F398202
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 305 | 143 | 305 | 180 |
Family's Representative Sequence
| Representative Sequence | 3300035086|Ga0373934_0023248|Ga0373934_0023248_1475_2104 |
| Length | 209 |
| Sequence | LCEVLVQGDSFPSAQLRVWIALRSSFTILAMRKIVLGLGISLDGYIARRDGSVDFLFMPKDYSMAPFFKTIDAAIMGRKTWEVAVKMGGSFGGSSMTSYVMSGSQPPGERGGVIFTNQTPAALIAEIRKRRGKDIWLMGGGELARDFLKADLVDELYLGVLPVLLGEGLPLFPSGFPQRNFALLENKTFSRGMIALKYKRLRSKAKRKH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 4 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 6 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 8 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 9 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 21 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 26 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 27 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 28 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 29 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 35 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 36 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 37 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 38 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 39 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 47 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 53 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 54 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 78 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 79 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 80 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 81 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 82 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 83 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 84 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 85 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 86 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 87 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 88 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 89 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 90 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 91 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 92 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 93 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 94 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 95 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 96 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 97 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 98 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 99 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 100 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 101 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 102 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 103 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 104 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 105 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 106 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 107 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 108 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 133 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 134 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 135 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 136 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 137 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 138 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 139 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 140 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 141 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 142 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 143 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.67 |
| Metatranscriptomes | 0.33 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.95 |
| Rhizosphere | 96.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.98 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10534539 | 3300005327 | Bacteria | 1014 |
| 2 | Ga0070683_100081361 | 3300005329 | Unclassified | 3032 |
| 3 | Ga0070680_100306115 | 3300005336 | Bacteria | 1348 |
| 4 | Ga0070674_100094155 | 3300005356 | Unclassified | 2169 |
| 5 | Ga0070709_10000057 | 3300005434 | Bacteria | 87352 |
| 6 | Ga0070709_10013598 | 3300005434 | Bacteria | 4581 |
| 7 | Ga0070709_10020696 | 3300005434 | Unclassified | 3823 |
| 8 | Ga0070709_10292507 | 3300005434 | Bacteria | 1187 |
| 9 | Ga0070714_100000715 | 3300005435 | Bacteria | 23534 |
| 10 | Ga0070713_100004775 | 3300005436 | Bacteria | 9172 |
| 11 | Ga0070713_100026895 | 3300005436 | Bacteria | 4523 |
| 12 | Ga0070713_100338288 | 3300005436 | Bacteria | 1394 |
| 13 | Ga0070713_100342546 | 3300005436 | Bacteria | 1385 |
| 14 | Ga0070713_100547058 | 3300005436 | Unclassified | 1096 |
| 15 | Ga0070713_100830357 | 3300005436 | Bacteria | 887 |
| 16 | Ga0070713_101220658 | 3300005436 | Unclassified | 728 |
| 17 | Ga0070710_10401086 | 3300005437 | Bacteria | 919 |
| 18 | Ga0070711_100018451 | 3300005439 | Bacteria | 4456 |
| 19 | Ga0070711_100064007 | 3300005439 | Bacteria | 2568 |
| 20 | Ga0070711_100110962 | 3300005439 | Bacteria | 2013 |
| 21 | Ga0070711_100189085 | 3300005439 | Bacteria | 1581 |
| 22 | Ga0070711_100364340 | 3300005439 | Bacteria | 1165 |
| 23 | Ga0070711_100575607 | 3300005439 | Bacteria | 937 |
| 24 | Ga0070705_100257114 | 3300005440 | Unclassified | 1229 |
| 25 | Ga0070708_100012421 | 3300005445 | Bacteria | 6953 |
| 26 | Ga0070708_100017913 | 3300005445 | Bacteria | 5921 |
| 27 | Ga0070708_100333197 | 3300005445 | Bacteria | 1430 |
| 28 | Ga0070708_101276883 | 3300005445 | Bacteria | 686 |
| 29 | Ga0070681_10006458 | 3300005458 | Bacteria | 11410 |
