0207657_10082553 3300025919 Bacteria 2697
124 Ga0207657_10132655 3300025919 Bacteria 2040
125 Ga0207652_10004969 3300025921 Bacteria 10765
126 Ga0207652_10263243 3300025921 Bacteria 1555
127 Ga0207681_10066999 3300025923 Bacteria 2487
128 Ga0207681_10114305 3300025923 Bacteria 1969
129 Ga0207681_10798055 3300025923 Bacteria 788
130 Ga0207694_10139862 3300025924 Bacteria 1946
131 Ga0207694_10246585 3300025924 Bacteria 1461
132 Ga0207694_10579325 3300025924 Bacteria 943
133 Ga0207650_10000033 3300025925 Bacteria 226809
134 Ga0207650_10093098 3300025925 Bacteria 2306
135 Ga0207650_10157112 3300025925 Bacteria 1799
136 Ga0207650_10278853 3300025925 Bacteria 1361
137 Ga0207644_10006895 3300025931 Bacteria 7396
138 Ga0207644_10020086 3300025931 Bacteria 4538
139 Ga0207670_10685343 3300025936 Bacteria 847
140 Ga0207711_10000374 3300025941 Bacteria 47567
141 Ga0207711_10018077 3300025941 Bacteria 5861
142 Ga0207711_10030162 3300025941 Bacteria 4574
143 Ga0207711_10072038 3300025941 Bacteria 3000
144 Ga0207689_10167418 3300025942 Bacteria 1811
145 Ga0207667_10054171 3300025949 Bacteria 4219
146 Ga0207667_10124014 3300025949 Bacteria 2661
147 Ga0207667_10178515 3300025949 Bacteria 2181
148 Ga0207667_10279218 3300025949 Bacteria 1707
149 Ga0207651_10140428 3300025960 Bacteria 1865
150 Ga0207712_10010537 3300025961 Bacteria 5868
151 Ga0207668_10000013 3300025972 Bacteria 167989
152 Ga0207668_10000197 3300025972 Bacteria 41484
153 Ga0207668_10002677 3300025972 Bacteria 10425
154 Ga0207668_10121250 3300025972 Bacteria 1980
155 Ga0207668_10321345 3300025972 Bacteria 1284
156 Ga0207640_10356903 3300025981 Bacteria 1176
157 Ga0207658_10000318 3300025986 Bacteria 48562
158 Ga0207658_10363357 3300025986 Bacteria 1263
159 Ga0207658_10651904 3300025986 Bacteria 949
160 Ga0207703_10000065 3300026035 Bacteria 126087
161 Ga0207703_10010473 3300026035 Bacteria 7249
162 Ga0207703_10059685 3300026035 Bacteria 3116
163 Ga0207639_10216034 3300026041 Bacteria 1653
164 Ga0207639_10384894 3300026041 Bacteria 1260
165 Ga0207641_10000011 3300026088 Bacteria 384362
166 Ga0207641_10000532 3300026088 Bacteria 42714
167 Ga0207641_10002973 3300026088 Bacteria 15339
168 Ga0207641_10013559 3300026088 Bacteria 6685
169 Ga0207641_10056759 3300026088 Bacteria 3328
170 Ga0207641_10542946 3300026088 Bacteria 1133
171 Ga0207676_10000135 3300026095 Bacteria 64914
172 Ga0207676_10000450 3300026095 Bacteria 34793
173 Ga0207676_10003035 3300026095 Bacteria 11983
174 Ga0207676_10108339 3300026095 Bacteria 2319
175 Ga0207676_10343488 3300026095 Bacteria 1378
176 Ga0207674_10103587 3300026116 Bacteria 2825
177 Ga0207675_100195956 3300026118 Bacteria 1939
178 Ga0207675_100341511 3300026118 Bacteria 1466
179 Ga0207683_10082124 3300026121 Bacteria 2862
180 Ga0207698_10176405 3300026142 Bacteria 1888
181 Ga0207698_10981659 3300026142 Bacteria 855
182 Ga0268266_10000003 3300028379 Bacteria 1701703
183 Ga0268266_10002066 3300028379 Bacteria 22243
184 Ga0268266_10002243 3300028379 Bacteria 21052
185 Ga0268266_10049562 3300028379 Bacteria 3602
186 Ga0268266_10105353 3300028379 Bacteria 2491
187 Ga0268266_10360854 3300028379 Bacteria 1367
188 Ga0268266_11140775 3300028379 Bacteria 754
189 Ga0268265_10002265 3300028380 Bacteria 14691
190 Ga0268265_10003943 3300028380 Bacteria 10454
191 Ga0268265_10203243 3300028380 Bacteria 1720
192 Ga0268265_10401924 3300028380 Bacteria 1266
193 Ga0268264_10000014 3300028381 Bacteria 509962
194 Ga0268264_10000205 3300028381 Bacteria 120743
195 Ga0268264_10048857 3300028381 Bacteria 3519
196 Ga0268264_10464795 3300028381 Bacteria 1228
197 Ga0307517_10003957 3300028786 Bacteria 22943
