F398202

General Info

Members Datasets Scaffolds Average Seq Length
305 143 305 180

Family's Representative Sequence

Representative Sequence 3300035086|Ga0373934_0023248|Ga0373934_0023248_1475_2104
Length 209
Sequence LCEVLVQGDSFPSAQLRVWIALRSSFTILAMRKIVLGLGISLDGYIARRDGSVDFLFMPKDYSMAPFFKTIDAAIMGRKTWEVAVKMGGSFGGSSMTSYVMSGSQPPGERGGVIFTNQTPAALIAEIRKRRGKDIWLMGGGELARDFLKADLVDELYLGVLPVLLGEGLPLFPSGFPQRNFALLENKTFSRGMIALKYKRLRSKAKRKH

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
38 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
53 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
54 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
79 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
80 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
81 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
82 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
83 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
84 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
85 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
86 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
87 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
88 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
89 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
90 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
91 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
92 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
93 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
94 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
95 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
96 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
97 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
99 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
102 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
103 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
104 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
105 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
106 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
107 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
108 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
109 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
110 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
111 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
112 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
113 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
114 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
115 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
116 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
117 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
118 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
119 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
120 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
121 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
122 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
123 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
124 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
125 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
126 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
127 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
128 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
129 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
130 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
131 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
134 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
135 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
138 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
139 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
140 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
141 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
142 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
143 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0.33
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.95
Rhizosphere 96.07
Stem 0
Stem Tuber 0
Unclassified 0.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10534539 3300005327 Bacteria 1014
2 Ga0070683_100081361 3300005329 Unclassified 3032
3 Ga0070680_100306115 3300005336 Bacteria 1348
4 Ga0070674_100094155 3300005356 Unclassified 2169
5 Ga0070709_10000057 3300005434 Bacteria 87352
6 Ga0070709_10013598 3300005434 Bacteria 4581
7 Ga0070709_10020696 3300005434 Unclassified 3823
8 Ga0070709_10292507 3300005434 Bacteria 1187
9 Ga0070714_100000715 3300005435 Bacteria 23534
10 Ga0070713_100004775 3300005436 Bacteria 9172
11 Ga0070713_100026895 3300005436 Bacteria 4523
12 Ga0070713_100338288 3300005436 Bacteria 1394
13 Ga0070713_100342546 3300005436 Bacteria 1385
14 Ga0070713_100547058 3300005436 Unclassified 1096
15 Ga0070713_100830357 3300005436 Bacteria 887
16 Ga0070713_101220658 3300005436 Unclassified 728