| 30 | Ga0070681_10785857 | 3300005458 | Bacteria | 869 |
| 31 | Ga0070685_10151009 | 3300005466 | Bacteria | 1472 |
| 32 | Ga0070706_100062888 | 3300005467 | Unclassified | 3430 |
| 33 | Ga0070706_100171437 | 3300005467 | Bacteria | 2026 |
| 34 | Ga0070706_100302020 | 3300005467 | Unclassified | 1494 |
| 35 | Ga0070707_100006912 | 3300005468 | Bacteria | 10511 |
| 36 | Ga0070707_100324688 | 3300005468 | Bacteria | 1495 |
| 37 | Ga0070707_100423380 | 3300005468 | Bacteria | 1292 |
| 38 | Ga0070698_100003703 | 3300005471 | Bacteria | 16779 |
| 39 | Ga0070698_100522460 | 3300005471 | Bacteria | 1125 |
| 40 | Ga0070698_101030352 | 3300005471 | Bacteria | 770 |
| 41 | Ga0070699_100029748 | 3300005518 | Bacteria | 4711 |
| 42 | Ga0070699_100356705 | 3300005518 | Bacteria | 1318 |
| 43 | Ga0070699_100569381 | 3300005518 | Bacteria | 1032 |
| 44 | Ga0070679_100175125 | 3300005530 | Bacteria | 2118 |
| 45 | Ga0070697_100003251 | 3300005536 | Bacteria | 12478 |
| 46 | Ga0070697_100083101 | 3300005536 | Bacteria | 2640 |
| 47 | Ga0070697_100239692 | 3300005536 | Bacteria | 1548 |
| 48 | Ga0070697_100369095 | 3300005536 | Bacteria | 1241 |
| 49 | Ga0068853_100049036 | 3300005539 | Unclassified | 3628 |
| 50 | Ga0068853_100608160 | 3300005539 | Bacteria | 1038 |
| 51 | Ga0070695_100020592 | 3300005545 | Bacteria | 4028 |
| 52 | Ga0070695_100137104 | 3300005545 | Bacteria | 1692 |
| 53 | Ga0070696_100093409 | 3300005546 | Unclassified | 2145 |
| 54 | Ga0070665_100022117 | 3300005548 | Bacteria | 6397 |
| 55 | Ga0070704_100019311 | 3300005549 | Bacteria | 4377 |
| 56 | Ga0068855_100675040 | 3300005563 | Bacteria | 1108 |
| 57 | Ga0068855_101229022 | 3300005563 | Unclassified | 778 |
| 58 | Ga0068852_100594328 | 3300005616 | Bacteria | 1110 |
| 59 | Ga0068866_10246780 | 3300005718 | Unclassified | 1090 |
| 60 | Ga0068863_100156088 | 3300005841 | Bacteria | 2185 |
| 61 | Ga0070717_10019871 | 3300006028 | Bacteria | 5275 |
| 62 | Ga0070717_10097702 | 3300006028 | Bacteria | 2488 |
| 63 | Ga0070717_10443702 | 3300006028 | Bacteria | 1169 |
| 64 | Ga0070717_10556988 | 3300006028 | Bacteria | 1038 |
| 65 | Ga0070717_10720212 | 3300006028 | Unclassified | 907 |
| 66 | Ga0070715_10078774 | 3300006163 | Unclassified | 1490 |
| 67 | Ga0070715_10187449 | 3300006163 | Bacteria | 1042 |
| 68 | Ga0070716_100001913 | 3300006173 | Bacteria | 9466 |
| 69 | Ga0070716_100004009 | 3300006173 | Bacteria | 6991 |
| 70 | Ga0070716_100016314 | 3300006173 | Bacteria | 3830 |
| 71 | Ga0070716_100050009 | 3300006173 | Unclassified | 2371 |
| 72 | Ga0070716_100059707 | 3300006173 | Bacteria | 2199 |
| 73 | Ga0070716_100134918 | 3300006173 | Bacteria | 1566 |
| 74 | Ga0070716_100282184 | 3300006173 | Bacteria | 1147 |
| 75 | Ga0070716_100403270 | 3300006173 | Bacteria | 984 |
| 76 | Ga0070716_100622047 | 3300006173 | Bacteria | 815 |
| 77 | Ga0070712_100012547 | 3300006175 | Bacteria | 5387 |
| 78 | Ga0070712_100096446 | 3300006175 | Bacteria | 2177 |
| 79 | Ga0070712_100181426 | 3300006175 | Bacteria | 1640 |
| 80 | Ga0070712_100334326 | 3300006175 | Bacteria | 1235 |
| 81 | Ga0070712_100431414 | 3300006175 | Bacteria | 1094 |
| 82 | Ga0097621_100686921 | 3300006237 | Unclassified | 941 |
| 83 | Ga0075434_100042242 | 3300006871 | Bacteria | 4520 |
| 84 | Ga0075434_100387578 | 3300006871 | Bacteria | 1418 |
| 85 | Ga0075434_100723644 | 3300006871 | Unclassified | 1012 |
| 86 | Ga0075436_100002551 | 3300006914 | Bacteria | 12538 |
| 87 | Ga0075436_100006061 | 3300006914 | Bacteria | 8297 |
| 88 | Ga0075436_100008907 | 3300006914 | Bacteria | 6869 |
| 89 | Ga0075436_100038842 | 3300006914 | Bacteria | 3285 |
| 90 | Ga0075436_100737155 | 3300006914 | Unclassified | 731 |
| 91 | Ga0075435_100161120 | 3300007076 | Bacteria | 1890 |
| 92 | Ga0075435_100498008 | 3300007076 | Unclassified | 1053 |
| 93 | Ga0075435_100834196 | 3300007076 | Bacteria | 803 |
| 94 | Ga0099794_10012772 | 3300007265 | Bacteria | 3637 |
| 95 | Ga0099794_10025617 | 3300007265 | Bacteria | 2720 |
| 96 | Ga0099794_10048299 | 3300007265 | Bacteria | 2043 |
| 97 | Ga0099794_10365498 | 3300007265 | Archaea | 752 |
| 98 | Ga0099795_10002701 | 3300007788 | Unclassified | 4239 |
| 99 | Ga0099795_10031723 | 3300007788 | Unclassified | 1822 |
| 100 | Ga0105240_10426997 | 3300009093 | Bacteria | 1488 |
| 101 | Ga0111539_10669431 | 3300009094 | Bacteria | 1209 |
| 102 | Ga0105243_10201343 | 3300009148 | Bacteria | 1746 |
| 103 | Ga0105241_10069231 | 3300009174 | Bacteria | 2736 |
| 104 | Ga0105241_10184143 | 3300009174 | Unclassified | 1734 |
| 105 | Ga0105241_10271666 | 3300009174 | Bacteria | 1445 |
| 106 | Ga0105242_10432710 | 3300009176 | Unclassified | 1236 |
| 107 | Ga0105248_10394796 | 3300009177 | Bacteria | 1558 |
| 108 | Ga0105248_10595104 | 3300009177 | Unclassified | 1248 |
| 109 | Ga0105248_11031123 | 3300009177 | Bacteria | 929 |
| 110 | Ga0105238_10408915 | 3300009551 | Bacteria | 1351 |
| 111 | Ga0105238_10889372 | 3300009551 | Unclassified | 909 |
| 112 | Ga0099796_10093774 | 3300010159 | Bacteria | 1119 |
| 113 | Ga0099796_10232243 | 3300010159 | Unclassified | 760 |
| 114 | Ga0157369_10170109 | 3300013105 | Bacteria | 2296 |
| 115 | Ga0157378_10112324 | 3300013297 | Bacteria | 2499 |
| 116 | Ga0157372_11241603 | 3300013307 | Bacteria | 861 |
| 117 | Ga0157375_10680412 | 3300013308 | Unclassified | 1183 |
| 118 | Ga0157376_10001896 | 3300014969 | Bacteria | 13962 |
| 119 | Ga0213872_10002468 | 3300021361 | Bacteria | 10843 |
| 120 | Ga0213872_10192263 | 3300021361 | Bacteria | 878 |
| 121 | Ga0213871_10014786 | 3300021441 | Bacteria | 1857 |
| 122 | Ga0207692_10130885 | 3300025898 | Bacteria | 1417 |
| 123 | Ga0207685_10108379 | 3300025905 | Bacteria | 1200 |
| 124 | Ga0207699_10000010 | 3300025906 | Bacteria | 295869 |
| 125 | Ga0207699_10006589 | 3300025906 | Bacteria | 5636 |
| 126 | Ga0207699_10008371 | 3300025906 | Bacteria | 5100 |
