F398197

General Info

Members Datasets Scaffolds Average Seq Length
305 166 610 170

Family's Representative Sequence

Representative Sequence 3300031911|Ga0307412_10722009|Ga0307412_107220091
Length 186
Sequence MNTTMARPPGLWRKLTAWYGEFLSWLLVFAVAILVIPVSLQIFSRFTALIPHYIWTEEMARFLFVWTIMIGAMLGVRESAHFEVDVWPRNISPRTDAALKIAARLGVLVIALVFVWSGIEFTRFGWNRISELAELPLWLIHIAWPIAGFTWIAFLGEQFWDEVQVLLGRRGPTPPEPHIPTEGAWE

Samples

Sample ID Description Type Environment
1 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
40 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
100 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
101 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
102 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
105 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
106 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
107 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
108 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
109 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
110 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
111 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
112 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
113 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
114 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
115 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
116 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
117 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
118 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
119 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
120 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
121 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
134 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
135 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
136 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
137 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
138 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
139 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
140 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
141 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
142 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
143 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
144 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
145 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
146 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
147 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
149 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
150 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
151 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
152 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
153 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
154 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
155 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
156 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
157 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
158 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
159 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
160 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
161 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
162 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
163 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
164 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
165 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
166 2508501050 Microvirga lupini Lut6 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0
Isolates 0.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.18
Nodule 0.33
Rhizoplane 0
Rhizosphere 90.16
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307412_10722009 3300031911 Bacteria 857
2 JGI25406J46586_10001102 3300003203 Bacteria 12651
3 Ga0065707_10088559 3300005295 Bacteria 4620
4 Ga0065707_10167618 3300005295 Bacteria 1509
5 Ga0065707_10352905 3300005295 Bacteria 905
6 Ga0070676_10342520 3300005328 Bacteria 1026
7 Ga0070690_100184569 3300005330 Bacteria 1443
8 Ga0070677_10025777 3300005333 Bacteria 2199
9 Ga0068869_100160915 3300005334 Bacteria 1748
10 Ga0070666_10359702 3300005335 Bacteria 1042
11 Ga0070666_10407624 3300005335 Bacteria 978
12 Ga0070689_100059716 3300005340 Bacteria 2964
13 Ga0070689_100102840 3300005340 Bacteria 2263
14 Ga0070689_100875123 3300005340 Bacteria 794
15 Ga0070691_10202279 3300005341 Bacteria 1044
16 Ga0070687_100340466 3300005343 Bacteria 965
17 Ga0070692_10333874 3300005345 Bacteria 936
18 Ga0070668_100078399 3300005347 Bacteria 2584
19 Ga0070668_100440213 3300005347 Bacteria 1119
20 Ga0070668_100550071 3300005347 Bacteria 1004
21 Ga0070669_100126732 3300005353 Bacteria 1954
22 Ga0070669_100198759 3300005353 Bacteria 1576
23 Ga0070675_100074243 3300005354 Bacteria 2824
24 Ga0070675_100146899 3300005354 Bacteria 2019
25 Ga0070671_100119885 3300005355 Bacteria 2213
26 Ga0070671_100784465 3300005355 Bacteria 829
27 Ga0070674_100006942 3300005356 Bacteria 6640
28 Ga0070674_100742215 3300005356 Bacteria 843
29 Ga0070674_100912981 3300005356 Bacteria 766
30 Ga0070673_100031244 3300005364 Bacteria 3995
31 Ga0070673_100606768 3300005364 Bacteria 998
32 Ga0070673_100792170 3300005364 Bacteria 875
33 Ga0070667_100390925 3300005367 Bacteria 1265
34 Ga0070705_100015015 3300005440 Bacteria 3996
35 Ga0070700_100394747 3300005441 Bacteria 1038
36 Ga0070694_100076412 3300005444 Bacteria 2318
37 Ga0070663_100228591 3300005455 Bacteria 1464
38 Ga0070678_101061060 3300005456 Bacteria 747
39 Ga0068867_100012175 3300005459 Bacteria 6077
40 Ga0068867_100120483 3300005459 Bacteria 2027
41 Ga0068867_100426391 3300005459 Bacteria 1125
42 Ga0070685_10277052 3300005466 Bacteria 1121
43 Ga0070672_100053502 3300005543 Bacteria 3156
44 Ga0070672_100148030 3300005543 Bacteria 1941
45 Ga0070672_100233833 3300005543 Bacteria 1545
46 Ga0070686_100816813 3300005544 Bacteria 753
47 Ga0070665_100175935 3300005548 Bacteria 2141
48 Ga0070704_100110298 3300005549 Bacteria 2092
49 Ga0070704_100555389 3300005549 Bacteria 1004
50 Ga0068857_100578826 3300005577 Bacteria 1060
51 Ga0068866_10186684 3300005718 Bacteria 1229
52 Ga0068861_100006161 3300005719 Bacteria 8158
53 Ga0068861_100069576 3300005719 Bacteria 2723
54 Ga0068861_100200190 3300005719 Bacteria 1676
55 Ga0068861_100660752 3300005719 Bacteria 967
56 Ga0068861_100828608 3300005719 Bacteria 870
57 Ga0068863_100101084 3300005841 Bacteria 2741
58 Ga0068863_101085623 3300005841 Bacteria 805
59 Ga0068858_100181986 3300005842 Bacteria 1985
60 Ga0068860_100524414 3300005843 Bacteria 1185
61 Ga0068860_100595720 3300005843 Bacteria 1110
62 Ga0068862_100013884 3300005844 Bacteria 6677
63 Ga0068862_100094788 3300005844 Bacteria 2603
64 Ga0068862_100193479 3300005844 Bacteria 1831