17 Ga0070710_10401086 3300005437 Bacteria 919
18 Ga0070711_100018451 3300005439 Bacteria 4456
19 Ga0070711_100064007 3300005439 Bacteria 2568
20 Ga0070711_100110962 3300005439 Bacteria 2013
21 Ga0070711_100189085 3300005439 Bacteria 1581
22 Ga0070711_100364340 3300005439 Bacteria 1165
23 Ga0070711_100575607 3300005439 Bacteria 937
24 Ga0070705_100257114 3300005440 Unclassified 1229
25 Ga0070708_100012421 3300005445 Bacteria 6953
26 Ga0070708_100017913 3300005445 Bacteria 5921
27 Ga0070708_100333197 3300005445 Bacteria 1430
28 Ga0070708_101276883 3300005445 Bacteria 686
29 Ga0070681_10006458 3300005458 Bacteria 11410
30 Ga0070681_10785857 3300005458 Bacteria 869
31 Ga0070685_10151009 3300005466 Bacteria 1472
32 Ga0070706_100062888 3300005467 Unclassified 3430
33 Ga0070706_100171437 3300005467 Bacteria 2026
34 Ga0070706_100302020 3300005467 Unclassified 1494
35 Ga0070707_100006912 3300005468 Bacteria 10511
36 Ga0070707_100324688 3300005468 Bacteria 1495
37 Ga0070707_100423380 3300005468 Bacteria 1292
38 Ga0070698_100003703 3300005471 Bacteria 16779
39 Ga0070698_100522460 3300005471 Bacteria 1125
40 Ga0070698_101030352 3300005471 Bacteria 770
41 Ga0070699_100029748 3300005518 Bacteria 4711
42 Ga0070699_100356705 3300005518 Bacteria 1318
43 Ga0070699_100569381 3300005518 Bacteria 1032
44 Ga0070679_100175125 3300005530 Bacteria 2118
45 Ga0070697_100003251 3300005536 Bacteria 12478
46 Ga0070697_100083101 3300005536 Bacteria 2640
47 Ga0070697_100239692 3300005536 Bacteria 1548
48 Ga0070697_100369095 3300005536 Bacteria 1241
49 Ga0068853_100049036 3300005539 Unclassified 3628
50 Ga0068853_100608160 3300005539 Bacteria 1038
51 Ga0070695_100020592 3300005545 Bacteria 4028
52 Ga0070695_100137104 3300005545 Bacteria 1692
53 Ga0070696_100093409 3300005546 Unclassified 2145
54 Ga0070665_100022117 3300005548 Bacteria 6397
55 Ga0070704_100019311 3300005549 Bacteria 4377
56 Ga0068855_100675040 3300005563 Bacteria 1108
57 Ga0068855_101229022 3300005563 Unclassified 778
58 Ga0068852_100594328 3300005616 Bacteria 1110
59 Ga0068866_10246780 3300005718 Unclassified 1090
60 Ga0068863_100156088 3300005841 Bacteria 2185
61 Ga0070717_10019871 3300006028 Bacteria 5275
62 Ga0070717_10097702 3300006028 Bacteria 2488
63 Ga0070717_10443702 3300006028 Bacteria 1169
64 Ga0070717_10556988 3300006028 Bacteria 1038
65 Ga0070717_10720212 3300006028 Unclassified 907
66 Ga0070715_10078774 3300006163 Unclassified 1490
67 Ga0070715_10187449 3300006163 Bacteria 1042
68 Ga0070716_100001913 3300006173 Bacteria 9466
69 Ga0070716_100004009 3300006173 Bacteria 6991
70 Ga0070716_100016314 3300006173 Bacteria 3830
71 Ga0070716_100050009 3300006173 Unclassified 2371
72 Ga0070716_100059707 3300006173 Bacteria 2199
73 Ga0070716_100134918 3300006173 Bacteria 1566
74 Ga0070716_100282184 3300006173 Bacteria 1147
75 Ga0070716_100403270 3300006173 Bacteria 984
76 Ga0070716_100622047 3300006173 Bacteria 815
77 Ga0070712_100012547 3300006175 Bacteria 5387
78 Ga0070712_100096446 3300006175 Bacteria 2177
79 Ga0070712_100181426 3300006175 Bacteria 1640
80 Ga0070712_100334326 3300006175 Bacteria 1235
81 Ga0070712_100431414 3300006175 Bacteria 1094
82 Ga0097621_100686921 3300006237 Unclassified 941
83 Ga0075434_100042242 3300006871 Bacteria 4520
84 Ga0075434_100387578 3300006871 Bacteria 1418
85 Ga0075434_100723644 3300006871 Unclassified 1012
86 Ga0075436_100002551 3300006914 Bacteria 12538
87 Ga0075436_100006061 3300006914 Bacteria 8297
88 Ga0075436_100008907 3300006914 Bacteria 6869
89 Ga0075436_100038842 3300006914 Bacteria 3285
90 Ga0075436_100737155 3300006914 Unclassified 731
91 Ga0075435_100161120 3300007076 Bacteria 1890
92 Ga0075435_100498008 3300007076 Unclassified 1053
93 Ga0075435_100834196 3300007076 Bacteria 803
94 Ga0099794_10012772 3300007265 Bacteria 3637
95 Ga0099794_10025617 3300007265 Bacteria 2720
96 Ga0099794_10048299 3300007265 Bacteria 2043
97 Ga0099794_10365498 3300007265 Archaea 752
98 Ga0099795_10002701 3300007788 Unclassified 4239
99 Ga0099795_10031723 3300007788 Unclassified 1822
100 Ga0105240_10426997 3300009093 Bacteria 1488
101 Ga0111539_10669431 3300009094 Bacteria 1209
102 Ga0105243_10201343 3300009148 Bacteria 1746
103 Ga0105241_10069231 3300009174 Bacteria 2736
104 Ga0105241_10184143 3300009174 Unclassified 1734
105 Ga0105241_10271666 3300009174 Bacteria 1445
106 Ga0105242_10432710 3300009176 Unclassified 1236
107 Ga0105248_10394796 3300009177 Bacteria 1558
108 Ga0105248_10595104 3300009177 Unclassified 1248
109 Ga0105248_11031123 3300009177 Bacteria 929
110 Ga0105238_10408915 3300009551 Bacteria 1351
111 Ga0105238_10889372 3300009551 Unclassified 909
112 Ga0099796_10093774 3300010159 Bacteria 1119
113 Ga0099796_10232243 3300010159 Unclassified 760
114 Ga0157369_10170109 3300013105 Bacteria 2296
115 Ga0157378_10112324 3300013297 Bacteria 2499
116 Ga0157372_11241603 3300013307 Bacteria 861
117 Ga0157375_10680412 3300013308 Unclassified 1183