| 127 | Ga0207699_10066905 | 3300025906 | Bacteria | 2183 |
| 128 | Ga0207684_10067732 | 3300025910 | Bacteria | 3034 |
| 129 | Ga0207684_10204006 | 3300025910 | Bacteria | 1706 |
| 130 | Ga0207684_10233809 | 3300025910 | Bacteria | 1586 |
| 131 | Ga0207684_10256328 | 3300025910 | Unclassified | 1509 |
| 132 | Ga0207684_10343059 | 3300025910 | Unclassified | 1286 |
| 133 | Ga0207684_10835576 | 3300025910 | Bacteria | 777 |
| 134 | Ga0207707_10019684 | 3300025912 | Bacteria | 5891 |
| 135 | Ga0207695_10203607 | 3300025913 | Bacteria | 1892 |
| 136 | Ga0207693_10067987 | 3300025915 | Bacteria | 2789 |
| 137 | Ga0207693_10082364 | 3300025915 | Bacteria | 2520 |
| 138 | Ga0207693_10407121 | 3300025915 | Unclassified | 1063 |
| 139 | Ga0207693_10422720 | 3300025915 | Bacteria | 1042 |
| 140 | Ga0207663_10041654 | 3300025916 | Bacteria | 2800 |
| 141 | Ga0207663_10426475 | 3300025916 | Bacteria | 1019 |
| 142 | Ga0207660_10174366 | 3300025917 | Unclassified | 1667 |
| 143 | Ga0207652_10269598 | 3300025921 | Bacteria | 1535 |
| 144 | Ga0207646_10002439 | 3300025922 | Bacteria | 21937 |
| 145 | Ga0207646_10191684 | 3300025922 | Bacteria | 1846 |
| 146 | Ga0207694_10106235 | 3300025924 | Bacteria | 2230 |
| 147 | Ga0207700_10002775 | 3300025928 | Bacteria | 10092 |
| 148 | Ga0207700_10288635 | 3300025928 | Bacteria | 1413 |
| 149 | Ga0207664_10007135 | 3300025929 | Bacteria | 7747 |
| 150 | Ga0207664_10029824 | 3300025929 | Bacteria | 4159 |
| 151 | Ga0207664_10394394 | 3300025929 | Bacteria | 1230 |
| 152 | Ga0207686_10133886 | 3300025934 | Bacteria | 1704 |
| 153 | Ga0207665_10000008 | 3300025939 | Bacteria | 173434 |
| 154 | Ga0207665_10000589 | 3300025939 | Bacteria | 24479 |
| 155 | Ga0207665_10028038 | 3300025939 | Bacteria | 3719 |
| 156 | Ga0207665_10030970 | 3300025939 | Unclassified | 3539 |
| 157 | Ga0207665_10045082 | 3300025939 | Bacteria | 2952 |
| 158 | Ga0207665_10068469 | 3300025939 | Bacteria | 2419 |
| 159 | Ga0207665_10241249 | 3300025939 | Bacteria | 1332 |
| 160 | Ga0207665_10648663 | 3300025939 | Unclassified | 827 |
| 161 | Ga0207661_10022249 | 3300025944 | Bacteria | 4769 |
| 162 | Ga0207667_11310204 | 3300025949 | Unclassified | 700 |
| 163 | Ga0207677_10458552 | 3300026023 | Unclassified | 1093 |
| 164 | Ga0207639_10066309 | 3300026041 | Unclassified | 2805 |
| 165 | Ga0209179_1036560 | 3300027512 | Unclassified | 1023 |
| 166 | Ga0209588_1011747 | 3300027671 | Unclassified | 2650 |
| 167 | Ga0209588_1022672 | 3300027671 | Bacteria | 1976 |
| 168 | Ga0209588_1026797 | 3300027671 | Bacteria | 1832 |
| 169 | Ga0268266_10000657 | 3300028379 | Bacteria | 46799 |
| 170 | Ga0268266_10307439 | 3300028379 | Unclassified | 1481 |
| 171 | Ga0265760_10046751 | 3300031090 | Unclassified | 1299 |
| 172 | Ga0373926_0025500 | 3300035083 | Bacteria | 2064 |
| 173 | Ga0373926_0100654 | 3300035083 | Bacteria | 1081 |
| 174 | Ga0373926_0133272 | 3300035083 | Unclassified | 941 |
| 175 | Ga0373934_0023248 | 3300035086 | Bacteria | 2395 |
| 176 | Ga0373934_0028647 | 3300035086 | Unclassified | 2173 |
| 177 | Ga0373944_0014732 | 3300035089 | Bacteria | 2186 |
| 178 | Ga0373923_0044033 | 3300035111 | Bacteria | 1849 |
| 179 | Ga0373923_0079051 | 3300035111 | Bacteria | 1424 |
| 180 | Ga0373923_0130116 | 3300035111 | Unclassified | 1130 |
| 181 | Ga0373936_0042476 | 3300035113 | Bacteria | 1825 |
| 182 | Ga0373945_0016942 | 3300035116 | Bacteria | 2465 |
| 183 | Ga0373945_0105309 | 3300035116 | Unclassified | 1108 |
| 184 | Ga0373945_0283640 | 3300035116 | Unclassified | 706 |
| 185 | Ga0373953_0002382 | 3300035117 | Bacteria | 5677 |
| 186 | Ga0373953_0111589 | 3300035117 | Bacteria | 1156 |
| 187 | Ga0373953_0241930 | 3300035117 | Unclassified | 783 |
| 188 | Ga0373954_0000077 | 3300035118 | Bacteria | 34839 |
| 189 | Ga0373954_0016625 | 3300035118 | Unclassified | 3296 |
| 190 | Ga0373956_0003594 | 3300035119 | Bacteria | 6256 |
| 191 | Ga0373956_0046208 | 3300035119 | Bacteria | 1944 |
| 192 | Ga0373956_0108449 | 3300035119 | Bacteria | 1291 |
| 193 | Ga0373957_0011212 | 3300035120 | Bacteria | 2985 |
| 194 | Ga0373943_0005634 | 3300035170 | Bacteria | 5619 |
| 195 | Ga0373946_0006964 | 3300035171 | Bacteria | 4119 |
| 196 | Ga0373946_0011140 | 3300035171 | Bacteria | 3347 |
| 197 | Ga0373946_0083890 | 3300035171 | Bacteria | 1400 |
| 198 | Ga0373955_0008432 | 3300035172 | Bacteria | 4787 |
| 199 | Ga0373955_0026088 | 3300035172 | Bacteria | 3006 |
| 200 | Ga0373955_0076161 | 3300035172 | Bacteria | 1887 |
| 201 | Ga0373924_0000270 | 3300035410 | Bacteria | 15909 |
| 202 | Ga0373924_0084246 | 3300035410 | Bacteria | 1355 |
| 203 | Ga0373935_0006289 | 3300035692 | Bacteria | 7074 |
| 204 | Ga0373935_0077136 | 3300035692 | Bacteria | 2159 |
| 205 | Ga0373935_0116952 | 3300035692 | Bacteria | 1776 |
| 206 | Ga0373935_0208442 | 3300035692 | Bacteria | 1353 |
| 207 | Ga0373935_0287672 | 3300035692 | Unclassified | 1158 |
| 208 | Ga0373927_0014358 | 3300035695 | Bacteria | 5244 |
| 209 | Ga0373927_0019916 | 3300035695 | Unclassified | 4399 |
| 210 | Ga0373927_0034473 | 3300035695 | Bacteria | 3292 |
| 211 | Ga0373927_0081665 | 3300035695 | Bacteria | 2095 |
| 212 | Ga0373927_0082446 | 3300035695 | Unclassified | 2085 |
| 213 | Ga0373933_0044158 | 3300035724 | Bacteria | 2639 |
| 214 | Ga0373933_0073109 | 3300035724 | Unclassified | 2089 |
| 215 | Ga0373947_0004202 | 3300035725 | Bacteria | 8446 |
| 216 | Ga0373947_0093168 | 3300035725 | Bacteria | 1882 |
| 217 | Ga0373937_0050461 | 3300036401 | Bacteria | 3811 |
| 218 | Ga0373937_0094296 | 3300036401 | Unclassified | 2775 |
| 219 | Ga0373925_0011032 | 3300037068 | Bacteria | 6561 |
| 220 | Ga0373925_0034833 | 3300037068 | Unclassified | 3712 |
| 221 | Ga0373925_0120356 | 3300037068 | Bacteria | 2037 |
| 222 | Ga0373925_1168137 | 3300037068 | Unclassified | 633 |