65 Ga0081455_10002720 3300005937 Bacteria 20867
66 Ga0081538_10006860 3300005981 Bacteria 9920
67 Ga0081538_10054194 3300005981 Bacteria 2374
68 Ga0081540_1013624 3300005983 Bacteria 5273
69 Ga0081539_10000240 3300005985 Bacteria 128629
70 Ga0075365_10018839 3300006038 Bacteria 4251
71 Ga0075365_10081001 3300006038 Bacteria 2199
72 Ga0075365_10196377 3300006038 Bacteria 1413
73 Ga0075363_100015336 3300006048 Bacteria 3765
74 Ga0075364_10358853 3300006051 Bacteria 994
75 Ga0075362_10001959 3300006177 Bacteria 6763
76 Ga0075362_10236048 3300006177 Bacteria 897
77 Ga0075367_10149592 3300006178 Bacteria 1448
78 Ga0075367_10251472 3300006178 Bacteria 1109
79 Ga0075367_10264599 3300006178 Bacteria 1080
80 Ga0075369_10012020 3300006186 Bacteria 3415
81 Ga0075369_10427634 3300006186 Bacteria 626
82 Ga0075366_10006381 3300006195 Bacteria 6460
83 Ga0075366_10014363 3300006195 Bacteria 4522
84 Ga0097621_101146445 3300006237 Bacteria 731
85 Ga0075370_10065086 3300006353 Bacteria 2079
86 Ga0075370_10193205 3300006353 Bacteria 1200
87 Ga0075428_100199273 3300006844 Bacteria 2165
88 Ga0075428_100442996 3300006844 Bacteria 1391
89 Ga0075428_100661631 3300006844 Bacteria 1114
90 Ga0075431_100003718 3300006847 Bacteria 14826
91 Ga0075431_100019621 3300006847 Bacteria 6897
92 Ga0075431_101061137 3300006847 Bacteria 776
93 Ga0075429_100220384 3300006880 Bacteria 1662
94 Ga0068865_100000733 3300006881 Bacteria 18424
95 Ga0068865_100019214 3300006881 Bacteria 4421
96 Ga0068865_100065516 3300006881 Bacteria 2560
97 Ga0068865_100199002 3300006881 Bacteria 1554
98 Ga0068865_101159314 3300006881 Bacteria 683
99 Ga0097620_101632452 3300006931 Bacteria 712
100 Ga0111539_10131348 3300009094 Bacteria 2932
101 Ga0111539_10583271 3300009094 Bacteria 1302
102 Ga0111539_10745180 3300009094 Bacteria 1140
103 Ga0111539_10825527 3300009094 Bacteria 1079
104 Ga0111539_10929086 3300009094 Bacteria 1012
105 Ga0105247_10771441 3300009101 Bacteria 731
106 Ga0114129_10014733 3300009147 Bacteria 11140
107 Ga0105243_10251181 3300009148 Bacteria 1579
108 Ga0105243_10348066 3300009148 Bacteria 1360
109 Ga0105249_10114157 3300009553 Bacteria 2557
110 Ga0105249_10257702 3300009553 Bacteria 1732
111 Ga0105249_10500743 3300009553 Bacteria 1260
112 Ga0157378_10049067 3300013297 Bacteria 3755
113 Ga0157378_10132829 3300013297 Bacteria 2306
114 Ga0163162_10178269 3300013306 Bacteria 2251
115 Ga0157375_10224332 3300013308 Bacteria 2038
116 Ga0157375_10394532 3300013308 Bacteria 1551
117 Ga0157375_10776709 3300013308 Bacteria 1108
118 Ga0157380_10712356 3300014326 Bacteria 1010
119 Ga0157377_10581436 3300014745 Bacteria 796
120 Ga0157379_10384707 3300014968 Bacteria 1288
121 Ga0207682_10000232 3300025893 Bacteria 25140
122 Ga0207688_10024614 3300025901 Bacteria 3303
123 Ga0207680_10313236 3300025903 Bacteria 1096
124 Ga0207645_10266417 3300025907 Bacteria 1135
125 Ga0207643_10205768 3300025908 Bacteria 1200
126 Ga0207660_10038236 3300025917 Bacteria 3349
127 Ga0207662_10229801 3300025918 Bacteria 1211
128 Ga0207681_10040802 3300025923 Bacteria 3090
129 Ga0207681_10667606 3300025923 Bacteria 862
130 Ga0207659_10076421 3300025926 Bacteria 2461
131 Ga0207659_10100969 3300025926 Bacteria 2175
132 Ga0207659_10720507 3300025926 Bacteria 855
133 Ga0207644_10048107 3300025931 Bacteria 3047
134 Ga0207706_10416481 3300025933 Bacteria 1164
135 Ga0207709_10193062 3300025935 Bacteria 1448
136 Ga0207709_10271627 3300025935 Bacteria 1248