118 Ga0157376_10001896 3300014969 Bacteria 13962
119 Ga0213872_10002468 3300021361 Bacteria 10843
120 Ga0213872_10192263 3300021361 Bacteria 878
121 Ga0213871_10014786 3300021441 Bacteria 1857
122 Ga0207692_10130885 3300025898 Bacteria 1417
123 Ga0207685_10108379 3300025905 Bacteria 1200
124 Ga0207699_10000010 3300025906 Bacteria 295869
125 Ga0207699_10006589 3300025906 Bacteria 5636
126 Ga0207699_10008371 3300025906 Bacteria 5100
127 Ga0207699_10066905 3300025906 Bacteria 2183
128 Ga0207684_10067732 3300025910 Bacteria 3034
129 Ga0207684_10204006 3300025910 Bacteria 1706
130 Ga0207684_10233809 3300025910 Bacteria 1586
131 Ga0207684_10256328 3300025910 Unclassified 1509
132 Ga0207684_10343059 3300025910 Unclassified 1286
133 Ga0207684_10835576 3300025910 Bacteria 777
134 Ga0207707_10019684 3300025912 Bacteria 5891
135 Ga0207695_10203607 3300025913 Bacteria 1892
136 Ga0207693_10067987 3300025915 Bacteria 2789
137 Ga0207693_10082364 3300025915 Bacteria 2520
138 Ga0207693_10407121 3300025915 Unclassified 1063
139 Ga0207693_10422720 3300025915 Bacteria 1042
140 Ga0207663_10041654 3300025916 Bacteria 2800
141 Ga0207663_10426475 3300025916 Bacteria 1019
142 Ga0207660_10174366 3300025917 Unclassified 1667
143 Ga0207652_10269598 3300025921 Bacteria 1535
144 Ga0207646_10002439 3300025922 Bacteria 21937
145 Ga0207646_10191684 3300025922 Bacteria 1846
146 Ga0207694_10106235 3300025924 Bacteria 2230
147 Ga0207700_10002775 3300025928 Bacteria 10092
148 Ga0207700_10288635 3300025928 Bacteria 1413
149 Ga0207664_10007135 3300025929 Bacteria 7747
150 Ga0207664_10029824 3300025929 Bacteria 4159
151 Ga0207664_10394394 3300025929 Bacteria 1230
152 Ga0207686_10133886 3300025934 Bacteria 1704
153 Ga0207665_10000008 3300025939 Bacteria 173434
154 Ga0207665_10000589 3300025939 Bacteria 24479
155 Ga0207665_10028038 3300025939 Bacteria 3719
156 Ga0207665_10030970 3300025939 Unclassified 3539
157 Ga0207665_10045082 3300025939 Bacteria 2952
158 Ga0207665_10068469 3300025939 Bacteria 2419
159 Ga0207665_10241249 3300025939 Bacteria 1332
160 Ga0207665_10648663 3300025939 Unclassified 827
161 Ga0207661_10022249 3300025944 Bacteria 4769
162 Ga0207667_11310204 3300025949 Unclassified 700
163 Ga0207677_10458552 3300026023 Unclassified 1093
164 Ga0207639_10066309 3300026041 Unclassified 2805
165 Ga0209179_1036560 3300027512 Unclassified 1023
166 Ga0209588_1011747 3300027671 Unclassified 2650
167 Ga0209588_1022672 3300027671 Bacteria 1976
168 Ga0209588_1026797 3300027671 Bacteria 1832
169 Ga0268266_10000657 3300028379 Bacteria 46799
170 Ga0268266_10307439 3300028379 Unclassified 1481
171 Ga0265760_10046751 3300031090 Unclassified 1299
172 Ga0373926_0025500 3300035083 Bacteria 2064
173 Ga0373926_0100654 3300035083 Bacteria 1081
174 Ga0373926_0133272 3300035083 Unclassified 941
175 Ga0373934_0023248 3300035086 Bacteria 2395
176 Ga0373934_0028647 3300035086 Unclassified 2173
177 Ga0373944_0014732 3300035089 Bacteria 2186
178 Ga0373923_0044033 3300035111 Bacteria 1849
179 Ga0373923_0079051 3300035111 Bacteria 1424
180 Ga0373923_0130116 3300035111 Unclassified 1130
181 Ga0373936_0042476 3300035113 Bacteria 1825
182 Ga0373945_0016942 3300035116 Bacteria 2465
183 Ga0373945_0105309 3300035116 Unclassified 1108
184 Ga0373945_0283640 3300035116 Unclassified 706
185 Ga0373953_0002382 3300035117 Bacteria 5677
186 Ga0373953_0111589 3300035117 Bacteria 1156
187 Ga0373953_0241930 3300035117 Unclassified 783
188 Ga0373954_0000077 3300035118 Bacteria 34839
189 Ga0373954_0016625 3300035118 Unclassified 3296
190 Ga0373956_0003594 3300035119 Bacteria 6256
191 Ga0373956_0046208 3300035119 Bacteria 1944
192 Ga0373956_0108449 3300035119 Bacteria 1291
193 Ga0373957_0011212 3300035120 Bacteria 2985
194 Ga0373943_0005634 3300035170 Bacteria 5619
195 Ga0373946_0006964 3300035171 Bacteria 4119
196 Ga0373946_0011140 3300035171 Bacteria 3347
197 Ga0373946_0083890 3300035171 Bacteria 1400
198 Ga0373955_0008432 3300035172 Bacteria 4787
199 Ga0373955_0026088 3300035172 Bacteria 3006
200 Ga0373955_0076161 3300035172 Bacteria 1887
201 Ga0373924_0000270 3300035410 Bacteria 15909
202 Ga0373924_0084246 3300035410 Bacteria 1355
203 Ga0373935_0006289 3300035692 Bacteria 7074
204 Ga0373935_0077136 3300035692 Bacteria 2159
205 Ga0373935_0116952 3300035692 Bacteria 1776
206 Ga0373935_0208442 3300035692 Bacteria 1353
207 Ga0373935_0287672 3300035692 Unclassified 1158
208 Ga0373927_0014358 3300035695 Bacteria 5244
209 Ga0373927_0019916 3300035695 Unclassified 4399
210 Ga0373927_0034473 3300035695 Bacteria 3292
211 Ga0373927_0081665 3300035695 Bacteria 2095
212 Ga0373927_0082446 3300035695 Unclassified 2085
213 Ga0373933_0044158 3300035724 Bacteria 2639
214 Ga0373933_0073109 3300035724 Unclassified 2089
215 Ga0373947_0004202 3300035725 Bacteria 8446
216 Ga0373947_0093168 3300035725 Bacteria 1882
217 Ga0373937_0050461 3300036401 Bacteria 3811
218 Ga0373937_0094296 3300036401 Unclassified 2775