| 223 | Ga0395905_0019920 | 3300037471 | Bacteria | 6357 |
| 224 | Ga0395905_0034428 | 3300037471 | Bacteria | 4756 |
| 225 | Ga0395905_0044458 | 3300037471 | Unclassified | 4169 |
| 226 | Ga0395905_0057296 | 3300037471 | Bacteria | 3645 |
| 227 | Ga0436364_1152167 | 3300037853 | Bacteria | 1431 |
| 228 | Ga0395901_0404254 | 3300038443 | Bacteria | 1403 |
| 229 | Ga0395901_0605043 | 3300038443 | Bacteria | 1105 |
| 230 | Ga0436360_0117297 | 3300039438 | Bacteria | 1793 |
| 231 | Ga0436360_0338476 | 3300039438 | Bacteria | 1729 |
| 232 | Ga0436360_0936714 | 3300039438 | Bacteria | 2996 |
| 233 | Ga0436361_0608005 | 3300039447 | Bacteria | 15128 |
| 234 | Ga0436361_0652690 | 3300039447 | Bacteria | 39906 |
| 235 | Ga0436361_1195118 | 3300039447 | Bacteria | 2081 |
| 236 | Ga0436361_1207841 | 3300039447 | Bacteria | 2082 |
| 237 | Ga0436363_0470616 | 3300039450 | Unclassified | 931 |
| 238 | Ga0436363_0540430 | 3300039450 | Bacteria | 5520 |
| 239 | Ga0466972_0321645 | 3300044658 | Bacteria | 723 |
| 240 | Ga0453683_0010010 | 3300044673 | Bacteria | 6307 |
| 241 | Ga0453684_1142071 | 3300044712 | Unclassified | 821 |
| 242 | Ga0451576_0029141 | 3300045051 | Bacteria | 5908 |
| 243 | Ga0451576_1337595 | 3300045051 | Unclassified | 746 |
| 244 | Ga0495603_0023259 | 3300046455 | Bacteria | 3752 |
| 245 | Ga0495651_0220214 | 3300046462 | Bacteria | 1314 |
| 246 | Ga0495651_0546513 | 3300046462 | Unclassified | 736 |
| 247 | Ga0495653_0344719 | 3300046463 | Unclassified | 959 |
| 248 | Ga0495580_0026534 | 3300046472 | Bacteria | 4223 |
| 249 | Ga0495580_0065284 | 3300046472 | Unclassified | 2549 |
| 250 | Ga0495580_0155003 | 3300046472 | Bacteria | 1586 |
| 251 | Ga0495580_0870379 | 3300046472 | Unclassified | 581 |
| 252 | Ga0495582_0043382 | 3300046473 | Bacteria | 2477 |
| 253 | Ga0495639_0048876 | 3300046475 | Bacteria | 1919 |
| 254 | Ga0495639_0123966 | 3300046475 | Unclassified | 1234 |
| 255 | Ga0495630_0318985 | 3300046517 | Bacteria | 1188 |
| 256 | Ga0495630_0362533 | 3300046517 | Unclassified | 1109 |
| 257 | Ga0495666_0007594 | 3300046526 | Bacteria | 5425 |
| 258 | Ga0495665_0027016 | 3300046531 | Unclassified | 3082 |
| 259 | Ga0495665_0077267 | 3300046531 | Bacteria | 1752 |
| 260 | Ga0495665_0323051 | 3300046531 | Unclassified | 788 |
| 261 | Ga0495587_0013391 | 3300046536 | Bacteria | 5156 |
| 262 | Ga0495667_0070981 | 3300046559 | Bacteria | 2272 |
| 263 | Ga0495667_0187485 | 3300046559 | Bacteria | 1326 |
| 264 | Ga0495634_0243579 | 3300046642 | Unclassified | 1102 |
| 265 | Ga0495635_0037181 | 3300046663 | Unclassified | 3371 |
| 266 | Ga0495635_0683990 | 3300046663 | Unclassified | 666 |
| 267 | Ga0495623_0016117 | 3300046679 | Bacteria | 4829 |
| 268 | Ga0495647_0006647 | 3300046681 | Bacteria | 3840 |
| 269 | Ga0495658_0008530 | 3300046683 | Bacteria | 5082 |
| 270 | Ga0495613_0208380 | 3300046689 | Bacteria | 1375 |
| 271 | Ga0495624_0093825 | 3300046690 | Bacteria | 1850 |
| 272 | Ga0495604_0023830 | 3300047317 | Bacteria | 4885 |
| 273 | Ga0495604_0156195 | 3300047317 | Bacteria | 1616 |
| 274 | Ga0495674_0081282 | 3300047319 | Bacteria | 2780 |
| 275 | Ga0495684_0025414 | 3300047471 | Unclassified | 4551 |
| 276 | Ga0495684_0032373 | 3300047471 | Bacteria | 4014 |
| 277 | Ga0495684_0130818 | 3300047471 | Bacteria | 1885 |
| 278 | Ga0495593_0085761 | 3300047673 | Unclassified | 1625 |
| 279 | Ga0495602_0007881 | 3300048088 | Bacteria | 11134 |
| 280 | Ga0495602_0045368 | 3300048088 | Unclassified | 3978 |
| 281 | Ga0495602_0351124 | 3300048088 | Bacteria | 1064 |
| 282 | Ga0495614_0258604 | 3300048089 | Unclassified | 798 |
| 283 | Ga0496104_0056870 | 3300048907 | Bacteria | 3701 |
| 284 | Ga0496104_1755551 | 3300048907 | Unclassified | 523 |
| 285 | Ga0496107_0406770 | 3300048910 | Unclassified | 1012 |
| 286 | Ga0496110_0126458 | 3300048913 | Bacteria | 2306 |
| 287 | Ga0496111_0001840 | 3300048914 | Bacteria | 12500 |
| 288 | Ga0496112_0057999 | 3300048915 | Bacteria | 3812 |
| 289 | Ga0496113_0000605 | 3300048916 | Bacteria | 17890 |
| 290 | Ga0496114_0316290 | 3300048917 | Unclassified | 1379 |
| 291 | Ga0496115_0004843 | 3300048918 | Bacteria | 9770 |
| 292 | nmdc:mga0n895_1346034_c1 | 3300050512 | Unclassified | 684 |
| 293 | nmdc:mga0n895_150703_c1 | 3300050512 | Bacteria | 2356 |
| 294 | nmdc:mga0n895_24785_c1 | 3300050512 | Bacteria | 5658 |
| 295 | nmdc:mga0n895_484518_c1 | 3300050512 | Bacteria | 1247 |
| 296 | nmdc:mga0n895_56328_c1 | 3300050512 | Bacteria | 3872 |
| 297 | nmdc:mga0rr50_355654_c1 | 3300050513 | Bacteria | 1232 |
| 298 | nmdc:mga0rr50_489407_c1 | 3300050513 | Unclassified | 1045 |
| 299 | nmdc:mga0rr50_73876_c1 | 3300050513 | Bacteria | 2608 |
| 300 | nmdc:mga08x19_10017_c1 | 3300050514 | Bacteria | 5682 |
| 301 | nmdc:mga08x19_1522_c1 | 3300050514 | Bacteria | 14366 |
| 302 | nmdc:mga08x19_19172_c1 | 3300050514 | Unclassified | 4196 |
| 303 | nmdc:mga08x19_597784_c1 | 3300050514 | Unclassified | 782 |
| 304 | nmdc:mga08x19_641465_c1 | 3300050514 | Unclassified | 753 |
| 305 | Ga0495601_0000524 | 3300053077 | Bacteria | 20280 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048907 | Ga0496104_1755551 | Ga0496104_1755551_27_482 | 151 |
| 2 | 3300048910 | Ga0496107_0406770 | Ga0496107_0406770_485_940 | 151 |
| 3 | 3300037068 | Ga0373925_1168137 | Ga0373925_1168137_145_615 | 156 |
| 4 | 3300046689 | Ga0495613_0208380 | Ga0495613_0208380_57_527 | 156 |
| 5 | 3300044712 | Ga0453684_1142071 | Ga0453684_1142071_193_672 | 159 |
| 6 | 3300037471 | Ga0395905_0057296 | Ga0395905_0057296_267_845 | 163 |
| 7 | 3300038443 | Ga0395901_0605043 | Ga0395901_0605043_309_887 | 163 |
| 8 | 3300037471 | Ga0395905_0019920 | Ga0395905_0019920_4460_4960 | 164 |
| 9 | 3300037471 | Ga0395905_0034428 | Ga0395905_0034428_3036_3620 | 164 |
| 10 | 3300038443 | Ga0395901_0404254 | Ga0395901_0404254_339_923 | 164 |