137 Ga0207670_10086596 3300025936 Bacteria 2205
138 Ga0207670_10192589 3300025936 Bacteria 1544
139 Ga0207670_11289468 3300025936 Bacteria 619
140 Ga0207669_10008583 3300025937 Bacteria 4806
141 Ga0207704_10089483 3300025938 Bacteria 2017
142 Ga0207704_10833082 3300025938 Bacteria 772
143 Ga0207691_10001936 3300025940 Bacteria 20208
144 Ga0207691_10531841 3300025940 Bacteria 997
145 Ga0207689_10264186 3300025942 Bacteria 1424
146 Ga0207651_10024441 3300025960 Bacteria 3738
147 Ga0207651_10247825 3300025960 Bacteria 1456
148 Ga0207712_10062768 3300025961 Bacteria 2642
149 Ga0207668_10033357 3300025972 Bacteria 3410
150 Ga0207668_10374008 3300025972 Bacteria 1197
151 Ga0207668_11294634 3300025972 Bacteria 656
152 Ga0207658_10193532 3300025986 Bacteria 1693
153 Ga0207658_10448162 3300025986 Bacteria 1142
154 Ga0207658_11021598 3300025986 Bacteria 754
155 Ga0207703_10121919 3300026035 Bacteria 2239
156 Ga0207678_10245978 3300026067 Bacteria 1532
157 Ga0207708_10039456 3300026075 Bacteria 3598
158 Ga0207708_10079080 3300026075 Bacteria 2526
159 Ga0207648_10015540 3300026089 Bacteria 6996
160 Ga0207648_10160610 3300026089 Bacteria 1985
161 Ga0207648_10309289 3300026089 Bacteria 1418
162 Ga0207648_10488668 3300026089 Bacteria 1125
163 Ga0207648_10942147 3300026089 Bacteria 807
164 Ga0207676_10071025 3300026095 Bacteria 2794
165 Ga0207675_100004251 3300026118 Bacteria 13850
166 Ga0207675_100019861 3300026118 Bacteria 6270
167 Ga0207675_100207846 3300026118 Bacteria 1882
168 Ga0207675_100217908 3300026118 Bacteria 1838
169 Ga0207675_100765195 3300026118 Bacteria 977
170 Ga0207683_10381445 3300026121 Bacteria 1296
171 Ga0207683_10963352 3300026121 Bacteria 792
172 Ga0207428_10105424 3300027907 Bacteria 2174
173 Ga0268266_10505741 3300028379 Bacteria 1154
174 Ga0268265_10010936 3300028380 Bacteria 6128
175 Ga0268265_10023406 3300028380 Bacteria 4353
176 Ga0268265_10159610 3300028380 Bacteria 1913
177 Ga0268265_10514560 3300028380 Bacteria 1130
178 Ga0268264_10343117 3300028381 Bacteria 1419
179 Ga0307515_10277669 3300028794 Bacteria 1387
180 Ga0307405_10680799 3300031731 Bacteria 849
181 Ga0307410_10423981 3300031852 Bacteria 1080
182 Ga0307407_10752984 3300031903 Bacteria 738
183 Ga0307412_10257136 3300031911 Bacteria 1359
184 Ga0307412_10507711 3300031911 Bacteria 1005
185 Ga0307416_100044665 3300032002 Bacteria 3481
186 Ga0307416_100340780 3300032002 Bacteria 1512
187 Ga0373942_0006208 3300035207 Bacteria 2759
188 Ga0373931_0117797 3300035691 Bacteria 1515
189 Ga0242420_062925 3300038996 Bacteria 743
190 Ga0436360_0467950 3300039438 Bacteria 1345
191 Ga0439438_141466 3300041405 Bacteria 575
192 Ga0439466_0093627 3300041411 Bacteria 941
193 Ga0439445_0125403 3300042004 Bacteria 739
194 Ga0439448_0092065 3300042005 Bacteria 1025
195 Ga0439455_0004623 3300042012 Bacteria 2742
196 Ga0439463_128287 3300042016 Bacteria 656
197 Ga0450888_012898 3300042126 Bacteria 995
198 Ga0439434_0017849 3300042435 Bacteria 2124
199 Ga0439434_0046065 3300042435 Bacteria 1346
200 Ga0439459_0024017 3300042438 Bacteria 1193
201 Ga0439459_0076271 3300042438 Bacteria 784
202 Ga0439464_0067651 3300042439 Bacteria 1053
203 Ga0439460_0083831 3300042461 Bacteria 1004
204 Ga0495598_0003360 3300046537 Bacteria 3394
205 Ga0495598_0118760 3300046537 Bacteria 894
206 Ga0495621_0155391 3300046539 Bacteria 902
207 Ga0501032_0203024 3300049569 Bacteria 1293
208 Ga0501033_0218660 3300049570 Bacteria 1356