219 Ga0373925_0011032 3300037068 Bacteria 6561
220 Ga0373925_0034833 3300037068 Unclassified 3712
221 Ga0373925_0120356 3300037068 Bacteria 2037
222 Ga0373925_1168137 3300037068 Unclassified 633
223 Ga0395905_0019920 3300037471 Bacteria 6357
224 Ga0395905_0034428 3300037471 Bacteria 4756
225 Ga0395905_0044458 3300037471 Unclassified 4169
226 Ga0395905_0057296 3300037471 Bacteria 3645
227 Ga0436364_1152167 3300037853 Bacteria 1431
228 Ga0395901_0404254 3300038443 Bacteria 1403
229 Ga0395901_0605043 3300038443 Bacteria 1105
230 Ga0436360_0117297 3300039438 Bacteria 1793
231 Ga0436360_0338476 3300039438 Bacteria 1729
232 Ga0436360_0936714 3300039438 Bacteria 2996
233 Ga0436361_0608005 3300039447 Bacteria 15128
234 Ga0436361_0652690 3300039447 Bacteria 39906
235 Ga0436361_1195118 3300039447 Bacteria 2081
236 Ga0436361_1207841 3300039447 Bacteria 2082
237 Ga0436363_0470616 3300039450 Unclassified 931
238 Ga0436363_0540430 3300039450 Bacteria 5520
239 Ga0466972_0321645 3300044658 Bacteria 723
240 Ga0453683_0010010 3300044673 Bacteria 6307
241 Ga0453684_1142071 3300044712 Unclassified 821
242 Ga0451576_0029141 3300045051 Bacteria 5908
243 Ga0451576_1337595 3300045051 Unclassified 746
244 Ga0495603_0023259 3300046455 Bacteria 3752
245 Ga0495651_0220214 3300046462 Bacteria 1314
246 Ga0495651_0546513 3300046462 Unclassified 736
247 Ga0495653_0344719 3300046463 Unclassified 959
248 Ga0495580_0026534 3300046472 Bacteria 4223
249 Ga0495580_0065284 3300046472 Unclassified 2549
250 Ga0495580_0155003 3300046472 Bacteria 1586
251 Ga0495580_0870379 3300046472 Unclassified 581
252 Ga0495582_0043382 3300046473 Bacteria 2477
253 Ga0495639_0048876 3300046475 Bacteria 1919
254 Ga0495639_0123966 3300046475 Unclassified 1234
255 Ga0495630_0318985 3300046517 Bacteria 1188
256 Ga0495630_0362533 3300046517 Unclassified 1109
257 Ga0495666_0007594 3300046526 Bacteria 5425
258 Ga0495665_0027016 3300046531 Unclassified 3082
259 Ga0495665_0077267 3300046531 Bacteria 1752
260 Ga0495665_0323051 3300046531 Unclassified 788
261 Ga0495587_0013391 3300046536 Bacteria 5156
262 Ga0495667_0070981 3300046559 Bacteria 2272
263 Ga0495667_0187485 3300046559 Bacteria 1326
264 Ga0495634_0243579 3300046642 Unclassified 1102
265 Ga0495635_0037181 3300046663 Unclassified 3371
266 Ga0495635_0683990 3300046663 Unclassified 666
267 Ga0495623_0016117 3300046679 Bacteria 4829
268 Ga0495647_0006647 3300046681 Bacteria 3840
269 Ga0495658_0008530 3300046683 Bacteria 5082
270 Ga0495613_0208380 3300046689 Bacteria 1375
271 Ga0495624_0093825 3300046690 Bacteria 1850
272 Ga0495604_0023830 3300047317 Bacteria 4885
273 Ga0495604_0156195 3300047317 Bacteria 1616
274 Ga0495674_0081282 3300047319 Bacteria 2780
275 Ga0495684_0025414 3300047471 Unclassified 4551
276 Ga0495684_0032373 3300047471 Bacteria 4014
277 Ga0495684_0130818 3300047471 Bacteria 1885
278 Ga0495593_0085761 3300047673 Unclassified 1625
279 Ga0495602_0007881 3300048088 Bacteria 11134
280 Ga0495602_0045368 3300048088 Unclassified 3978
281 Ga0495602_0351124 3300048088 Bacteria 1064
282 Ga0495614_0258604 3300048089 Unclassified 798
283 Ga0496104_0056870 3300048907 Bacteria 3701
284 Ga0496104_1755551 3300048907 Unclassified 523
285 Ga0496107_0406770 3300048910 Unclassified 1012
286 Ga0496110_0126458 3300048913 Bacteria 2306
287 Ga0496111_0001840 3300048914 Bacteria 12500
288 Ga0496112_0057999 3300048915 Bacteria 3812
289 Ga0496113_0000605 3300048916 Bacteria 17890
290 Ga0496114_0316290 3300048917 Unclassified 1379
291 Ga0496115_0004843 3300048918 Bacteria 9770
292 nmdc:mga0n895_1346034_c1 3300050512 Unclassified 684
293 nmdc:mga0n895_150703_c1 3300050512 Bacteria 2356
294 nmdc:mga0n895_24785_c1 3300050512 Bacteria 5658
295 nmdc:mga0n895_484518_c1 3300050512 Bacteria 1247
296 nmdc:mga0n895_56328_c1 3300050512 Bacteria 3872
297 nmdc:mga0rr50_355654_c1 3300050513 Bacteria 1232
298 nmdc:mga0rr50_489407_c1 3300050513 Unclassified 1045
299 nmdc:mga0rr50_73876_c1 3300050513 Bacteria 2608
300 nmdc:mga08x19_10017_c1 3300050514 Bacteria 5682
301 nmdc:mga08x19_1522_c1 3300050514 Bacteria 14366
302 nmdc:mga08x19_19172_c1 3300050514 Unclassified 4196
303 nmdc:mga08x19_597784_c1 3300050514 Unclassified 782
304 nmdc:mga08x19_641465_c1 3300050514 Unclassified 753
305 Ga0495601_0000524 3300053077 Bacteria 20280

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048907 Ga0496104_1755551 Ga0496104_1755551_27_482 151
2 3300048910 Ga0496107_0406770 Ga0496107_0406770_485_940 151
3 3300037068 Ga0373925_1168137 Ga0373925_1168137_145_615 156
4 3300046689 Ga0495613_0208380 Ga0495613_0208380_57_527 156
5 3300044712 Ga0453684_1142071 Ga0453684_1142071_193_672 159
6 3300037471 Ga0395905_0057296 Ga0395905_0057296_267_845 163
7 3300038443 Ga0395901_0605043 Ga0395901_0605043_309_887 163
8 3300037471 Ga0395905_0019920 Ga0395905_0019920_4460_4960 164
9 3300037471 Ga0395905_0034428 Ga0395905_0034428_3036_3620 164
10 3300038443 Ga0395901_0404254 Ga0395901_0404254_339_923 164