| 11 | 3300044658 | Ga0466972_0321645 | Ga0466972_0321645_49_609 | 164 |
| 12 | 3300006173 | Ga0070716_100016314 | Ga0070716_1000163143 | 170 |
| 13 | 3300025939 | Ga0207665_10028038 | Ga0207665_100280383 | 170 |
| 14 | 3300005356 | Ga0070674_100094155 | Ga0070674_1000941553 | 171 |
| 15 | 3300028379 | Ga0268266_10307439 | Ga0268266_103074392 | 171 |
| 16 | 3300005329 | Ga0070683_100081361 | Ga0070683_1000813612 | 172 |
| 17 | 3300005336 | Ga0070680_100306115 | Ga0070680_1003061151 | 172 |
| 18 | 3300005458 | Ga0070681_10785857 | Ga0070681_107858571 | 172 |
| 19 | 3300005530 | Ga0070679_100175125 | Ga0070679_1001751252 | 172 |
| 20 | 3300005539 | Ga0068853_100049036 | Ga0068853_1000490363 | 172 |
| 21 | 3300005563 | Ga0068855_100675040 | Ga0068855_1006750401 | 172 |
| 22 | 3300005616 | Ga0068852_100594328 | Ga0068852_1005943281 | 172 |
| 23 | 3300009093 | Ga0105240_10426997 | Ga0105240_104269972 | 172 |
| 24 | 3300009174 | Ga0105241_10271666 | Ga0105241_102716661 | 172 |
| 25 | 3300009551 | Ga0105238_10408915 | Ga0105238_104089152 | 172 |
| 26 | 3300013105 | Ga0157369_10170109 | Ga0157369_101701093 | 172 |
| 27 | 3300025913 | Ga0207695_10203607 | Ga0207695_102036072 | 172 |
| 28 | 3300025917 | Ga0207660_10174366 | Ga0207660_101743662 | 172 |
| 29 | 3300025921 | Ga0207652_10269598 | Ga0207652_102695982 | 172 |
| 30 | 3300025924 | Ga0207694_10106235 | Ga0207694_101062352 | 172 |
| 31 | 3300025929 | Ga0207664_10394394 | Ga0207664_103943941 | 172 |
| 32 | 3300025944 | Ga0207661_10022249 | Ga0207661_100222492 | 172 |
| 33 | 3300026023 | Ga0207677_10458552 | Ga0207677_104585521 | 172 |
| 34 | 3300026041 | Ga0207639_10066309 | Ga0207639_100663092 | 172 |
| 35 | 3300048915 | Ga0496112_0057999 | Ga0496112_0057999_2317_2865 | 172 |
| 36 | 3300035083 | Ga0373926_0025500 | Ga0373926_0025500_223_747 | 173 |
| 37 | 3300035086 | Ga0373934_0028647 | Ga0373934_0028647_757_1281 | 173 |
| 38 | 3300035111 | Ga0373923_0079051 | Ga0373923_0079051_24_548 | 173 |
| 39 | 3300035117 | Ga0373953_0241930 | Ga0373953_0241930_98_622 | 173 |
| 40 | 3300035118 | Ga0373954_0016625 | Ga0373954_0016625_1278_1802 | 173 |
| 41 | 3300035171 | Ga0373946_0083890 | Ga0373946_0083890_235_759 | 173 |
| 42 | 3300035172 | Ga0373955_0076161 | Ga0373955_0076161_1164_1688 | 173 |
| 43 | 3300035692 | Ga0373935_0077136 | Ga0373935_0077136_47_571 | 173 |
| 44 | 3300035695 | Ga0373927_0019916 | Ga0373927_0019916_1387_1911 | 173 |
| 45 | 3300035724 | Ga0373933_0073109 | Ga0373933_0073109_1218_1742 | 173 |
| 46 | 3300036401 | Ga0373937_0094296 | Ga0373937_0094296_748_1272 | 173 |
| 47 | 3300037068 | Ga0373925_0034833 | Ga0373925_0034833_2355_2879 | 173 |
| 48 | 3300046462 | Ga0495651_0220214 | Ga0495651_0220214_381_920 | 173 |
| 49 | 3300046463 | Ga0495653_0344719 | Ga0495653_0344719_320_844 | 173 |
| 50 | 3300046472 | Ga0495580_0065284 | Ga0495580_0065284_1288_1812 | 173 |
| 51 | 3300046531 | Ga0495665_0027016 | Ga0495665_0027016_1257_1781 | 173 |
| 52 | 3300046663 | Ga0495635_0037181 | Ga0495635_0037181_1631_2155 | 173 |
| 53 | 3300047319 | Ga0495674_0081282 | Ga0495674_0081282_227_751 | 173 |
| 54 | 3300047471 | Ga0495684_0025414 | Ga0495684_0025414_2621_3145 | 173 |
| 55 | 3300048088 | Ga0495602_0045368 | Ga0495602_0045368_1654_2178 | 173 |
| 56 | 3300005467 | Ga0070706_100062888 | Ga0070706_1000628882 | 174 |
| 57 | 3300005471 | Ga0070698_101030352 | Ga0070698_1010303522 | 174 |
| 58 | 3300005545 | Ga0070695_100020592 | Ga0070695_1000205921 | 174 |
| 59 | 3300005549 | Ga0070704_100019311 | Ga0070704_1000193115 | 174 |
| 60 | 3300025910 | Ga0207684_10343059 | Ga0207684_103430592 | 174 |
| 61 | 3300050512 | nmdc:mga0n895_56328_c1 | nmdc:mga0n895_56328_c1_1057_1590 | 174 |
| 62 | 3300039447 | Ga0436361_0652690 | Ga0436361_0652690_12334_12861 | 175 |
| 63 | 3300044673 | Ga0453683_0010010 | Ga0453683_0010010_5120_5647 | 175 |
| 64 | 3300045051 | Ga0451576_0029141 | Ga0451576_0029141_443_970 | 175 |
| 65 | 3300005434 | Ga0070709_10013598 | Ga0070709_100135982 | 177 |
| 66 | 3300005434 | Ga0070709_10020696 | Ga0070709_100206962 | 177 |
| 67 | 3300005434 | Ga0070709_10292507 | Ga0070709_102925072 | 177 |
| 68 | 3300005436 | Ga0070713_100026895 | Ga0070713_1000268955 | 177 |
| 69 | 3300005436 | Ga0070713_100338288 | Ga0070713_1003382882 | 177 |
| 70 | 3300005437 | Ga0070710_10401086 | Ga0070710_104010861 | 177 |
| 71 | 3300005445 | Ga0070708_100012421 | Ga0070708_1000124211 | 177 |
| 72 | 3300005445 | Ga0070708_100017913 | Ga0070708_1000179137 | 177 |
| 73 | 3300005467 | Ga0070706_100302020 | Ga0070706_1003020202 | 177 |
| 74 | 3300005468 | Ga0070707_100006912 | Ga0070707_1000069121 | 177 |
| 75 | 3300005468 | Ga0070707_100423380 | Ga0070707_1004233802 | 177 |
| 76 | 3300005471 | Ga0070698_100522460 | Ga0070698_1005224601 | 177 |
| 77 | 3300005518 | Ga0070699_100569381 | Ga0070699_1005693811 | 177 |
| 78 | 3300005536 | Ga0070697_100003251 | Ga0070697_1000032515 | 177 |
| 79 | 3300005536 | Ga0070697_100083101 | Ga0070697_1000831012 | 177 |
| 80 | 3300005536 | Ga0070697_100239692 | Ga0070697_1002396921 | 177 |
| 81 | 3300005545 | Ga0070695_100137104 | Ga0070695_1001371042 | 177 |
| 82 | 3300006173 | Ga0070716_100001913 | Ga0070716_10000191310 | 177 |
| 83 | 3300006173 | Ga0070716_100050009 | Ga0070716_1000500093 | 177 |
| 84 | 3300006173 | Ga0070716_100059707 | Ga0070716_1000597071 | 177 |
| 85 | 3300006173 | Ga0070716_100134918 | Ga0070716_1001349182 | 177 |
| 86 | 3300006175 | Ga0070712_100334326 | Ga0070712_1003343262 | 177 |
| 87 | 3300006914 | Ga0075436_100006061 | Ga0075436_1000060616 | 177 |
| 88 | 3300006914 | Ga0075436_100038842 | Ga0075436_1000388422 | 177 |
| 89 | 3300025906 | Ga0207699_10006589 | Ga0207699_100065892 | 177 |
| 90 | 3300025906 | Ga0207699_10008371 | Ga0207699_100083716 | 177 |
| 91 | 3300025910 | Ga0207684_10067732 | Ga0207684_100677323 | 177 |
| 92 | 3300025910 | Ga0207684_10233809 | Ga0207684_102338092 | 177 |