209 Ga0501033_0226626 3300049570 Bacteria 1329
210 Ga0501033_0315254 3300049570 Bacteria 1099
211 Ga0501034_0000286 3300049571 Bacteria 90126
212 Ga0501034_0092700 3300049571 Bacteria 3017
213 Ga0501034_0622164 3300049571 Bacteria 983
214 Ga0501034_1183328 3300049571 Bacteria 643
215 Ga0501036_0003981 3300049572 Bacteria 11871
216 Ga0501036_0219838 3300049572 Bacteria 1595
217 Ga0501036_0321631 3300049572 Bacteria 1292
218 Ga0501038_0105291 3300049574 Bacteria 2343
219 Ga0501038_0193091 3300049574 Bacteria 1637
220 Ga0501038_0283902 3300049574 Bacteria 1302
221 Ga0501038_0656029 3300049574 Bacteria 789
222 Ga0501039_0004314 3300049575 Bacteria 10721
223 Ga0501039_0287130 3300049575 Bacteria 1293
224 Ga0501039_1076499 3300049575 Bacteria 623
225 Ga0501040_0109009 3300049576 Bacteria 1936
226 Ga0501041_0040012 3300049577 Bacteria 2845
227 Ga0501042_0048246 3300049578 Bacteria 3036
228 Ga0501042_0569739 3300049578 Bacteria 823
229 Ga0501046_0240875 3300049580 Bacteria 1334
230 Ga0501046_0565340 3300049580 Bacteria 809
231 Ga0501047_0683998 3300049581 Bacteria 844
232 Ga0501048_0011082 3300049582 Bacteria 6721
233 Ga0501067_0106468 3300049583 Bacteria 1558
234 Ga0501068_0084753 3300049584 Bacteria 1949
235 Ga0501069_0756840 3300049585 Bacteria 587
236 Ga0501070_1260678 3300049586 Bacteria 565
237 Ga0501071_0373814 3300049587 Bacteria 1086
238 Ga0501071_0950165 3300049587 Bacteria 663
239 Ga0501072_0030801 3300049588 Bacteria 4197
240 Ga0501072_0042427 3300049588 Bacteria 3573
241 Ga0501072_0210159 3300049588 Bacteria 1551
242 Ga0501072_0381820 3300049588 Bacteria 1118
243 Ga0501072_0381999 3300049588 Bacteria 1118
244 Ga0501072_0681594 3300049588 Bacteria 808
245 Ga0501073_0160868 3300049589 Bacteria 1556
246 Ga0501073_0365188 3300049589 Bacteria 997
247 Ga0501073_0872305 3300049589 Bacteria 620
248 Ga0501074_0021456 3300049590 Bacteria 4689
249 Ga0501075_0000820 3300049591 Bacteria 19501
250 Ga0501075_0043364 3300049591 Bacteria 3374
251 Ga0501075_0057127 3300049591 Bacteria 2938
252 Ga0501075_0819740 3300049591 Bacteria 708
253 Ga0501076_0043419 3300049592 Bacteria 3542
254 Ga0501076_0050502 3300049592 Bacteria 3290
255 Ga0501076_0186124 3300049592 Bacteria 1694
256 Ga0501076_0201951 3300049592 Bacteria 1623
257 Ga0501076_0672889 3300049592 Bacteria 854
258 Ga0501076_1395072 3300049592 Bacteria 576
259 Ga0501079_0009527 3300049741 Bacteria 7364
260 Ga0501079_0043356 3300049741 Bacteria 3472
261 Ga0501079_0180987 3300049741 Bacteria 1645
262 Ga0501079_0355317 3300049741 Bacteria 1148
263 Ga0501079_0408743 3300049741 Bacteria 1065
264 Ga0501080_0162765 3300049742 Bacteria 2060
265 Ga0501080_0182834 3300049742 Bacteria 1928
266 Ga0501080_1026859 3300049742 Bacteria 714
267 Ga0501081_0002012 3300049743 Bacteria 12657
268 Ga0501081_0044154 3300049743 Bacteria 3059
269 Ga0501081_0074658 3300049743 Bacteria 2366
270 Ga0501083_0094488 3300049744 Bacteria 1973
271 Ga0501035_0092877 3300049822 Bacteria 2655
272 Ga0501035_0132863 3300049822 Bacteria 2169
273 Ga0501045_0003085 3300049824 Bacteria 11391
274 Ga0501045_0035234 3300049824 Bacteria 3633
275 Ga0501045_0146014 3300049824 Bacteria 1759
276 nmdc:mga03683_156184_c1 3300050489 Bacteria 1031
277 nmdc:mga03683_176835_c1 3300050489 Bacteria 972
278 nmdc:mga03683_55102_c1 3300050489 Bacteria 1669
279 nmdc:mga03n38_8108_c1 3300050490 Bacteria 3751
280 nmdc:mga00v17_453613_c1 3300050491 Bacteria 832