11 3300044658 Ga0466972_0321645 Ga0466972_0321645_49_609 164
12 3300006173 Ga0070716_100016314 Ga0070716_1000163143 170
13 3300025939 Ga0207665_10028038 Ga0207665_100280383 170
14 3300005356 Ga0070674_100094155 Ga0070674_1000941553 171
15 3300028379 Ga0268266_10307439 Ga0268266_103074392 171
16 3300005329 Ga0070683_100081361 Ga0070683_1000813612 172
17 3300005336 Ga0070680_100306115 Ga0070680_1003061151 172
18 3300005458 Ga0070681_10785857 Ga0070681_107858571 172
19 3300005530 Ga0070679_100175125 Ga0070679_1001751252 172
20 3300005539 Ga0068853_100049036 Ga0068853_1000490363 172
21 3300005563 Ga0068855_100675040 Ga0068855_1006750401 172
22 3300005616 Ga0068852_100594328 Ga0068852_1005943281 172
23 3300009093 Ga0105240_10426997 Ga0105240_104269972 172
24 3300009174 Ga0105241_10271666 Ga0105241_102716661 172
25 3300009551 Ga0105238_10408915 Ga0105238_104089152 172
26 3300013105 Ga0157369_10170109 Ga0157369_101701093 172
27 3300025913 Ga0207695_10203607 Ga0207695_102036072 172
28 3300025917 Ga0207660_10174366 Ga0207660_101743662 172
29 3300025921 Ga0207652_10269598 Ga0207652_102695982 172
30 3300025924 Ga0207694_10106235 Ga0207694_101062352 172
31 3300025929 Ga0207664_10394394 Ga0207664_103943941 172
32 3300025944 Ga0207661_10022249 Ga0207661_100222492 172
33 3300026023 Ga0207677_10458552 Ga0207677_104585521 172
34 3300026041 Ga0207639_10066309 Ga0207639_100663092 172
35 3300048915 Ga0496112_0057999 Ga0496112_0057999_2317_2865 172
36 3300035083 Ga0373926_0025500 Ga0373926_0025500_223_747 173
37 3300035086 Ga0373934_0028647 Ga0373934_0028647_757_1281 173
38 3300035111 Ga0373923_0079051 Ga0373923_0079051_24_548 173
39 3300035117 Ga0373953_0241930 Ga0373953_0241930_98_622 173
40 3300035118 Ga0373954_0016625 Ga0373954_0016625_1278_1802 173
41 3300035171 Ga0373946_0083890 Ga0373946_0083890_235_759 173
42 3300035172 Ga0373955_0076161 Ga0373955_0076161_1164_1688 173
43 3300035692 Ga0373935_0077136 Ga0373935_0077136_47_571 173
44 3300035695 Ga0373927_0019916 Ga0373927_0019916_1387_1911 173
45 3300035724 Ga0373933_0073109 Ga0373933_0073109_1218_1742 173
46 3300036401 Ga0373937_0094296 Ga0373937_0094296_748_1272 173
47 3300037068 Ga0373925_0034833 Ga0373925_0034833_2355_2879 173
48 3300046462 Ga0495651_0220214 Ga0495651_0220214_381_920 173
49 3300046463 Ga0495653_0344719 Ga0495653_0344719_320_844 173
50 3300046472 Ga0495580_0065284 Ga0495580_0065284_1288_1812 173
51 3300046531 Ga0495665_0027016 Ga0495665_0027016_1257_1781 173
52 3300046663 Ga0495635_0037181 Ga0495635_0037181_1631_2155 173
53 3300047319 Ga0495674_0081282 Ga0495674_0081282_227_751 173
54 3300047471 Ga0495684_0025414 Ga0495684_0025414_2621_3145 173
55 3300048088 Ga0495602_0045368 Ga0495602_0045368_1654_2178 173
56 3300005467 Ga0070706_100062888 Ga0070706_1000628882 174
57 3300005471 Ga0070698_101030352 Ga0070698_1010303522 174
58 3300005545 Ga0070695_100020592 Ga0070695_1000205921 174
59 3300005549 Ga0070704_100019311 Ga0070704_1000193115 174
60 3300025910 Ga0207684_10343059 Ga0207684_103430592 174
61 3300050512 nmdc:mga0n895_56328_c1 nmdc:mga0n895_56328_c1_1057_1590 174
62 3300039447 Ga0436361_0652690 Ga0436361_0652690_12334_12861 175
63 3300044673 Ga0453683_0010010 Ga0453683_0010010_5120_5647 175
64 3300045051 Ga0451576_0029141 Ga0451576_0029141_443_970 175
65 3300005434 Ga0070709_10013598 Ga0070709_100135982 177
66 3300005434 Ga0070709_10020696 Ga0070709_100206962 177
67 3300005434 Ga0070709_10292507 Ga0070709_102925072 177
68 3300005436 Ga0070713_100026895 Ga0070713_1000268955 177
69 3300005436 Ga0070713_100338288 Ga0070713_1003382882 177
70 3300005437 Ga0070710_10401086 Ga0070710_104010861 177
71 3300005445 Ga0070708_100012421 Ga0070708_1000124211 177
72 3300005445 Ga0070708_100017913 Ga0070708_1000179137 177
73 3300005467 Ga0070706_100302020 Ga0070706_1003020202 177
74 3300005468 Ga0070707_100006912 Ga0070707_1000069121 177
75 3300005468 Ga0070707_100423380 Ga0070707_1004233802 177
76 3300005471 Ga0070698_100522460 Ga0070698_1005224601 177
77 3300005518 Ga0070699_100569381 Ga0070699_1005693811 177
78 3300005536 Ga0070697_100003251 Ga0070697_1000032515 177
79 3300005536 Ga0070697_100083101 Ga0070697_1000831012 177
80 3300005536 Ga0070697_100239692 Ga0070697_1002396921 177
81 3300005545 Ga0070695_100137104 Ga0070695_1001371042 177
82 3300006173 Ga0070716_100001913 Ga0070716_10000191310 177
83 3300006173 Ga0070716_100050009 Ga0070716_1000500093 177
84 3300006173 Ga0070716_100059707 Ga0070716_1000597071 177
85 3300006173 Ga0070716_100134918 Ga0070716_1001349182 177
86 3300006175 Ga0070712_100334326 Ga0070712_1003343262 177
87 3300006914 Ga0075436_100006061 Ga0075436_1000060616 177
88 3300006914 Ga0075436_100038842 Ga0075436_1000388422 177
89 3300025906 Ga0207699_10006589 Ga0207699_100065892 177
90 3300025906 Ga0207699_10008371 Ga0207699_100083716 177
91 3300025910 Ga0207684_10067732 Ga0207684_100677323 177
92 3300025910 Ga0207684_10233809 Ga0207684_102338092 177