| 93 | 3300025910 | Ga0207684_10256328 | Ga0207684_102563282 | 177 |
| 94 | 3300025922 | Ga0207646_10002439 | Ga0207646_100024392 | 177 |
| 95 | 3300025928 | Ga0207700_10288635 | Ga0207700_102886352 | 177 |
| 96 | 3300025939 | Ga0207665_10000589 | Ga0207665_1000058911 | 177 |
| 97 | 3300025939 | Ga0207665_10030970 | Ga0207665_100309703 | 177 |
| 98 | 3300025939 | Ga0207665_10241249 | Ga0207665_102412492 | 177 |
| 99 | 3300025939 | Ga0207665_10648663 | Ga0207665_106486631 | 177 |
| 100 | 3300035695 | Ga0373927_0082446 | Ga0373927_0082446_217_819 | 177 |
| 101 | 3300037853 | Ga0436364_1152167 | Ga0436364_1152167_204_737 | 177 |
| 102 | 3300050514 | nmdc:mga08x19_19172_c1 | nmdc:mga08x19_19172_c1_1199_1783 | 177 |
| 103 | 3300050514 | nmdc:mga08x19_597784_c1 | nmdc:mga08x19_597784_c1_217_753 | 177 |
| 104 | 3300005436 | Ga0070713_100547058 | Ga0070713_1005470582 | 178 |
| 105 | 3300005439 | Ga0070711_100364340 | Ga0070711_1003643402 | 178 |
| 106 | 3300005445 | Ga0070708_100333197 | Ga0070708_1003331973 | 178 |
| 107 | 3300005466 | Ga0070685_10151009 | Ga0070685_101510092 | 178 |
| 108 | 3300005539 | Ga0068853_100608160 | Ga0068853_1006081602 | 178 |
| 109 | 3300005548 | Ga0070665_100022117 | Ga0070665_1000221171 | 178 |
| 110 | 3300005841 | Ga0068863_100156088 | Ga0068863_1001560883 | 178 |
| 111 | 3300006173 | Ga0070716_100403270 | Ga0070716_1004032702 | 178 |
| 112 | 3300006871 | Ga0075434_100723644 | Ga0075434_1007236442 | 178 |
| 113 | 3300007076 | Ga0075435_100498008 | Ga0075435_1004980081 | 178 |
| 114 | 3300007788 | Ga0099795_10031723 | Ga0099795_100317233 | 178 |
| 115 | 3300009177 | Ga0105248_10394796 | Ga0105248_103947962 | 178 |
| 116 | 3300009177 | Ga0105248_11031123 | Ga0105248_110311232 | 178 |
| 117 | 3300009551 | Ga0105238_10889372 | Ga0105238_108893722 | 178 |
| 118 | 3300010159 | Ga0099796_10232243 | Ga0099796_102322431 | 178 |
| 119 | 3300014969 | Ga0157376_10001896 | Ga0157376_100018969 | 178 |
| 120 | 3300025906 | Ga0207699_10066905 | Ga0207699_100669052 | 178 |
| 121 | 3300025916 | Ga0207663_10426475 | Ga0207663_104264752 | 178 |
| 122 | 3300027512 | Ga0209179_1036560 | Ga0209179_10365601 | 178 |
| 123 | 3300028379 | Ga0268266_10000657 | Ga0268266_1000065728 | 178 |
| 124 | 3300035083 | Ga0373926_0133272 | Ga0373926_0133272_231_773 | 178 |
| 125 | 3300035089 | Ga0373944_0014732 | Ga0373944_0014732_1414_1956 | 178 |
| 126 | 3300035111 | Ga0373923_0130116 | Ga0373923_0130116_390_932 | 178 |
| 127 | 3300035113 | Ga0373936_0042476 | Ga0373936_0042476_329_871 | 178 |
| 128 | 3300035116 | Ga0373945_0016942 | Ga0373945_0016942_1293_1835 | 178 |
| 129 | 3300035116 | Ga0373945_0105309 | Ga0373945_0105309_526_1068 | 178 |
| 130 | 3300035116 | Ga0373945_0283640 | Ga0373945_0283640_62_598 | 178 |
| 131 | 3300035170 | Ga0373943_0005634 | Ga0373943_0005634_4657_5199 | 178 |
| 132 | 3300035171 | Ga0373946_0006964 | Ga0373946_0006964_2871_3413 | 178 |
| 133 | 3300035171 | Ga0373946_0011140 | Ga0373946_0011140_2534_3076 | 178 |
| 134 | 3300035410 | Ga0373924_0000270 | Ga0373924_0000270_7533_8075 | 178 |
| 135 | 3300035692 | Ga0373935_0006289 | Ga0373935_0006289_417_959 | 178 |
| 136 | 3300035692 | Ga0373935_0116952 | Ga0373935_0116952_1160_1702 | 178 |
| 137 | 3300035695 | Ga0373927_0014358 | Ga0373927_0014358_3826_4368 | 178 |
| 138 | 3300035695 | Ga0373927_0034473 | Ga0373927_0034473_197_739 | 178 |
| 139 | 3300035725 | Ga0373947_0004202 | Ga0373947_0004202_4073_4615 | 178 |
| 140 | 3300035725 | Ga0373947_0093168 | Ga0373947_0093168_467_1009 | 178 |
| 141 | 3300037068 | Ga0373925_0011032 | Ga0373925_0011032_322_864 | 178 |
| 142 | 3300039450 | Ga0436363_0540430 | Ga0436363_0540430_4659_5201 | 178 |
| 143 | 3300046455 | Ga0495603_0023259 | Ga0495603_0023259_2323_2859 | 178 |
| 144 | 3300046472 | Ga0495580_0026534 | Ga0495580_0026534_2668_3204 | 178 |
| 145 | 3300046472 | Ga0495580_0155003 | Ga0495580_0155003_718_1260 | 178 |
| 146 | 3300046473 | Ga0495582_0043382 | Ga0495582_0043382_1484_2020 | 178 |
| 147 | 3300046475 | Ga0495639_0048876 | Ga0495639_0048876_361_903 | 178 |
| 148 | 3300046475 | Ga0495639_0123966 | Ga0495639_0123966_164_706 | 178 |
| 149 | 3300046517 | Ga0495630_0362533 | Ga0495630_0362533_246_782 | 178 |
| 150 | 3300046526 | Ga0495666_0007594 | Ga0495666_0007594_1101_1637 | 178 |
| 151 | 3300046531 | Ga0495665_0077267 | Ga0495665_0077267_1033_1575 | 178 |
| 152 | 3300046531 | Ga0495665_0323051 | Ga0495665_0323051_148_690 | 178 |
| 153 | 3300046642 | Ga0495634_0243579 | Ga0495634_0243579_140_676 | 178 |
| 154 | 3300046681 | Ga0495647_0006647 | Ga0495647_0006647_1481_2017 | 178 |
| 155 | 3300046683 | Ga0495658_0008530 | Ga0495658_0008530_3873_4409 | 178 |
| 156 | 3300046690 | Ga0495624_0093825 | Ga0495624_0093825_418_954 | 178 |
| 157 | 3300047471 | Ga0495684_0130818 | Ga0495684_0130818_1100_1636 | 178 |
| 158 | 3300047673 | Ga0495593_0085761 | Ga0495593_0085761_356_892 | 178 |
| 159 | 3300048917 | Ga0496114_0316290 | Ga0496114_0316290_150_686 | 178 |
| 160 | 3300048918 | Ga0496115_0004843 | Ga0496115_0004843_3930_4466 | 178 |
| 161 | 3300050512 | nmdc:mga0n895_1346034_c1 | nmdc:mga0n895_1346034_c1_47_583 | 178 |
| 162 | 3300050513 | nmdc:mga0rr50_489407_c1 | nmdc:mga0rr50_489407_c1_70_606 | 178 |
| 163 | 3300005436 | Ga0070713_100342546 | Ga0070713_1003425462 | 179 |
| 164 | 3300005439 | Ga0070711_100064007 | Ga0070711_1000640072 | 179 |
| 165 | 3300005439 | Ga0070711_100189085 | Ga0070711_1001890852 | 179 |
| 166 | 3300005439 | Ga0070711_100575607 | Ga0070711_1005756071 | 179 |
| 167 | 3300005440 | Ga0070705_100257114 | Ga0070705_1002571142 | 179 |
| 168 | 3300005458 | Ga0070681_10006458 | Ga0070681_1000645810 | 179 |
| 169 | 3300005471 | Ga0070698_100003703 | Ga0070698_1000037034 | 179 |
| 170 | 3300005518 | Ga0070699_100029748 | Ga0070699_1000297483 | 179 |
| 171 | 3300005546 | Ga0070696_100093409 | Ga0070696_1000934092 | 179 |