281 nmdc:mga0yw44_692815_c1 3300050492 Bacteria 692
282 nmdc:mga06z11_187108_c1 3300050494 Bacteria 1197
283 nmdc:mga07m45_232031_c1 3300050496 Bacteria 1074
284 nmdc:mga05p37_530_c1 3300050507 Bacteria 42063
285 nmdc:mga09592_43586_c1 3300050508 Bacteria 3775
286 nmdc:mga09592_58_c1 3300050508 Bacteria 61599
287 nmdc:mga09592_689596_c1 3300050508 Bacteria 870
288 nmdc:mga0qj67_299945_c1 3300050509 Bacteria 1302
289 nmdc:mga06r32_330267_c1 3300050510 Bacteria 1510
290 nmdc:mga06r32_4369_c1 3300050510 Bacteria 12643
291 nmdc:mga08y16_355243_c1 3300050511 Bacteria 1505
292 nmdc:mga08y16_593787_c1 3300050511 Bacteria 1117
293 nmdc:mga08y16_819581_c1 3300050511 Bacteria 922
294 nmdc:mga08y16_8690_c1 3300050511 Bacteria 10654
295 nmdc:mga0n895_1260623_c1 3300050512 Bacteria 711
296 nmdc:mga0sz30_44255_c1 3300050516 Bacteria 1464
297 nmdc:mga0sz30_449553_c1 3300050516 Bacteria 578
298 nmdc:mga0sz30_83093_c1 3300050516 Bacteria 1387
299 Ga0500641_0018520 3300053096 Bacteria 2620
300 Ga0501084_0143734 3300054114 Bacteria 2009
301 Ga0501082_0141654 3300060353 Bacteria 2087
302 Ga0501082_0607040 3300060353 Bacteria 957
303 Ga0530510_0001422 3300061734 Bacteria 16023
304 Ga0530510_0004248 3300061734 Bacteria 9905
305 2508732110 2508501050 Bacteria 9633614
306 Ga0307412_10722009
307 JGI25406J46586_10001102
308 Ga0065707_10088559
309 Ga0065707_10167618
310 Ga0065707_10352905
311 Ga0070676_10342520
312 Ga0070690_100184569
313 Ga0070677_10025777
314 Ga0068869_100160915
315 Ga0070666_10359702
316 Ga0070666_10407624
317 Ga0070689_100059716
318 Ga0070689_100102840
319 Ga0070689_100875123
320 Ga0070691_10202279
321 Ga0070687_100340466
322 Ga0070692_10333874
323 Ga0070668_100078399
324 Ga0070668_100440213
325 Ga0070668_100550071
326 Ga0070669_100126732
327 Ga0070669_100198759
328 Ga0070675_100074243
329 Ga0070675_100146899
330 Ga0070671_100119885
331 Ga0070671_100784465
332 Ga0070674_100006942
333 Ga0070674_100742215
334 Ga0070674_100912981
335 Ga0070673_100031244
336 Ga0070673_100606768
337 Ga0070673_100792170
338 Ga0070667_100390925
339 Ga0070705_100015015
340 Ga0070700_100394747
341 Ga0070694_100076412
342 Ga0070663_100228591
343 Ga0070678_101061060
344 Ga0068867_100012175
345 Ga0068867_100120483
346 Ga0068867_100426391
347 Ga0070685_10277052
348 Ga0070672_100053502
349 Ga0070672_100148030
350 Ga0070672_100233833
351 Ga0070686_100816813
352 Ga0070665_100175935
353 Ga0070704_100110298
354 Ga0070704_100555389
355 Ga0068857_100578826
356 Ga0068866_10186684
357 Ga0068861_100006161
358 Ga0068861_100069576
359 Ga0068861_100200190
360 Ga0068861_100660752
361 Ga0068861_100828608
362 Ga0068863_100101084
363 Ga0068863_101085623
364 Ga0068858_100181986
365 Ga0068860_100524414
366 Ga0068860_100595720
367 Ga0068862_100013884
368 Ga0068862_100094788
369 Ga0068862_100193479
370 Ga0081455_10002720
371 Ga0081538_10006860
372 Ga0081538_10054194
373 Ga0081540_1013624
374 Ga0081539_10000240
375 Ga0075365_10018839
376 Ga0075365_10081001
377 Ga0075365_10196377
378 Ga0075363_100015336
379 Ga0075364_10358853
380 Ga0075362_10001959
381 Ga0075362_10236048
382 Ga0075367_10149592
383 Ga0075367_10251472
384 Ga0075367_10264599
385 Ga0075369_10012020
386 Ga0075369_10427634
387 Ga0075366_10006381
388 Ga0075366_10014363
389 Ga0097621_101146445
390 Ga0075370_10065086
391 Ga0075370_10193205
392 Ga0075428_100199273
393 Ga0075428_100442996
394 Ga0075428_100661631
395 Ga0075431_100003718
396 Ga0075431_100019621
397 Ga0075431_101061137