93 3300025910 Ga0207684_10256328 Ga0207684_102563282 177
94 3300025922 Ga0207646_10002439 Ga0207646_100024392 177
95 3300025928 Ga0207700_10288635 Ga0207700_102886352 177
96 3300025939 Ga0207665_10000589 Ga0207665_1000058911 177
97 3300025939 Ga0207665_10030970 Ga0207665_100309703 177
98 3300025939 Ga0207665_10241249 Ga0207665_102412492 177
99 3300025939 Ga0207665_10648663 Ga0207665_106486631 177
100 3300035695 Ga0373927_0082446 Ga0373927_0082446_217_819 177
101 3300037853 Ga0436364_1152167 Ga0436364_1152167_204_737 177
102 3300050514 nmdc:mga08x19_19172_c1 nmdc:mga08x19_19172_c1_1199_1783 177
103 3300050514 nmdc:mga08x19_597784_c1 nmdc:mga08x19_597784_c1_217_753 177
104 3300005436 Ga0070713_100547058 Ga0070713_1005470582 178
105 3300005439 Ga0070711_100364340 Ga0070711_1003643402 178
106 3300005445 Ga0070708_100333197 Ga0070708_1003331973 178
107 3300005466 Ga0070685_10151009 Ga0070685_101510092 178
108 3300005539 Ga0068853_100608160 Ga0068853_1006081602 178
109 3300005548 Ga0070665_100022117 Ga0070665_1000221171 178
110 3300005841 Ga0068863_100156088 Ga0068863_1001560883 178
111 3300006173 Ga0070716_100403270 Ga0070716_1004032702 178
112 3300006871 Ga0075434_100723644 Ga0075434_1007236442 178
113 3300007076 Ga0075435_100498008 Ga0075435_1004980081 178
114 3300007788 Ga0099795_10031723 Ga0099795_100317233 178
115 3300009177 Ga0105248_10394796 Ga0105248_103947962 178
116 3300009177 Ga0105248_11031123 Ga0105248_110311232 178
117 3300009551 Ga0105238_10889372 Ga0105238_108893722 178
118 3300010159 Ga0099796_10232243 Ga0099796_102322431 178
119 3300014969 Ga0157376_10001896 Ga0157376_100018969 178
120 3300025906 Ga0207699_10066905 Ga0207699_100669052 178
121 3300025916 Ga0207663_10426475 Ga0207663_104264752 178
122 3300027512 Ga0209179_1036560 Ga0209179_10365601 178
123 3300028379 Ga0268266_10000657 Ga0268266_1000065728 178
124 3300035083 Ga0373926_0133272 Ga0373926_0133272_231_773 178
125 3300035089 Ga0373944_0014732 Ga0373944_0014732_1414_1956 178
126 3300035111 Ga0373923_0130116 Ga0373923_0130116_390_932 178
127 3300035113 Ga0373936_0042476 Ga0373936_0042476_329_871 178
128 3300035116 Ga0373945_0016942 Ga0373945_0016942_1293_1835 178
129 3300035116 Ga0373945_0105309 Ga0373945_0105309_526_1068 178
130 3300035116 Ga0373945_0283640 Ga0373945_0283640_62_598 178
131 3300035170 Ga0373943_0005634 Ga0373943_0005634_4657_5199 178
132 3300035171 Ga0373946_0006964 Ga0373946_0006964_2871_3413 178
133 3300035171 Ga0373946_0011140 Ga0373946_0011140_2534_3076 178
134 3300035410 Ga0373924_0000270 Ga0373924_0000270_7533_8075 178
135 3300035692 Ga0373935_0006289 Ga0373935_0006289_417_959 178
136 3300035692 Ga0373935_0116952 Ga0373935_0116952_1160_1702 178
137 3300035695 Ga0373927_0014358 Ga0373927_0014358_3826_4368 178
138 3300035695 Ga0373927_0034473 Ga0373927_0034473_197_739 178
139 3300035725 Ga0373947_0004202 Ga0373947_0004202_4073_4615 178
140 3300035725 Ga0373947_0093168 Ga0373947_0093168_467_1009 178
141 3300037068 Ga0373925_0011032 Ga0373925_0011032_322_864 178
142 3300039450 Ga0436363_0540430 Ga0436363_0540430_4659_5201 178
143 3300046455 Ga0495603_0023259 Ga0495603_0023259_2323_2859 178
144 3300046472 Ga0495580_0026534 Ga0495580_0026534_2668_3204 178
145 3300046472 Ga0495580_0155003 Ga0495580_0155003_718_1260 178
146 3300046473 Ga0495582_0043382 Ga0495582_0043382_1484_2020 178
147 3300046475 Ga0495639_0048876 Ga0495639_0048876_361_903 178
148 3300046475 Ga0495639_0123966 Ga0495639_0123966_164_706 178
149 3300046517 Ga0495630_0362533 Ga0495630_0362533_246_782 178
150 3300046526 Ga0495666_0007594 Ga0495666_0007594_1101_1637 178
151 3300046531 Ga0495665_0077267 Ga0495665_0077267_1033_1575 178
152 3300046531 Ga0495665_0323051 Ga0495665_0323051_148_690 178
153 3300046642 Ga0495634_0243579 Ga0495634_0243579_140_676 178
154 3300046681 Ga0495647_0006647 Ga0495647_0006647_1481_2017 178
155 3300046683 Ga0495658_0008530 Ga0495658_0008530_3873_4409 178
156 3300046690 Ga0495624_0093825 Ga0495624_0093825_418_954 178
157 3300047471 Ga0495684_0130818 Ga0495684_0130818_1100_1636 178
158 3300047673 Ga0495593_0085761 Ga0495593_0085761_356_892 178
159 3300048917 Ga0496114_0316290 Ga0496114_0316290_150_686 178
160 3300048918 Ga0496115_0004843 Ga0496115_0004843_3930_4466 178
161 3300050512 nmdc:mga0n895_1346034_c1 nmdc:mga0n895_1346034_c1_47_583 178
162 3300050513 nmdc:mga0rr50_489407_c1 nmdc:mga0rr50_489407_c1_70_606 178
163 3300005436 Ga0070713_100342546 Ga0070713_1003425462 179
164 3300005439 Ga0070711_100064007 Ga0070711_1000640072 179
165 3300005439 Ga0070711_100189085 Ga0070711_1001890852 179
166 3300005439 Ga0070711_100575607 Ga0070711_1005756071 179
167 3300005440 Ga0070705_100257114 Ga0070705_1002571142 179
168 3300005458 Ga0070681_10006458 Ga0070681_1000645810 179
169 3300005471 Ga0070698_100003703 Ga0070698_1000037034 179
170 3300005518 Ga0070699_100029748 Ga0070699_1000297483 179
171 3300005546 Ga0070696_100093409 Ga0070696_1000934092 179