198 Ga0307517_10046849 3300028786 Bacteria 4498
199 Ga0307517_10063627 3300028786 Bacteria 3446
200 Ga0265327_10038068 3300031251 Bacteria 2628
201 Ga0307513_10000649 3300031456 Bacteria 50063
202 Ga0307513_10003278 3300031456 Bacteria 22053
203 Ga0307408_100538198 3300031548 Bacteria 1029
204 Ga0307510_10018167 3300033180 Bacteria 8278
205 Ga0307510_10144077 3300033180 Bacteria 2019
206 Ga0307510_10171832 3300033180 Bacteria 1745
207 Ga0373936_0001631 3300035113 Bacteria 8220
208 Ga0373943_0134470 3300035170 Bacteria 1326
209 Ga0373946_0089263 3300035171 Bacteria 1363
210 Ga0373927_0058247 3300035695 Bacteria 2498
211 Ga0373925_0000199 3300037068 Bacteria 65400
212 Ga0373925_0213289 3300037068 Bacteria 1538
213 Ga0395899_0000560 3300037312 Bacteria 39802
214 Ga0395899_0165994 3300037312 Bacteria 1557
215 Ga0395900_0000002 3300037418 Bacteria 671103
216 Ga0395900_0053892 3300037418 Bacteria 4140
217 Ga0395900_1014813 3300037418 Bacteria 749
218 Ga0395898_0095607 3300037466 Bacteria 2854
219 Ga0395905_0029197 3300037471 Bacteria 5197
220 Ga0395905_0085197 3300037471 Bacteria 2961
221 Ga0436364_0197907 3300037853 Bacteria 1311
222 Ga0395901_0000021 3300038443 Bacteria 307734
223 Ga0395901_0155909 3300038443 Bacteria 2398
224 Ga0436365_1395551 3300039437 Bacteria 1807
225 Ga0436365_1458768 3300039437 Bacteria 1585
226 Ga0436362_0085380 3300039453 Bacteria 891
227 Ga0466968_0098720 3300044735 Bacteria 1302
228 Ga0495629_0117584 3300046459 Bacteria 1852
229 Ga0495583_0019518 3300046506 Bacteria 3536
230 Ga0495606_0218441 3300046507 Bacteria 1076
231 Ga0495620_0008708 3300046515 Bacteria 5432
232 Ga0495628_0020975 3300046516 Bacteria 5382
233 Ga0495630_0280954 3300046517 Bacteria 1272
234 Ga0495643_0031500 3300046522 Bacteria 2950
235 Ga0495642_0040891 3300046528 Bacteria 1884
236 Ga0495665_0099125 3300046531 Bacteria 1530
237 Ga0495597_0000813 3300046542 Bacteria 24618
238 Ga0495622_0002218 3300046557 Bacteria 9469
239 Ga0495668_0022002 3300046616 Bacteria 3648
240 Ga0495625_0154907 3300046660 Bacteria 1538
241 Ga0495625_0214742 3300046660 Bacteria 1263
242 Ga0495669_0000007 3300046684 Bacteria 180797
243 Ga0495669_0000318 3300046684 Bacteria 26632
244 Ga0495669_0156856 3300046684 Bacteria 1079
245 Ga0495687_055413 3300047443 Bacteria 1658
246 Ga0495677_0065989 3300047445 Bacteria 1345
247 Ga0495677_0114914 3300047445 Bacteria 1024
248 Ga0495602_0223146 3300048088 Bacteria 1421
249 Ga0496101_0047602 3300048904 Bacteria 3079
250 Ga0496101_0308612 3300048904 Bacteria 1240
251 Ga0496102_0003298 3300048905 Bacteria 13683
252 Ga0496102_0078242 3300048905 Bacteria 3044
253 Ga0496106_0436754 3300048909 Bacteria 1052
254 Ga0496107_0029308 3300048910 Bacteria 3915
255 Ga0496108_0036030 3300048911 Bacteria 4115
256 Ga0496109_0067293 3300048912 Bacteria 3281
257 Ga0496110_0858900 3300048913 Bacteria 813
258 Ga0496112_0015115 3300048915 Bacteria 7191
259 Ga0496112_0248131 3300048915 Bacteria 1732
260 Ga0496112_0673378 3300048915 Bacteria 963
261 Ga0496113_0163179 3300048916 Bacteria 1762
262 Ga0496115_0006365 3300048918 Bacteria 8648
263 Ga0496115_0036911 3300048918 Bacteria 3870
264 Ga0496115_0047345 3300048918 Bacteria 3438
265 Ga0496115_0551871 3300048918 Bacteria 921
266 Ga0496117_0033707 3300048920 Bacteria 3869
267 Ga0496119_0004198 3300048922 Bacteria 14479
268 Ga0496121_0000035 3300048924 Bacteria 374316
269 Ga0496121_0488257 3300048924 Bacteria 785
270 Ga0501036_0676999 3300049572 Bacteria 853
271 Ga0501037_0397201 3300049573 Bacteria 946
272 Ga0501047_0004654 3300049581 Bacteria 12909
273 Ga0501047_0032668 3300049581 Bacteria 5026
274 Ga0501048_0296597 3300049582 Bacteria 1150
275 Ga0501044_0013059 3300049823 Bacteria 8988
276 Ga0501044_0261904 3300049823 Bacteria 1667
277 nmdc:mga03n38_142026_c1 3300050490 Bacteria 1200
278 nmdc:mga00v17_8680_c1 3300050491 Bacteria 5474
279 nmdc:mga0k408_225501_c1 3300050493 Bacteria 1119
280 nmdc:mga06z11_2778_c1 3300050494 Bacteria 6710
281 nmdc:mga04h51_24454_c1 3300050495 Bacteria 1850
282 nmdc:mga07m45_145530_c1 3300050496 Bacteria 1374
283 Ga0500635_0000206 3300053080 Bacteria 29145
284 Ga0500578_0126757 3300053086 Bacteria 1603
285 Ga0500583_0373368 3300053092 Bacteria 688
286 Ga0500651_0028791 3300053093 Bacteria 3492
287 Ga0500566_0030902 3300053094 Bacteria 3122
288 Ga0500641_0102923 3300053096 Bacteria 1225
289 Ga0500555_002396 3300053103 Bacteria 5448
290 Ga0500556_0072566 3300053104 Bacteria 1288
291 Ga0500562_001104 3300053108 Bacteria 6634
292 Ga0500562_005916 3300053108 Bacteria 3079
293 Ga0500569_000371 3300053109 Bacteria 7301
294 Ga0500595_001765 3300053119 Bacteria 11252
295 Ga0500595_063452 3300053119 Bacteria 1110
296 Ga0500608_000264 3300053122 Bacteria 20418
297 Ga0500614_004893 3300053123 Bacteria 2817
298 Ga0500642_0032329 3300053130 Bacteria 2195
299 Ga0500559_0036213 3300053136 Bacteria 2133
300 Ga0500616_0097553 3300053153 Bacteria 1443
301 Ga0500616_0156747 3300053153 Bacteria 1048
302 Ga0500624_001610 3300053157 Bacteria 3439
303 Ga0500636_0003786 3300053177 Bacteria 8541
304 Ga0500637_0054170 3300053178 Bacteria 2289
305 Ga0500596_002188 3300053735 Bacteria 3874

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049582 Ga0501048_0296597 Ga0501048_0296597_545_1135 196
2 3300005331 Ga0070670_100016139 Ga0070670_1000161393 198
3 3300005355 Ga0070671_100003609 Ga0070671_1000036097 198
4 3300005367 Ga0070667_100051881 Ga0070667_1000518814 198
5 3300005617 Ga0068859_100000811 Ga0068859_1000008115 198
6 3300005617 Ga0068859_100277059 Ga0068859_1002770592 198
7 3300005719 Ga0068861_100097711 Ga0068861_1000977113 198
8 3300005841 Ga0068863_100000663 Ga0068863_1000006635 198
9 3300005842 Ga0068858_100008697 Ga0068858_1000086975 198
10 3300005843 Ga0068860_100097126 Ga0068860_1000971263 198
11 3300005844 Ga0068862_100014066 Ga0068862_1000140665 198
12 3300006195 Ga0075366_10019047 Ga0075366_100190471 198
13 3300006931 Ga0097620_100000811 Ga0097620_1000008115 198
14 3300006931 Ga0097620_100277083 Ga0097620_1002770833 198
15 3300025923 Ga0207681_10066999 Ga0207681_100669993 198
16 3300025931 Ga0207644_10006895 Ga0207644_100068952 198
17 3300025941 Ga0207711_10030162 Ga0207711_100301625 198
18 3300025972 Ga0207668_10002677 Ga0207668_100026775 198
19 3300026118 Ga0207675_100195956 Ga0207675_1001959563 198
20 3300028380 Ga0268265_10002265 Ga0268265_100022652 198
21 3300046531 Ga0495665_0099125 Ga0495665_0099125_909_1508 198
22 3300049823 Ga0501044_0261904 Ga0501044_0261904_1027_1623 198
23 3300050495 nmdc:mga04h51_24454_c1 nmdc:mga04h51_24454_c1_19_615 198
24 3300053092 Ga0500583_0373368 Ga0500583_0373368_17_616 198
25 3300035113 Ga0373936_0001631 Ga0373936_0001631_1048_1722 208
26 3300009177 Ga0105248_10000170 Ga0105248_1000017083 209
27 3300025941 Ga0207711_10000374 Ga0207711_100003749 209
28 3300046516 Ga0495628_0020975 Ga0495628_0020975_3078_3728 216
29 3300009551 Ga0105238_10156771 Ga0105238_101567712 217
30 3300013307 Ga0157372_10841976 Ga0157372_108419761 217
31 3300005842 Ga0068858_100296436 Ga0068858_1002964363 218
32 3300049572 Ga0501036_0676999 Ga0501036_0676999_23_679 218
33 3300049573 Ga0501037_0397201 Ga0501037_0397201_157_813 218
34 3300049823 Ga0501044_0013059 Ga0501044_0013059_4821_5477 218
35 3300005617 Ga0068859_101100951 Ga0068859_1011009512 221
36 3300006931 Ga0097620_101101031 Ga0097620_1011010312 221
37 3300037853 Ga0436364_0197907 Ga0436364_0197907_408_1073 221
38 3300005458 Ga0070681_10352714 Ga0070681_103527142 222
39 3300021384 Ga0213876_10160973 Ga0213876_101609732 222
40 3300025913 Ga0207695_10018076 Ga0207695_100180764 222
41 3300025921 Ga0207652_10263243 Ga0207652_102632432 222
42 3300025924 Ga0207694_10246585 Ga0207694_102465852 222
43 3300025949 Ga0207667_10054171 Ga0207667_100541713 222
44 3300031548 Ga0307408_100538198 Ga0307408_1005381982 222
45 3300039437 Ga0436365_1395551 Ga0436365_1395551_409_1080 222
46 3300049581 Ga0501047_0004654 Ga0501047_0004654_9920_10588 222
47 3300005327 Ga0070658_10688084 Ga0070658_106880841 223
48 3300005336 Ga0070680_100017002 Ga0070680_1000170026 223
49 3300005336 Ga0070680_100241287 Ga0070680_1002412872 223
50 3300005366 Ga0070659_100115311 Ga0070659_1001153112 223
51 3300005458 Ga0070681_10038631 Ga0070681_100386312 223
52 3300005458 Ga0070681_10227262 Ga0070681_102272622 223
53 3300005530 Ga0070679_100144915 Ga0070679_1001449152 223
54 3300005563 Ga0068855_100121878 Ga0068855_1001218782 223
55 3300005563 Ga0068855_100889485 Ga0068855_1008894852 223
56 3300005577 Ga0068857_100576732 Ga0068857_1005767322 223
57 3300006042 Ga0075368_10018064 Ga0075368_100180644 223
58 3300006178 Ga0075367_10002614 Ga0075367_100026146 223
59 3300009093 Ga0105240_10050780 Ga0105240_100507803 223
60 3300009551 Ga0105238_10820334 Ga0105238_108203341 223
61 3300013104 Ga0157370_10032275 Ga0157370_100322753 223
62 3300013104 Ga0157370_10589920 Ga0157370_105899202 223
63 3300013307 Ga0157372_10054941 Ga0157372_100549414 223
64 3300025909 Ga0207705_10003453 Ga0207705_100034535 223
65 3300025912 Ga0207707_10018494 Ga0207707_100184942 223
66 3300025912 Ga0207707_10368250 Ga0207707_103682502 223
67 3300025913 Ga0207695_10066392 Ga0207695_100663922 223
68 3300025917 Ga0207660_10002946 Ga0207660_100029464 223
69 3300025917 Ga0207660_10053132 Ga0207660_100531323 223
70 3300025917 Ga0207660_10129999 Ga0207660_101299992 223
71 3300025919 Ga0207657_10132655 Ga0207657_101326552 223
72 3300025921 Ga0207652_10004969 Ga0207652_100049692 223
73 3300025924 Ga0207694_10579325 Ga0207694_105793251 223
74 3300025949 Ga0207667_10124014 Ga0207667_101240141 223
75 3300026041 Ga0207639_10216034 Ga0207639_102160342 223
76 3300026116 Ga0207674_10103587 Ga0207674_101035872 223
77 3300026142 Ga0207698_10981659 Ga0207698_109816592 223
78 3300033180 Ga0307510_10144077 Ga0307510_101440773 223
79 3300035170 Ga0373943_0134470 Ga0373943_0134470_105_776 223
80 3300037068 Ga0373925_0213289 Ga0373925_0213289_332_1003 223
81 3300039453 Ga0436362_0085380 Ga0436362_0085380_171_842 223
82 3300046517 Ga0495630_0280954 Ga0495630_0280954_455_1138 223
83 3300050490 nmdc:mga03n38_142026_c1 nmdc:mga03n38_142026_c1_110_781 223
84 3300050491 nmdc:mga00v17_8680_c1 nmdc:mga00v17_8680_c1_147_818 223
85 3300050493 nmdc:mga0k408_225501_c1 nmdc:mga0k408_225501_c1_329_1000 223
86 3300050494 nmdc:mga06z11_2778_c1 nmdc:mga06z11_2778_c1_1475_2146 223
87 3300050496 nmdc:mga07m45_145530_c1 nmdc:mga07m45_145530_c1_110_781 223
88 3300053108 Ga0500562_001104 Ga0500562_001104_4559_5230 223
89 3300005262 Ga0065165_1016811 Ga0065165_10168112 224
90 3300005331 Ga0070670_100000007 Ga0070670_10000000768 224
91 3300005331 Ga0070670_100012304 Ga0070670_1000123048 224
92 3300005334 Ga0068869_100113234 Ga0068869_1001132343 224
93 3300005335 Ga0070666_10134769 Ga0070666_101347693 224
94 3300005340 Ga0070689_100418045 Ga0070689_1004180452 224
95 3300005344 Ga0070661_100206920 Ga0070661_1002069202 224
96 3300005347 Ga0070668_100001382 Ga0070668_1000013827 224
97 3300005347 Ga0070668_100001424 Ga0070668_1000014246 224
98 3300005347 Ga0070668_100090836 Ga0070668_1000908362 224
99 3300005353 Ga0070669_100048689 Ga0070669_1000486892 224
100 3300005355 Ga0070671_100208989 Ga0070671_1002089892 224
101 3300005364 Ga0070673_100135604 Ga0070673_1001356042 224
102 3300005367 Ga0070667_100000293 Ga0070667_10000029346 224
103 3300005367 Ga0070667_100005167 Ga0070667_1000051679 224
104 3300005456 Ga0070678_100298320 Ga0070678_1002983202 224
105 3300005548 Ga0070665_100001912 Ga0070665_1000019127 224
106 3300005548 Ga0070665_100004154 Ga0070665_1000041545 224
107 3300005548 Ga0070665_100231556 Ga0070665_1002315562 224
108 3300005563 Ga0068855_100346607 Ga0068855_1003466072 224
109 3300005578 Ga0068854_100457872 Ga0068854_1004578722 224
110 3300005616 Ga0068852_100278820 Ga0068852_1002788202 224
111 3300005617 Ga0068859_100083263 Ga0068859_1000832635 224
112 3300005617 Ga0068859_100291199 Ga0068859_1002911991 224
113 3300005618 Ga0068864_100002694 Ga0068864_10000269410 224
114 3300005618 Ga0068864_100006635 Ga0068864_1000066358 224
115 3300005618 Ga0068864_100150351 Ga0068864_1001503512 224
116 3300005618 Ga0068864_100302083 Ga0068864_1003020832 224
117 3300005719 Ga0068861_100241928 Ga0068861_1002419281 224
118 3300005841 Ga0068863_100001917 Ga0068863_10000191711 224
119 3300005841 Ga0068863_100002318 Ga0068863_10000231823 224
120 3300005841 Ga0068863_100027950 Ga0068863_1000279502 224
121 3300005841 Ga0068863_100086882 Ga0068863_1000868822 224
122 3300005841 Ga0068863_100110501 Ga0068863_1001105012 224
123 3300005841 Ga0068863_100464667 Ga0068863_1004646672 224
124 3300005842 Ga0068858_100001006 Ga0068858_10000100614 224
125 3300005842 Ga0068858_100035160 Ga0068858_1000351608 224
126 3300005842 Ga0068858_100721113 Ga0068858_1007211131 224
127 3300005843 Ga0068860_100000047 Ga0068860_10000004769 224
128 3300005843 Ga0068860_100001901 Ga0068860_10000190119 224
129 3300005843 Ga0068860_100032863 Ga0068860_1000328632 224
130 3300005844 Ga0068862_100000396 Ga0068862_10000039651 224
131 3300005844 Ga0068862_100022932 Ga0068862_1000229322 224
132 3300005844 Ga0068862_100089367 Ga0068862_1000893673 224
133 3300005844 Ga0068862_100403355 Ga0068862_1004033552 224
134 3300006177 Ga0075362_10057465 Ga0075362_100574652 224
135 3300006881 Ga0068865_100000389 Ga0068865_10000038921 224
136 3300006931 Ga0097620_100083262 Ga0097620_1000832625 224
137 3300006931 Ga0097620_100291188 Ga0097620_1002911881 224
138 3300009093 Ga0105240_10152483 Ga0105240_101524834 224
139 3300009093 Ga0105240_10269488 Ga0105240_102694883 224
140 3300009174 Ga0105241_10317003 Ga0105241_103170032 224
141 3300009177 Ga0105248_10022121 Ga0105248_100221215 224
142 3300009177 Ga0105248_10029455 Ga0105248_100294555 224
143 3300009177 Ga0105248_10030024 Ga0105248_100300249 224
144 3300009177 Ga0105248_10043455 Ga0105248_100434552 224
145 3300009177 Ga0105248_10404334 Ga0105248_104043343 224
146 3300009551 Ga0105238_10040354 Ga0105238_100403545 224
147 3300009551 Ga0105238_10427936 Ga0105238_104279362 224
148 3300009553 Ga0105249_10001104 Ga0105249_100011047 224
149 3300010375 Ga0105239_10243085 Ga0105239_102430853 224
150 3300010375 Ga0105239_11502853 Ga0105239_115028531 224
151 3300013306 Ga0163162_10010062 Ga0163162_100100624 224
152 3300014325 Ga0163163_10012776 Ga0163163_100127768 224
153 3300014325 Ga0163163_10081481 Ga0163163_100814813 224
154 3300014325 Ga0163163_10127535 Ga0163163_101275352 224
155 3300014326 Ga0157380_10188015 Ga0157380_101880152 224
156 3300014968 Ga0157379_10017448 Ga0157379_100174489 224
157 3300014968 Ga0157379_10024067 Ga0157379_100240676 224
158 3300014968 Ga0157379_10051954 Ga0157379_100519544 224
159 3300017792 Ga0163161_10295206 Ga0163161_102952062 224
160 3300021384 Ga0213876_10094210 Ga0213876_100942103 224
161 3300025304 Ga0209257_1003844 Ga0209257_10038444 224
162 3300025903 Ga0207680_10141250 Ga0207680_101412502 224
163 3300025903 Ga0207680_10148894 Ga0207680_101488942 224
164 3300025913 Ga0207695_10011899 Ga0207695_100118994 224
165 3300025919 Ga0207657_10082553 Ga0207657_100825531 224
166 3300025923 Ga0207681_10114305 Ga0207681_101143053 224
167 3300025923 Ga0207681_10798055 Ga0207681_107980551 224
168 3300025924 Ga0207694_10139862 Ga0207694_101398622 224
169 3300025925 Ga0207650_10000033 Ga0207650_1000003327 224
170 3300025925 Ga0207650_10093098 Ga0207650_100930984 224
171 3300025925 Ga0207650_10157112 Ga0207650_101571122 224
172 3300025925 Ga0207650_10278853 Ga0207650_102788532 224
173 3300025931 Ga0207644_10020086 Ga0207644_100200863 224
174 3300025936 Ga0207670_10685343 Ga0207670_106853432 224
175 3300025941 Ga0207711_10018077 Ga0207711_100180777 224
176 3300025941 Ga0207711_10072038 Ga0207711_100720383 224
177 3300025942 Ga0207689_10167418 Ga0207689_101674181 224
178 3300025949 Ga0207667_10178515 Ga0207667_101785152 224
179 3300025949 Ga0207667_10279218 Ga0207667_102792182 224
180 3300025960 Ga0207651_10140428 Ga0207651_101404282 224
181 3300025961 Ga0207712_10010537 Ga0207712_100105377 224
182 3300025972 Ga0207668_10000013 Ga0207668_1000001323 224
183 3300025972 Ga0207668_10000197 Ga0207668_100001977 224
184 3300025972 Ga0207668_10121250 Ga0207668_101212502 224
185 3300025972 Ga0207668_10321345 Ga0207668_103213452 224
186 3300025981 Ga0207640_10356903 Ga0207640_103569032 224
187 3300025986 Ga0207658_10000318 Ga0207658_1000031847 224
188 3300025986 Ga0207658_10363357 Ga0207658_103633572 224
189 3300025986 Ga0207658_10651904 Ga0207658_106519042 224
190 3300026035 Ga0207703_10000065 Ga0207703_10000065108 224
191 3300026035 Ga0207703_10010473 Ga0207703_100104738 224
192 3300026035 Ga0207703_10059685 Ga0207703_100596851 224
193 3300026041 Ga0207639_10384894 Ga0207639_103848942 224
194 3300026088 Ga0207641_10000011 Ga0207641_10000011398 224
195 3300026088 Ga0207641_10000532 Ga0207641_1000053239 224
196 3300026088 Ga0207641_10002973 Ga0207641_1000297313 224
197 3300026088 Ga0207641_10013559 Ga0207641_100135596 224
198 3300026088 Ga0207641_10056759 Ga0207641_100567593 224
199 3300026088 Ga0207641_10542946 Ga0207641_105429462 224
200 3300026095 Ga0207676_10000135 Ga0207676_1000013568 224
201 3300026095 Ga0207676_10000450 Ga0207676_1000045015 224
202 3300026095 Ga0207676_10003035 Ga0207676_1000303510 224
203 3300026095 Ga0207676_10108339 Ga0207676_101083394 224
204 3300026095 Ga0207676_10343488 Ga0207676_103434882 224
205 3300026118 Ga0207675_100341511 Ga0207675_1003415112 224
206 3300026121 Ga0207683_10082124 Ga0207683_100821242 224
207 3300026142 Ga0207698_10176405 Ga0207698_101764052 224
208 3300028379 Ga0268266_10000003 Ga0268266_100000031314 224
209 3300028379 Ga0268266_10002066 Ga0268266_100020666 224
210 3300028379 Ga0268266_10002243 Ga0268266_100022435 224
211 3300028379 Ga0268266_10049562 Ga0268266_100495621 224
212 3300028379 Ga0268266_10105353 Ga0268266_101053533 224
213 3300028379 Ga0268266_10360854 Ga0268266_103608542 224
214 3300028379 Ga0268266_11140775 Ga0268266_111407751 224
215 3300028380 Ga0268265_10003943 Ga0268265_100039437 224
216 3300028380 Ga0268265_10203243 Ga0268265_102032432 224
217 3300028380 Ga0268265_10401924 Ga0268265_104019242 224
218 3300028381 Ga0268264_10000014 Ga0268264_10000014297 224
219 3300028381 Ga0268264_10000205 Ga0268264_1000020558 224
220 3300028381 Ga0268264_10048857 Ga0268264_100488575 224
221 3300028381 Ga0268264_10464795 Ga0268264_104647952 224
222 3300028786 Ga0307517_10003957 Ga0307517_1000395719 224
223 3300028786 Ga0307517_10046849 Ga0307517_100468497 224
224 3300028786 Ga0307517_10063627 Ga0307517_100636274 224
225 3300031251 Ga0265327_10038068 Ga0265327_100380682 224
226 3300031456 Ga0307513_10000649 Ga0307513_100006494 224
227 3300031456 Ga0307513_10003278 Ga0307513_1000327819 224
228 3300033180 Ga0307510_10018167 Ga0307510_100181676 224
229 3300033180 Ga0307510_10171832 Ga0307510_101718321 224
230 3300035171 Ga0373946_0089263 Ga0373946_0089263_350_1024 224
231 3300035695 Ga0373927_0058247 Ga0373927_0058247_270_944 224
232 3300037068 Ga0373925_0000199 Ga0373925_0000199_4945_5619 224
233 3300037312 Ga0395899_0000560 Ga0395899_0000560_14766_15443 224
234 3300037312 Ga0395899_0165994 Ga0395899_0165994_375_1094 224
235 3300037418 Ga0395900_0000002 Ga0395900_0000002_213334_214011 224
236 3300037418 Ga0395900_0053892 Ga0395900_0053892_3349_4026 224
237 3300037418 Ga0395900_1014813 Ga0395900_1014813_59_736 224
238 3300037466 Ga0395898_0095607 Ga0395898_0095607_363_1040 224
239 3300037471 Ga0395905_0029197 Ga0395905_0029197_986_1663 224
240 3300037471 Ga0395905_0085197 Ga0395905_0085197_1480_2157 224
241 3300038443 Ga0395901_0000021 Ga0395901_0000021_80883_81560 224
242 3300038443 Ga0395901_0155909 Ga0395901_0155909_1362_2081 224
243 3300039437 Ga0436365_1458768 Ga0436365_1458768_729_1403 224
244 3300044735 Ga0466968_0098720 Ga0466968_0098720_279_953 224
245 3300046459 Ga0495629_0117584 Ga0495629_0117584_979_1656 224
246 3300046506 Ga0495583_0019518 Ga0495583_0019518_451_1125 224
247 3300046507 Ga0495606_0218441 Ga0495606_0218441_332_1006 224
248 3300046515 Ga0495620_0008708 Ga0495620_0008708_1478_2155 224
249 3300046522 Ga0495643_0031500 Ga0495643_0031500_139_813 224
250 3300046528 Ga0495642_0040891 Ga0495642_0040891_486_1166 224
251 3300046542 Ga0495597_0000813 Ga0495597_0000813_3958_4632 224
252 3300046557 Ga0495622_0002218 Ga0495622_0002218_62_739 224
253 3300046616 Ga0495668_0022002 Ga0495668_0022002_2729_3403 224
254 3300046660 Ga0495625_0154907 Ga0495625_0154907_145_822 224
255 3300046660 Ga0495625_0214742 Ga0495625_0214742_48_725 224
256 3300046684 Ga0495669_0000007 Ga0495669_0000007_98910_99587 224
257 3300046684 Ga0495669_0000318 Ga0495669_0000318_25193_25870 224
258 3300046684 Ga0495669_0156856 Ga0495669_0156856_231_923 224
259 3300047443 Ga0495687_055413 Ga0495687_055413_101_775 224
260 3300047445 Ga0495677_0065989 Ga0495677_0065989_109_786 224
261 3300047445 Ga0495677_0114914 Ga0495677_0114914_181_861 224
262 3300048088 Ga0495602_0223146 Ga0495602_0223146_313_990 224
263 3300048904 Ga0496101_0047602 Ga0496101_0047602_1107_1781 224
264 3300048904 Ga0496101_0308612 Ga0496101_0308612_147_827 224
265 3300048905 Ga0496102_0003298 Ga0496102_0003298_3999_4673 224
266 3300048905 Ga0496102_0078242 Ga0496102_0078242_1346_2020 224
267 3300048909 Ga0496106_0436754 Ga0496106_0436754_118_792 224
268 3300048910 Ga0496107_0029308 Ga0496107_0029308_2457_3131 224
269 3300048911 Ga0496108_0036030 Ga0496108_0036030_3085_3759 224
270 3300048912 Ga0496109_0067293 Ga0496109_0067293_2252_2926 224
271 3300048913 Ga0496110_0858900 Ga0496110_0858900_61_735 224
272 3300048915 Ga0496112_0015115 Ga0496112_0015115_1819_2493 224
273 3300048915 Ga0496112_0248131 Ga0496112_0248131_445_1119 224
274 3300048915 Ga0496112_0673378 Ga0496112_0673378_221_898 224
275 3300048916 Ga0496113_0163179 Ga0496113_0163179_166_840 224
276 3300048918 Ga0496115_0006365 Ga0496115_0006365_842_1516 224
277 3300048918 Ga0496115_0036911 Ga0496115_0036911_509_1186 224
278 3300048918 Ga0496115_0047345 Ga0496115_0047345_37_711 224
279 3300048918 Ga0496115_0551871 Ga0496115_0551871_95_781 224
280 3300048920 Ga0496117_0033707 Ga0496117_0033707_1318_1992 224
281 3300048922 Ga0496119_0004198 Ga0496119_0004198_7252_7926 224
282 3300048924 Ga0496121_0000035 Ga0496121_0000035_362766_363440 224
283 3300048924 Ga0496121_0488257 Ga0496121_0488257_12_728 224
284 3300049581 Ga0501047_0032668 Ga0501047_0032668_404_1090 224
285 3300053080 Ga0500635_0000206 Ga0500635_0000206_3312_3986 224
286 3300053086 Ga0500578_0126757 Ga0500578_0126757_910_1584 224
287 3300053093 Ga0500651_0028791 Ga0500651_0028791_324_1001 224
288 3300053094 Ga0500566_0030902 Ga0500566_0030902_1670_2347 224
289 3300053096 Ga0500641_0102923 Ga0500641_0102923_485_1159 224
290 3300053103 Ga0500555_002396 Ga0500555_002396_2495_3169 224
291 3300053104 Ga0500556_0072566 Ga0500556_0072566_147_860 224
292 3300053108 Ga0500562_005916 Ga0500562_005916_1088_1762 224
293 3300053109 Ga0500569_000371 Ga0500569_000371_3308_3982 224
294 3300053119 Ga0500595_001765 Ga0500595_001765_9356_10033 224
295 3300053119 Ga0500595_063452 Ga0500595_063452_27_701 224
296 3300053122 Ga0500608_000264 Ga0500608_000264_4803_5480 224
297 3300053123 Ga0500614_004893 Ga0500614_004893_337_1014 224
298 3300053130 Ga0500642_0032329 Ga0500642_0032329_42_719 224
299 3300053136 Ga0500559_0036213 Ga0500559_0036213_558_1235 224
300 3300053153 Ga0500616_0097553 Ga0500616_0097553_623_1297 224
301 3300053153 Ga0500616_0156747 Ga0500616_0156747_214_894 224
302 3300053157 Ga0500624_001610 Ga0500624_001610_1918_2592 224
303 3300053177 Ga0500636_0003786 Ga0500636_0003786_4016_4690 224
304 3300053178 Ga0500637_0054170 Ga0500637_0054170_237_911 224
305 3300053735 Ga0500596_002188 Ga0500596_002188_2422_3099 224

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02390

Methyltransf_4

Putative methyltransferase

50

202

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dxz-assembly1.cif.gz_A crystal structure of ectrmb in complex with sah 0.8886 26 224
3dxy-assembly1.cif.gz_A crystal structure of ectrmb in complex with sam 0.878 26 224
3dxz-assembly1.cif.gz_A crystal structure of ectrmb in complex with sah 0.8677 26 224
3dxy-assembly1.cif.gz_A crystal structure of ectrmb in complex with sam 0.842 26 224
7nzj-assembly3.cif.gz_E structure of bstrmb apo 0.8412 52 224
ID Description Score Start End Superfamily
3dxzA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8886 26 224 3.40.50.150
3dxzA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8676 26 224 3.40.50.150
af_Q4E3J0_145_404_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8541 52 104 3.40.50.150
af_P9WFY9_38_258_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8442 19 223 3.40.50.150
af_Q55EX4_556_743_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8259 52 223 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A519PBR7-F1-model_v4 tRNA (guanine(46)-N(7))-methyltransferase (EC 2.1.1.33) 0.9592 61 224 GO:0008176
GO:0043527
AF-A0A519PBR7-F1-model_v4 tRNA (guanine(46)-N(7))-methyltransferase (EC 2.1.1.33) 0.9535 61 224 GO:0008176
GO:0043527
AF-A0A062TUX9-F1-model_v4 tRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.33) (tRNA (guanine(46)-N(7))-methyltransferase) (tRNA(m7G46)-methyltransferase) 0.952 27 224 GO:0008176
GO:0043527
AF-A0A3D5ZZ30-F1-model_v4 deleted 0.9515 18 223
AF-A0A1F3A8E5-F1-model_v4 tRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.33) (tRNA (guanine(46)-N(7))-methyltransferase) (tRNA(m7G46)-methyltransferase) 0.9384 12 224 GO:0008176
GO:0043527

Feature Viewer

pLDDT pTM Quality
87.3 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map