398 Ga0075429_100220384
399 Ga0068865_100000733
400 Ga0068865_100019214
401 Ga0068865_100065516
402 Ga0068865_100199002
403 Ga0068865_101159314
404 Ga0097620_101632452
405 Ga0111539_10131348
406 Ga0111539_10583271
407 Ga0111539_10745180
408 Ga0111539_10825527
409 Ga0111539_10929086
410 Ga0105247_10771441
411 Ga0114129_10014733
412 Ga0105243_10251181
413 Ga0105243_10348066
414 Ga0105249_10114157
415 Ga0105249_10257702
416 Ga0105249_10500743
417 Ga0157378_10049067
418 Ga0157378_10132829
419 Ga0163162_10178269
420 Ga0157375_10224332
421 Ga0157375_10394532
422 Ga0157375_10776709
423 Ga0157380_10712356
424 Ga0157377_10581436
425 Ga0157379_10384707
426 Ga0207682_10000232
427 Ga0207688_10024614
428 Ga0207680_10313236
429 Ga0207645_10266417
430 Ga0207643_10205768
431 Ga0207660_10038236
432 Ga0207662_10229801
433 Ga0207681_10040802
434 Ga0207681_10667606
435 Ga0207659_10076421
436 Ga0207659_10100969
437 Ga0207659_10720507
438 Ga0207644_10048107
439 Ga0207706_10416481
440 Ga0207709_10193062
441 Ga0207709_10271627
442 Ga0207670_10086596
443 Ga0207670_10192589
444 Ga0207670_11289468
445 Ga0207669_10008583
446 Ga0207704_10089483
447 Ga0207704_10833082
448 Ga0207691_10001936
449 Ga0207691_10531841
450 Ga0207689_10264186
451 Ga0207651_10024441
452 Ga0207651_10247825
453 Ga0207712_10062768
454 Ga0207668_10033357
455 Ga0207668_10374008
456 Ga0207668_11294634
457 Ga0207658_10193532
458 Ga0207658_10448162
459 Ga0207658_11021598
460 Ga0207703_10121919
461 Ga0207678_10245978
462 Ga0207708_10039456
463 Ga0207708_10079080
464 Ga0207648_10015540
465 Ga0207648_10160610
466 Ga0207648_10309289
467 Ga0207648_10488668
468 Ga0207648_10942147
469 Ga0207676_10071025
470 Ga0207675_100004251
471 Ga0207675_100019861
472 Ga0207675_100207846
473 Ga0207675_100217908
474 Ga0207675_100765195
475 Ga0207683_10381445
476 Ga0207683_10963352
477 Ga0207428_10105424
478 Ga0268266_10505741
479 Ga0268265_10010936
480 Ga0268265_10023406
481 Ga0268265_10159610
482 Ga0268265_10514560
483 Ga0268264_10343117
484 Ga0307515_10277669
485 Ga0307405_10680799
486 Ga0307410_10423981
487 Ga0307407_10752984
488 Ga0307412_10257136
489 Ga0307412_10507711
490 Ga0307416_100044665
491 Ga0307416_100340780
492 Ga0373942_0006208
493 Ga0373931_0117797
494 Ga0242420_062925
495 Ga0436360_0467950
496 Ga0439438_141466
497 Ga0439466_0093627
498 Ga0439445_0125403
499 Ga0439448_0092065
500 Ga0439455_0004623
501 Ga0439463_128287
502 Ga0450888_012898
503 Ga0439434_0017849
504 Ga0439434_0046065
505 Ga0439459_0024017
506 Ga0439459_0076271
507 Ga0439464_0067651
508 Ga0439460_0083831
509 Ga0495598_0003360
510 Ga0495598_0118760
511 Ga0495621_0155391
512 Ga0501032_0203024
513 Ga0501033_0218660
514 Ga0501033_0226626
515 Ga0501033_0315254
516 Ga0501034_0000286
517 Ga0501034_0092700
518 Ga0501034_0622164
519 Ga0501034_1183328
520 Ga0501036_0003981
521 Ga0501036_0219838
522 Ga0501036_0321631
523 Ga0501038_0105291
524 Ga0501038_0193091
525 Ga0501038_0283902
526 Ga0501038_0656029
527 Ga0501039_0004314
528 Ga0501039_0287130
529 Ga0501039_1076499
530 Ga0501040_0109009
531 Ga0501041_0040012
532 Ga0501042_0048246
533 Ga0501042_0569739
534 Ga0501046_0240875
535 Ga0501046_0565340
536 Ga0501047_0683998
537 Ga0501048_0011082
538 Ga0501067_0106468
539 Ga0501068_0084753
540 Ga0501069_0756840
541 Ga0501070_1260678
542 Ga0501071_0373814
543 Ga0501071_0950165
544 Ga0501072_0030801
545 Ga0501072_0042427
546 Ga0501072_0210159
547 Ga0501072_0381820