| 172 | 3300006028 | Ga0070717_10097702 | Ga0070717_100977022 | 179 |
| 173 | 3300006028 | Ga0070717_10443702 | Ga0070717_104437022 | 179 |
| 174 | 3300006028 | Ga0070717_10556988 | Ga0070717_105569882 | 179 |
| 175 | 3300006163 | Ga0070715_10078774 | Ga0070715_100787742 | 179 |
| 176 | 3300006163 | Ga0070715_10187449 | Ga0070715_101874492 | 179 |
| 177 | 3300006173 | Ga0070716_100622047 | Ga0070716_1006220472 | 179 |
| 178 | 3300006175 | Ga0070712_100012547 | Ga0070712_1000125472 | 179 |
| 179 | 3300006175 | Ga0070712_100096446 | Ga0070712_1000964462 | 179 |
| 180 | 3300006237 | Ga0097621_100686921 | Ga0097621_1006869212 | 179 |
| 181 | 3300006871 | Ga0075434_100042242 | Ga0075434_1000422423 | 179 |
| 182 | 3300006871 | Ga0075434_100387578 | Ga0075434_1003875782 | 179 |
| 183 | 3300006914 | Ga0075436_100002551 | Ga0075436_1000025518 | 179 |
| 184 | 3300006914 | Ga0075436_100008907 | Ga0075436_1000089075 | 179 |
| 185 | 3300006914 | Ga0075436_100737155 | Ga0075436_1007371551 | 179 |
| 186 | 3300007076 | Ga0075435_100161120 | Ga0075435_1001611204 | 179 |
| 187 | 3300007076 | Ga0075435_100834196 | Ga0075435_1008341961 | 179 |
| 188 | 3300007265 | Ga0099794_10025617 | Ga0099794_100256173 | 179 |
| 189 | 3300007265 | Ga0099794_10048299 | Ga0099794_100482992 | 179 |
| 190 | 3300007265 | Ga0099794_10365498 | Ga0099794_103654981 | 179 |
| 191 | 3300009174 | Ga0105241_10184143 | Ga0105241_101841432 | 179 |
| 192 | 3300010159 | Ga0099796_10093774 | Ga0099796_100937742 | 179 |
| 193 | 3300013307 | Ga0157372_11241603 | Ga0157372_112416032 | 179 |
| 194 | 3300025898 | Ga0207692_10130885 | Ga0207692_101308852 | 179 |
| 195 | 3300025905 | Ga0207685_10108379 | Ga0207685_101083792 | 179 |
| 196 | 3300025910 | Ga0207684_10835576 | Ga0207684_108355762 | 179 |
| 197 | 3300025912 | Ga0207707_10019684 | Ga0207707_100196843 | 179 |
| 198 | 3300025915 | Ga0207693_10067987 | Ga0207693_100679872 | 179 |
| 199 | 3300025915 | Ga0207693_10407121 | Ga0207693_104071212 | 179 |
| 200 | 3300025929 | Ga0207664_10029824 | Ga0207664_100298243 | 179 |
| 201 | 3300025939 | Ga0207665_10045082 | Ga0207665_100450823 | 179 |
| 202 | 3300025939 | Ga0207665_10068469 | Ga0207665_100684692 | 179 |
| 203 | 3300027671 | Ga0209588_1022672 | Ga0209588_10226722 | 179 |
| 204 | 3300027671 | Ga0209588_1026797 | Ga0209588_10267972 | 179 |
| 205 | 3300031090 | Ga0265760_10046751 | Ga0265760_100467512 | 179 |
| 206 | 3300035086 | Ga0373934_0023248 | Ga0373934_0023248_1475_2104 | 179 |
| 207 | 3300035111 | Ga0373923_0044033 | Ga0373923_0044033_439_978 | 179 |
| 208 | 3300035117 | Ga0373953_0002382 | Ga0373953_0002382_657_1286 | 179 |
| 209 | 3300035117 | Ga0373953_0111589 | Ga0373953_0111589_567_1106 | 179 |
| 210 | 3300035118 | Ga0373954_0000077 | Ga0373954_0000077_29023_29652 | 179 |
| 211 | 3300035119 | Ga0373956_0003594 | Ga0373956_0003594_3001_3540 | 179 |
| 212 | 3300035119 | Ga0373956_0046208 | Ga0373956_0046208_1032_1571 | 179 |
| 213 | 3300035119 | Ga0373956_0108449 | Ga0373956_0108449_169_798 | 179 |
| 214 | 3300035120 | Ga0373957_0011212 | Ga0373957_0011212_1147_1776 | 179 |
| 215 | 3300035172 | Ga0373955_0008432 | Ga0373955_0008432_1276_1905 | 179 |
| 216 | 3300035172 | Ga0373955_0026088 | Ga0373955_0026088_70_609 | 179 |
| 217 | 3300035410 | Ga0373924_0084246 | Ga0373924_0084246_353_892 | 179 |
| 218 | 3300035692 | Ga0373935_0208442 | Ga0373935_0208442_286_825 | 179 |
| 219 | 3300035692 | Ga0373935_0287672 | Ga0373935_0287672_417_962 | 179 |
| 220 | 3300035695 | Ga0373927_0081665 | Ga0373927_0081665_215_754 | 179 |
| 221 | 3300035724 | Ga0373933_0044158 | Ga0373933_0044158_1555_2094 | 179 |
| 222 | 3300036401 | Ga0373937_0050461 | Ga0373937_0050461_561_1100 | 179 |
| 223 | 3300037068 | Ga0373925_0120356 | Ga0373925_0120356_748_1392 | 179 |
| 224 | 3300037471 | Ga0395905_0044458 | Ga0395905_0044458_1375_1929 | 179 |
| 225 | 3300039450 | Ga0436363_0470616 | Ga0436363_0470616_129_716 | 179 |
| 226 | 3300045051 | Ga0451576_1337595 | Ga0451576_1337595_90_629 | 179 |
| 227 | 3300046462 | Ga0495651_0546513 | Ga0495651_0546513_20_559 | 179 |
| 228 | 3300046472 | Ga0495580_0870379 | Ga0495580_0870379_17_556 | 179 |
| 229 | 3300046517 | Ga0495630_0318985 | Ga0495630_0318985_177_821 | 179 |
| 230 | 3300046536 | Ga0495587_0013391 | Ga0495587_0013391_4208_4837 | 179 |
| 231 | 3300046559 | Ga0495667_0070981 | Ga0495667_0070981_1010_1654 | 179 |
| 232 | 3300046559 | Ga0495667_0187485 | Ga0495667_0187485_71_610 | 179 |
| 233 | 3300046663 | Ga0495635_0683990 | Ga0495635_0683990_57_596 | 179 |
| 234 | 3300046679 | Ga0495623_0016117 | Ga0495623_0016117_2192_2821 | 179 |
| 235 | 3300047317 | Ga0495604_0023830 | Ga0495604_0023830_589_1218 | 179 |
| 236 | 3300047471 | Ga0495684_0032373 | Ga0495684_0032373_3079_3618 | 179 |
| 237 | 3300048088 | Ga0495602_0007881 | Ga0495602_0007881_3052_3681 | 179 |
| 238 | 3300048089 | Ga0495614_0258604 | Ga0495614_0258604_78_722 | 179 |
| 239 | 3300048907 | Ga0496104_0056870 | Ga0496104_0056870_3004_3549 | 179 |
| 240 | 3300048913 | Ga0496110_0126458 | Ga0496110_0126458_1605_2150 | 179 |
| 241 | 3300048914 | Ga0496111_0001840 | Ga0496111_0001840_2955_3500 | 179 |
| 242 | 3300048916 | Ga0496113_0000605 | Ga0496113_0000605_4785_5333 | 179 |
| 243 | 3300050512 | nmdc:mga0n895_150703_c1 | nmdc:mga0n895_150703_c1_968_1507 | 179 |
| 244 | 3300050512 | nmdc:mga0n895_24785_c1 | nmdc:mga0n895_24785_c1_403_942 | 179 |
| 245 | 3300050512 | nmdc:mga0n895_484518_c1 | nmdc:mga0n895_484518_c1_493_1047 | 179 |
| 246 | 3300050513 | nmdc:mga0rr50_355654_c1 | nmdc:mga0rr50_355654_c1_39_578 | 179 |
| 247 | 3300050513 | nmdc:mga0rr50_73876_c1 | nmdc:mga0rr50_73876_c1_1181_1720 | 179 |
| 248 | 3300050514 | nmdc:mga08x19_10017_c1 | nmdc:mga08x19_10017_c1_1813_2352 | 179 |
| 249 | 3300050514 | nmdc:mga08x19_1522_c1 | nmdc:mga08x19_1522_c1_5764_6303 | 179 |