172 3300006028 Ga0070717_10097702 Ga0070717_100977022 179
173 3300006028 Ga0070717_10443702 Ga0070717_104437022 179
174 3300006028 Ga0070717_10556988 Ga0070717_105569882 179
175 3300006163 Ga0070715_10078774 Ga0070715_100787742 179
176 3300006163 Ga0070715_10187449 Ga0070715_101874492 179
177 3300006173 Ga0070716_100622047 Ga0070716_1006220472 179
178 3300006175 Ga0070712_100012547 Ga0070712_1000125472 179
179 3300006175 Ga0070712_100096446 Ga0070712_1000964462 179
180 3300006237 Ga0097621_100686921 Ga0097621_1006869212 179
181 3300006871 Ga0075434_100042242 Ga0075434_1000422423 179
182 3300006871 Ga0075434_100387578 Ga0075434_1003875782 179
183 3300006914 Ga0075436_100002551 Ga0075436_1000025518 179
184 3300006914 Ga0075436_100008907 Ga0075436_1000089075 179
185 3300006914 Ga0075436_100737155 Ga0075436_1007371551 179
186 3300007076 Ga0075435_100161120 Ga0075435_1001611204 179
187 3300007076 Ga0075435_100834196 Ga0075435_1008341961 179
188 3300007265 Ga0099794_10025617 Ga0099794_100256173 179
189 3300007265 Ga0099794_10048299 Ga0099794_100482992 179
190 3300007265 Ga0099794_10365498 Ga0099794_103654981 179
191 3300009174 Ga0105241_10184143 Ga0105241_101841432 179
192 3300010159 Ga0099796_10093774 Ga0099796_100937742 179
193 3300013307 Ga0157372_11241603 Ga0157372_112416032 179
194 3300025898 Ga0207692_10130885 Ga0207692_101308852 179
195 3300025905 Ga0207685_10108379 Ga0207685_101083792 179
196 3300025910 Ga0207684_10835576 Ga0207684_108355762 179
197 3300025912 Ga0207707_10019684 Ga0207707_100196843 179
198 3300025915 Ga0207693_10067987 Ga0207693_100679872 179
199 3300025915 Ga0207693_10407121 Ga0207693_104071212 179
200 3300025929 Ga0207664_10029824 Ga0207664_100298243 179
201 3300025939 Ga0207665_10045082 Ga0207665_100450823 179
202 3300025939 Ga0207665_10068469 Ga0207665_100684692 179
203 3300027671 Ga0209588_1022672 Ga0209588_10226722 179
204 3300027671 Ga0209588_1026797 Ga0209588_10267972 179
205 3300031090 Ga0265760_10046751 Ga0265760_100467512 179
206 3300035086 Ga0373934_0023248 Ga0373934_0023248_1475_2104 179
207 3300035111 Ga0373923_0044033 Ga0373923_0044033_439_978 179
208 3300035117 Ga0373953_0002382 Ga0373953_0002382_657_1286 179
209 3300035117 Ga0373953_0111589 Ga0373953_0111589_567_1106 179
210 3300035118 Ga0373954_0000077 Ga0373954_0000077_29023_29652 179
211 3300035119 Ga0373956_0003594 Ga0373956_0003594_3001_3540 179
212 3300035119 Ga0373956_0046208 Ga0373956_0046208_1032_1571 179
213 3300035119 Ga0373956_0108449 Ga0373956_0108449_169_798 179
214 3300035120 Ga0373957_0011212 Ga0373957_0011212_1147_1776 179
215 3300035172 Ga0373955_0008432 Ga0373955_0008432_1276_1905 179
216 3300035172 Ga0373955_0026088 Ga0373955_0026088_70_609 179
217 3300035410 Ga0373924_0084246 Ga0373924_0084246_353_892 179
218 3300035692 Ga0373935_0208442 Ga0373935_0208442_286_825 179
219 3300035692 Ga0373935_0287672 Ga0373935_0287672_417_962 179
220 3300035695 Ga0373927_0081665 Ga0373927_0081665_215_754 179
221 3300035724 Ga0373933_0044158 Ga0373933_0044158_1555_2094 179
222 3300036401 Ga0373937_0050461 Ga0373937_0050461_561_1100 179
223 3300037068 Ga0373925_0120356 Ga0373925_0120356_748_1392 179
224 3300037471 Ga0395905_0044458 Ga0395905_0044458_1375_1929 179
225 3300039450 Ga0436363_0470616 Ga0436363_0470616_129_716 179
226 3300045051 Ga0451576_1337595 Ga0451576_1337595_90_629 179
227 3300046462 Ga0495651_0546513 Ga0495651_0546513_20_559 179
228 3300046472 Ga0495580_0870379 Ga0495580_0870379_17_556 179
229 3300046517 Ga0495630_0318985 Ga0495630_0318985_177_821 179
230 3300046536 Ga0495587_0013391 Ga0495587_0013391_4208_4837 179
231 3300046559 Ga0495667_0070981 Ga0495667_0070981_1010_1654 179
232 3300046559 Ga0495667_0187485 Ga0495667_0187485_71_610 179
233 3300046663 Ga0495635_0683990 Ga0495635_0683990_57_596 179
234 3300046679 Ga0495623_0016117 Ga0495623_0016117_2192_2821 179
235 3300047317 Ga0495604_0023830 Ga0495604_0023830_589_1218 179
236 3300047471 Ga0495684_0032373 Ga0495684_0032373_3079_3618 179
237 3300048088 Ga0495602_0007881 Ga0495602_0007881_3052_3681 179
238 3300048089 Ga0495614_0258604 Ga0495614_0258604_78_722 179
239 3300048907 Ga0496104_0056870 Ga0496104_0056870_3004_3549 179
240 3300048913 Ga0496110_0126458 Ga0496110_0126458_1605_2150 179
241 3300048914 Ga0496111_0001840 Ga0496111_0001840_2955_3500 179
242 3300048916 Ga0496113_0000605 Ga0496113_0000605_4785_5333 179
243 3300050512 nmdc:mga0n895_150703_c1 nmdc:mga0n895_150703_c1_968_1507 179
244 3300050512 nmdc:mga0n895_24785_c1 nmdc:mga0n895_24785_c1_403_942 179
245 3300050512 nmdc:mga0n895_484518_c1 nmdc:mga0n895_484518_c1_493_1047 179
246 3300050513 nmdc:mga0rr50_355654_c1 nmdc:mga0rr50_355654_c1_39_578 179
247 3300050513 nmdc:mga0rr50_73876_c1 nmdc:mga0rr50_73876_c1_1181_1720 179
248 3300050514 nmdc:mga08x19_10017_c1 nmdc:mga08x19_10017_c1_1813_2352 179
249 3300050514 nmdc:mga08x19_1522_c1 nmdc:mga08x19_1522_c1_5764_6303 179
250 3300050514 nmdc:mga08x19_641465_c1 nmdc:mga08x19_641465_c1_131_676 179
251 3300005434 Ga0070709_10000057 Ga0070709_100000575 180
252 3300005436 Ga0070713_101220658 Ga0070713_1012206581 180
253 3300005439 Ga0070711_100110962 Ga0070711_1001109623 180
254 3300005445 Ga0070708_101276883 Ga0070708_1012768831 180
255 3300005467 Ga0070706_100171437 Ga0070706_1001714372 180
256 3300005468 Ga0070707_100324688 Ga0070707_1003246882 180
257 3300005518 Ga0070699_100356705 Ga0070699_1003567051 180
258 3300005536 Ga0070697_100369095 Ga0070697_1003690952 180
259 3300006028 Ga0070717_10720212 Ga0070717_107202122 180
260 3300006173 Ga0070716_100004009 Ga0070716_1000040095 180
261 3300006173 Ga0070716_100282184 Ga0070716_1002821842 180
262 3300006175 Ga0070712_100181426 Ga0070712_1001814261 180
263 3300006175 Ga0070712_100431414 Ga0070712_1004314142 180
264 3300007265 Ga0099794_10012772 Ga0099794_100127723 180
265 3300007788 Ga0099795_10002701 Ga0099795_100027012 180
266 3300009094 Ga0111539_10669431 Ga0111539_106694312 180
267 3300021361 Ga0213872_10002468 Ga0213872_100024688 180
268 3300021361 Ga0213872_10192263 Ga0213872_101922632 180
269 3300025906 Ga0207699_10000010 Ga0207699_10000010159 180
270 3300025910 Ga0207684_10204006 Ga0207684_102040062 180
271 3300025915 Ga0207693_10422720 Ga0207693_104227202 180
272 3300025922 Ga0207646_10191684 Ga0207646_101916842 180
273 3300025939 Ga0207665_10000008 Ga0207665_10000008121 180
274 3300027671 Ga0209588_1011747 Ga0209588_10117472 180
275 3300039438 Ga0436360_0936714 Ga0436360_0936714_1063_1605 180
276 3300039447 Ga0436361_0608005 Ga0436361_0608005_11027_11569 180
277 3300047317 Ga0495604_0156195 Ga0495604_0156195_615_1160 180
278 3300048088 Ga0495602_0351124 Ga0495602_0351124_452_997 180
279 3300005435 Ga0070714_100000715 Ga0070714_1000007156 181
280 3300005436 Ga0070713_100004775 Ga0070713_1000047752 181
281 3300005436 Ga0070713_100830357 Ga0070713_1008303571 181
282 3300005439 Ga0070711_100018451 Ga0070711_1000184512 181
283 3300005718 Ga0068866_10246780 Ga0068866_102467802 181
284 3300006028 Ga0070717_10019871 Ga0070717_100198712 181
285 3300009148 Ga0105243_10201343 Ga0105243_102013432 181
286 3300009176 Ga0105242_10432710 Ga0105242_104327101 181
287 3300009177 Ga0105248_10595104 Ga0105248_105951041 181
288 3300013297 Ga0157378_10112324 Ga0157378_101123242 181
289 3300013308 Ga0157375_10680412 Ga0157375_106804122 181
290 3300021441 Ga0213871_10014786 Ga0213871_100147862 181
291 3300025915 Ga0207693_10082364 Ga0207693_100823642 181
292 3300025916 Ga0207663_10041654 Ga0207663_100416542 181
293 3300025928 Ga0207700_10002775 Ga0207700_100027753 181
294 3300025929 Ga0207664_10007135 Ga0207664_100071358 181
295 3300025934 Ga0207686_10133886 Ga0207686_101338863 181
296 3300035083 Ga0373926_0100654 Ga0373926_0100654_269_814 181
297 3300039438 Ga0436360_0117297 Ga0436360_0117297_910_1455 181
298 3300039438 Ga0436360_0338476 Ga0436360_0338476_446_991 181
299 3300039447 Ga0436361_1195118 Ga0436361_1195118_647_1192 181
300 3300039447 Ga0436361_1207841 Ga0436361_1207841_648_1193 181
301 3300053077 Ga0495601_0000524 Ga0495601_0000524_10331_10885 181
302 3300005327 Ga0070658_10534539 Ga0070658_105345391 182
303 3300005563 Ga0068855_101229022 Ga0068855_1012290222 182
304 3300009174 Ga0105241_10069231 Ga0105241_100692315 182
305 3300025949 Ga0207667_11310204 Ga0207667_113102041 182

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

32

195

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.8634 3 172
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.8538 3 172
3ky8-assembly1.cif.gz_B crystal structure of putative riboflavin biosynthesis protein (yp_001092907.1) from shewanella sp. pv-4 at 2.12 a resolution 0.8469 3 173
7xh2-assembly1.cif.gz_A dihydrofolate reductase-like protein sach in safracin biosynthesis 0.8404 1 170
3jtw-assembly1.cif.gz_A-2 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8396 1 172
ID Description Score Start End Superfamily
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8268 1 172 3.40.430.10
3tqaA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8262 3 171 3.40.430.10
5ecxB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8229 3 172 3.40.430.10
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8224 1 172 3.40.430.10
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8171 3 174 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A4Q0T5X4-F1-model_v4 Dihydrofolate reductase 0.9319 1 173 GO:0008703
GO:0009231
AF-A0A2V8UK03-F1-model_v4 Dihydrofolate reductase 0.9281 2 180 GO:0008703
GO:0009231
AF-A0A4Q0T5X4-F1-model_v4 Dihydrofolate reductase 0.9268 1 173 GO:0008703
GO:0009231
AF-A0A1Q6XB11-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.9212 1 182 GO:0008703
GO:0009231
AF-A0A0A2UU15-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.9202 2 171 GO:0008703
GO:0009231

Feature Viewer

pLDDT pTM Quality
87.33 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map