548 Ga0501072_0381999
549 Ga0501072_0681594
550 Ga0501073_0160868
551 Ga0501073_0365188
552 Ga0501073_0872305
553 Ga0501074_0021456
554 Ga0501075_0000820
555 Ga0501075_0043364
556 Ga0501075_0057127
557 Ga0501075_0819740
558 Ga0501076_0043419
559 Ga0501076_0050502
560 Ga0501076_0186124
561 Ga0501076_0201951
562 Ga0501076_0672889
563 Ga0501076_1395072
564 Ga0501079_0009527
565 Ga0501079_0043356
566 Ga0501079_0180987
567 Ga0501079_0355317
568 Ga0501079_0408743
569 Ga0501080_0162765
570 Ga0501080_0182834
571 Ga0501080_1026859
572 Ga0501081_0002012
573 Ga0501081_0044154
574 Ga0501081_0074658
575 Ga0501083_0094488
576 Ga0501035_0092877
577 Ga0501035_0132863
578 Ga0501045_0003085
579 Ga0501045_0035234
580 Ga0501045_0146014
581 nmdc:mga03683_156184_c1
582 nmdc:mga03683_176835_c1
583 nmdc:mga03683_55102_c1
584 nmdc:mga03n38_8108_c1
585 nmdc:mga00v17_453613_c1
586 nmdc:mga0yw44_692815_c1
587 nmdc:mga06z11_187108_c1
588 nmdc:mga07m45_232031_c1
589 nmdc:mga05p37_530_c1
590 nmdc:mga09592_43586_c1
591 nmdc:mga09592_58_c1
592 nmdc:mga09592_689596_c1
593 nmdc:mga0qj67_299945_c1
594 nmdc:mga06r32_330267_c1
595 nmdc:mga06r32_4369_c1
596 nmdc:mga08y16_355243_c1
597 nmdc:mga08y16_593787_c1
598 nmdc:mga08y16_819581_c1
599 nmdc:mga08y16_8690_c1
600 nmdc:mga0n895_1260623_c1
601 nmdc:mga0sz30_44255_c1
602 nmdc:mga0sz30_449553_c1
603 nmdc:mga0sz30_83093_c1
604 Ga0500641_0018520
605 Ga0501084_0143734
606 Ga0501082_0141654
607 Ga0501082_0607040
608 Ga0530510_0001422
609 Ga0530510_0004248
610 2508732110

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04290

DctQ

Tripartite ATP-independent periplasmic transporters, DctQ component

34

165

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qha-assembly1.cif.gz_A cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol 0.7829 15 162
7qha-assembly1.cif.gz_A cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol 0.7551 15 162
8thj-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) 0.672 11 165
8thj-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) 0.603 11 165
1w0b-assembly1.cif.gz_A solution structure of the human alpha-hemoglobin stabilizing protein (ahsp) p30a mutant 0.5064 62 169
ID Description Score Start End Superfamily
5hxrA01 Special;Helix non-globular;Methane Monooxygenase Hydroxylase; Chain G, domain 1;NCX, peripheral helical region 0.8217 94 163 6.10.280.80
af_P37674_16_146_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7853 35 160 1.20.120.550
5jdhA01 Special;Helix non-globular;Methane Monooxygenase Hydroxylase; Chain G, domain 1;NCX, peripheral helical region 0.7724 91 163 6.10.280.80
af_P37674_16_146_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7537 35 160 1.20.120.550
5hxrA01 Special;Helix non-globular;Methane Monooxygenase Hydroxylase; Chain G, domain 1;NCX, peripheral helical region 0.707 94 163 6.10.280.80
ID Description Score Start End GO Terms
AF-A0A1G6VJW4-F1-model_v4 TRAP transporter small permease protein 0.9101 7 165 GO:0005886
GO:0015740
GO:0022857
AF-A0A4Q4CXK4-F1-model_v4 TRAP transporter small permease protein 0.9079 7 165 GO:0005886
GO:0015740
GO:0022857
AF-A0A2N1SMF8-F1-model_v4 TRAP transporter small permease 0.9036 10 165 GO:0005886
GO:0015740
GO:0022857
AF-A0A849TAC1-F1-model_v4 TRAP transporter small permease protein 0.8989 4 165 GO:0005886
GO:0015740
GO:0022857
AF-A0A1V2GUU8-F1-model_v4 TRAP transporter small permease protein 0.8965 11 167 GO:0005886
GO:0015740
GO:0022857

Map