| 250 | 3300050514 | nmdc:mga08x19_641465_c1 | nmdc:mga08x19_641465_c1_131_676 | 179 |
| 251 | 3300005434 | Ga0070709_10000057 | Ga0070709_100000575 | 180 |
| 252 | 3300005436 | Ga0070713_101220658 | Ga0070713_1012206581 | 180 |
| 253 | 3300005439 | Ga0070711_100110962 | Ga0070711_1001109623 | 180 |
| 254 | 3300005445 | Ga0070708_101276883 | Ga0070708_1012768831 | 180 |
| 255 | 3300005467 | Ga0070706_100171437 | Ga0070706_1001714372 | 180 |
| 256 | 3300005468 | Ga0070707_100324688 | Ga0070707_1003246882 | 180 |
| 257 | 3300005518 | Ga0070699_100356705 | Ga0070699_1003567051 | 180 |
| 258 | 3300005536 | Ga0070697_100369095 | Ga0070697_1003690952 | 180 |
| 259 | 3300006028 | Ga0070717_10720212 | Ga0070717_107202122 | 180 |
| 260 | 3300006173 | Ga0070716_100004009 | Ga0070716_1000040095 | 180 |
| 261 | 3300006173 | Ga0070716_100282184 | Ga0070716_1002821842 | 180 |
| 262 | 3300006175 | Ga0070712_100181426 | Ga0070712_1001814261 | 180 |
| 263 | 3300006175 | Ga0070712_100431414 | Ga0070712_1004314142 | 180 |
| 264 | 3300007265 | Ga0099794_10012772 | Ga0099794_100127723 | 180 |
| 265 | 3300007788 | Ga0099795_10002701 | Ga0099795_100027012 | 180 |
| 266 | 3300009094 | Ga0111539_10669431 | Ga0111539_106694312 | 180 |
| 267 | 3300021361 | Ga0213872_10002468 | Ga0213872_100024688 | 180 |
| 268 | 3300021361 | Ga0213872_10192263 | Ga0213872_101922632 | 180 |
| 269 | 3300025906 | Ga0207699_10000010 | Ga0207699_10000010159 | 180 |
| 270 | 3300025910 | Ga0207684_10204006 | Ga0207684_102040062 | 180 |
| 271 | 3300025915 | Ga0207693_10422720 | Ga0207693_104227202 | 180 |
| 272 | 3300025922 | Ga0207646_10191684 | Ga0207646_101916842 | 180 |
| 273 | 3300025939 | Ga0207665_10000008 | Ga0207665_10000008121 | 180 |
| 274 | 3300027671 | Ga0209588_1011747 | Ga0209588_10117472 | 180 |
| 275 | 3300039438 | Ga0436360_0936714 | Ga0436360_0936714_1063_1605 | 180 |
| 276 | 3300039447 | Ga0436361_0608005 | Ga0436361_0608005_11027_11569 | 180 |
| 277 | 3300047317 | Ga0495604_0156195 | Ga0495604_0156195_615_1160 | 180 |
| 278 | 3300048088 | Ga0495602_0351124 | Ga0495602_0351124_452_997 | 180 |
| 279 | 3300005435 | Ga0070714_100000715 | Ga0070714_1000007156 | 181 |
| 280 | 3300005436 | Ga0070713_100004775 | Ga0070713_1000047752 | 181 |
| 281 | 3300005436 | Ga0070713_100830357 | Ga0070713_1008303571 | 181 |
| 282 | 3300005439 | Ga0070711_100018451 | Ga0070711_1000184512 | 181 |
| 283 | 3300005718 | Ga0068866_10246780 | Ga0068866_102467802 | 181 |
| 284 | 3300006028 | Ga0070717_10019871 | Ga0070717_100198712 | 181 |
| 285 | 3300009148 | Ga0105243_10201343 | Ga0105243_102013432 | 181 |
| 286 | 3300009176 | Ga0105242_10432710 | Ga0105242_104327101 | 181 |
| 287 | 3300009177 | Ga0105248_10595104 | Ga0105248_105951041 | 181 |
| 288 | 3300013297 | Ga0157378_10112324 | Ga0157378_101123242 | 181 |
| 289 | 3300013308 | Ga0157375_10680412 | Ga0157375_106804122 | 181 |
| 290 | 3300021441 | Ga0213871_10014786 | Ga0213871_100147862 | 181 |
| 291 | 3300025915 | Ga0207693_10082364 | Ga0207693_100823642 | 181 |
| 292 | 3300025916 | Ga0207663_10041654 | Ga0207663_100416542 | 181 |
| 293 | 3300025928 | Ga0207700_10002775 | Ga0207700_100027753 | 181 |
| 294 | 3300025929 | Ga0207664_10007135 | Ga0207664_100071358 | 181 |
| 295 | 3300025934 | Ga0207686_10133886 | Ga0207686_101338863 | 181 |
| 296 | 3300035083 | Ga0373926_0100654 | Ga0373926_0100654_269_814 | 181 |
| 297 | 3300039438 | Ga0436360_0117297 | Ga0436360_0117297_910_1455 | 181 |
| 298 | 3300039438 | Ga0436360_0338476 | Ga0436360_0338476_446_991 | 181 |
| 299 | 3300039447 | Ga0436361_1195118 | Ga0436361_1195118_647_1192 | 181 |
| 300 | 3300039447 | Ga0436361_1207841 | Ga0436361_1207841_648_1193 | 181 |
| 301 | 3300053077 | Ga0495601_0000524 | Ga0495601_0000524_10331_10885 | 181 |
| 302 | 3300005327 | Ga0070658_10534539 | Ga0070658_105345391 | 182 |
| 303 | 3300005563 | Ga0068855_101229022 | Ga0068855_1012290222 | 182 |
| 304 | 3300009174 | Ga0105241_10069231 | Ga0105241_100692315 | 182 |
| 305 | 3300025949 | Ga0207667_11310204 | Ga0207667_113102041 | 182 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1d1g-assembly1.cif.gz_B | dihydrofolate reductase from thermotoga maritima | 0.8634 | 3 | 172 |
| 1d1g-assembly1.cif.gz_B | dihydrofolate reductase from thermotoga maritima | 0.8538 | 3 | 172 |
| 3ky8-assembly1.cif.gz_B | crystal structure of putative riboflavin biosynthesis protein (yp_001092907.1) from shewanella sp. pv-4 at 2.12 a resolution | 0.8469 | 3 | 173 |
| 7xh2-assembly1.cif.gz_A | dihydrofolate reductase-like protein sach in safracin biosynthesis | 0.8404 | 1 | 170 |
| 3jtw-assembly1.cif.gz_A-2 | crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution | 0.8396 | 1 | 172 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3jtwB00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.8268 | 1 | 172 | 3.40.430.10 |
| 3tqaA00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.8262 | 3 | 171 | 3.40.430.10 |
| 5ecxB00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.8229 | 3 | 172 | 3.40.430.10 |
| 3jtwB00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.8224 | 1 | 172 | 3.40.430.10 |
| 1cz3B00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.8171 | 3 | 174 | 3.40.430.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q0T5X4-F1-model_v4 | Dihydrofolate reductase | 0.9319 | 1 | 173 |
GO:0008703
GO:0009231 |
| AF-A0A2V8UK03-F1-model_v4 | Dihydrofolate reductase | 0.9281 | 2 | 180 |
GO:0008703
GO:0009231 |
| AF-A0A4Q0T5X4-F1-model_v4 | Dihydrofolate reductase | 0.9268 | 1 | 173 |
GO:0008703
GO:0009231 |
| AF-A0A1Q6XB11-F1-model_v4 | Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein | 0.9212 | 1 | 182 |
GO:0008703
GO:0009231 |
| AF-A0A0A2UU15-F1-model_v4 | Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein | 0.9202 | 2 | 171 |
GO:0008703
GO:0009231 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar