F398068

General Info

Members Datasets Scaffolds Average Seq Length
305 216 300 152

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10287017|Ga0075433_102870172
Length 173
Sequence MARRAVWAILDLSLLSERTVMVEVGQPAPDFELPDQNGEPVRLSELRGQRVVVYFYPKADTPGCTTQACGIRDHTADYDAAGAEVLGISPDPVEDVKKFADKFDLRFHLLADADHAVADTYGVWVEKTKYGRTYWGNERTTFVIDADGRVAEVLRNVKPAEHDDLVLGALSGV

Samples

Sample ID Description Type Environment
1 2651869818 Vibrio splendidus UCD-SED10 Isolate Rhizosphere
2 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
3 2919497567 Shewanella putrefaciens 3469 Isolate Unclassified
4 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
5 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
121 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
122 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
123 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
124 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
125 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
126 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
127 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
128 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
129 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
130 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
131 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
132 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
133 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
134 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
139 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
140 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
141 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
142 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
143 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
144 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
145 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
146 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
147 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
148 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
149 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
150 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
155 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
156 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
157 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
158 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
159 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
160 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
161 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
162 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
163 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
164 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
176 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
192 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
193 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
194 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
195 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
196 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
197 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
198 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
199 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
200 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
201 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
204 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
205 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
206 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
207 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
208 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
209 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
210 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
211 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
212 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
213 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
214 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
215 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
216 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.36
Metatranscriptomes 0
Isolates 1.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.98
Nodule 0
Rhizoplane 4.59
Rhizosphere 92.13
Stem 0
Stem Tuber 0
Unclassified 2.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065714_10074682 3300005288 Bacteria 3004
2 Ga0070683_100373892 3300005329 Bacteria 1358
3 Ga0070680_100274325 3300005336 Bacteria 1428
4 Ga0070682_100032463 3300005337 Bacteria 3166
5 Ga0068868_100079689 3300005338 Bacteria 2623
6 Ga0068868_100251544 3300005338 Bacteria 1487
7 Ga0068868_100428585 3300005338 Bacteria 1146
8 Ga0068868_100512505 3300005338 Bacteria 1052
9 Ga0070661_100156557 3300005344 Bacteria 1724
10 Ga0070692_10185026 3300005345 Bacteria 1210
11 Ga0070668_100997222 3300005347 Bacteria 752
12 Ga0070675_100352017 3300005354 Bacteria 1306
13 Ga0070675_101044733 3300005354 Bacteria 751
14 Ga0070673_100207312 3300005364 Bacteria 1691
15 Ga0070667_100210818 3300005367 Bacteria 1726
16 Ga0070709_11026492 3300005434 Bacteria 657
17 Ga0070710_10237707 3300005437 Bacteria 1166
18 Ga0070711_100623141 3300005439 Bacteria 902
19 Ga0070700_100002408 3300005441 Bacteria 9535
20 Ga0070708_100068104 3300005445 Bacteria 3199
21 Ga0070708_101349016 3300005445 Bacteria 666
22 Ga0070663_100109262 3300005455 Bacteria 2076
23 Ga0070681_10018848 3300005458 Bacteria 6906
24 Ga0068867_100058762 3300005459 Bacteria 2850
25 Ga0068867_101330119 3300005459 Bacteria 664
26 Ga0070679_100004965 3300005530 Bacteria 12282
27 Ga0070684_100246177 3300005535 Bacteria 1634
28 Ga0070697_100484559 3300005536 Bacteria 1080
29 Ga0070695_101107347 3300005545 Bacteria 648
30 Ga0070665_101292271 3300005548 Bacteria 740
31 Ga0070704_100876651 3300005549 Bacteria 806
32 Ga0068855_100448994 3300005563 Bacteria 1407
33 Ga0068855_102358444 3300005563 Bacteria 532
34 Ga0070664_100812641 3300005564 Bacteria 875
35 Ga0070664_102116301 3300005564 Bacteria 534
36 Ga0068857_100091005 3300005577 Bacteria 2730
37 Ga0068857_100604703 3300005577 Bacteria 1037
38 Ga0068856_100030271 3300005614 Bacteria 5291
39 Ga0070702_100028226 3300005615 Bacteria 3040
40 Ga0068864_100588448 3300005618 Bacteria 1079
41 Ga0068866_10297922 3300005718 Bacteria 1006
42 Ga0068863_100340290 3300005841 Bacteria 1459
43 Ga0068858_100007802 3300005842 Bacteria 10332
44 Ga0068860_100009357 3300005843 Bacteria 9736
45 Ga0081538_10002606 3300005981 Bacteria 17484
46 Ga0081538_10014149 3300005981 Bacteria 6268
47 Ga0081538_10063147 3300005981 Bacteria 2105
48 Ga0081540_1028862 3300005983 Bacteria 3103
49 Ga0081540_1040320 3300005983 Bacteria 2435
50 Ga0070712_100162196 3300006175 Bacteria 1727
51 Ga0070712_100926776 3300006175 Bacteria 752
52 Ga0070712_101215591 3300006175 Bacteria 656
53 Ga0097621_100092231 3300006237 Bacteria 2536
54 Ga0097621_100100970 3300006237 Bacteria 2427
55 Ga0068871_100143126 3300006358 Bacteria 2034
56 Ga0068871_100466027 3300006358 Bacteria 1134
57 Ga0075428_101819444 3300006844 Bacteria 634
58 Ga0075431_100051293 3300006847 Bacteria 4255
59 Ga0075431_100410869 3300006847 Bacteria 1354
60 Ga0075433_10287017 3300006852 Bacteria 1458
61 Ga0075434_100200666 3300006871 Bacteria 2014
62 Ga0068865_100147499 3300006881 Bacteria 1781
63 Ga0075436_100022562 3300006914 Bacteria 4322
64 Ga0105240_10013554 3300009093 Bacteria 11189
65 Ga0105240_10372893 3300009093 Bacteria 1613
66 Ga0111539_10786780 3300009094 Bacteria 1107
67 Ga0105245_10001860 3300009098 Bacteria 19182
68 Ga0105245_10017667 3300009098 Bacteria 6226
69 Ga0105245_10138089 3300009098 Bacteria 2293
70 Ga0105247_10204203 3300009101 Bacteria 1329
71 Ga0105247_10329335 3300009101 Bacteria 1068
72 Ga0114129_10321950 3300009147 Bacteria 2055
73 Ga0114129_11111667 3300009147 Bacteria 989
74 Ga0105243_10235100 3300009148 Bacteria 1628
75 Ga0105243_10727900 3300009148 Bacteria 970
76 Ga0105243_10941240 3300009148 Bacteria 862
77 Ga0105242_10203114 3300009176 Bacteria 1761
78 Ga0105242_10279206 3300009176 Bacteria 1516
79 Ga0105242_10770828 3300009176 Bacteria 949
80 Ga0105242_10868416 3300009176 Bacteria 899
81 Ga0105242_11400628 3300009176 Unclassified 726
82 Ga0105248_10272473 3300009177 Bacteria 1906
83 Ga0105248_10273559 3300009177 Unclassified 1902
84 Ga0105248_10695987 3300009177 Bacteria 1147
85 Ga0105237_11064891 3300009545 Bacteria 815
86 Ga0105238_10049828 3300009551 Bacteria 4217
87 Ga0105249_10397271 3300009553 Bacteria 1408
88 Ga0105239_10315813 3300010375 Bacteria 1761
89 Ga0105239_10393966 3300010375 Bacteria 1567
90 Ga0105246_10014340 3300011119 Bacteria 4984
91 Ga0105246_10367683 3300011119 Bacteria 1184
92 Ga0157370_10071463 3300013104 Bacteria 3274
93 Ga0157369_10727860 3300013105 Bacteria 1021
94 Ga0157374_10190792 3300013296 Bacteria 2004
95 Ga0157374_10322084 3300013296 Bacteria 1532
96 Ga0157378_10127678 3300013297 Bacteria 2351
97 Ga0163162_10144517 3300013306 Bacteria 2494
98 Ga0163162_10320532 3300013306 Bacteria 1682
99 Ga0157372_11087430 3300013307 Bacteria 925
100 Ga0157375_10281644 3300013308 Bacteria 1825
101 Ga0163163_10014430 3300014325 Bacteria 7262
102 Ga0163163_10833189 3300014325 Bacteria 986
103 Ga0157380_10010302 3300014326 Bacteria 6721
104 Ga0182008_10191441 3300014497 Bacteria 1038
105 Ga0157377_10011559 3300014745 Bacteria 4412
106 Ga0157377_11490980 3300014745 Bacteria 537
107 Ga0157379_10119644 3300014968 Bacteria 2369
108 Ga0157376_10011621 3300014969 Bacteria 6499
109 Ga0157376_10986379 3300014969 Bacteria 864
110 Ga0213875_10074832 3300021388 Bacteria 1580
111 Ga0207642_10183348 3300025899 Bacteria 1142
112 Ga0207642_10204137 3300025899 Bacteria 1094
113 Ga0207642_10369574 3300025899 Bacteria 851
114 Ga0207710_10208313 3300025900 Bacteria 967
115 Ga0207688_10023342 3300025901 Bacteria 3387
116 Ga0207680_10034308 3300025903 Bacteria 2903
117 Ga0207645_10074013 3300025907 Bacteria 2181
118 Ga0207654_10316228 3300025911 Bacteria 1066
119 Ga0207707_10003370 3300025912 Bacteria 14184
120 Ga0207695_10036793 3300025913 Bacteria 5287
121 Ga0207671_10285301 3300025914 Bacteria 1303
122 Ga0207671_10589188 3300025914 Bacteria 886
123 Ga0207693_10062714 3300025915 Bacteria 2912
124 Ga0207693_10375891 3300025915 Bacteria 1111
125 Ga0207652_10003837 3300025921 Bacteria 12331
126 Ga0207652_10115658 3300025921 Bacteria 2382
127 Ga0207694_10339368 3300025924 Bacteria 1242
128 Ga0207687_10001660 3300025927 Bacteria 15354
129 Ga0207687_10050762 3300025927 Bacteria 2889
130 Ga0207687_11617913 3300025927 Bacteria 556
131 Ga0207664_10248952 3300025929 Bacteria 1550
132 Ga0207690_10604830 3300025932 Bacteria 895
133 Ga0207706_10427282 3300025933 Bacteria 1147
134 Ga0207686_10046515 3300025934 Unclassified 2677
135 Ga0207686_10095832 3300025934 Bacteria 1970
136 Ga0207686_10635433 3300025934 Bacteria 843
137 Ga0207686_11326340 3300025934 Bacteria 591
138 Ga0207709_10321640 3300025935 Bacteria 1158
139 Ga0207669_10428895 3300025937 Bacteria 1042
140 Ga0207704_10348570 3300025938 Bacteria 1152
141 Ga0207665_10078490 3300025939 Bacteria 2268
142 Ga0207711_10740867 3300025941 Unclassified 916
143 Ga0207689_10054380 3300025942 Bacteria 3297
144 Ga0207689_10310723 3300025942 Bacteria 1307
145 Ga0207661_10426712 3300025944 Bacteria 1205
146 Ga0207661_11140214 3300025944 Bacteria 718
147 Ga0207679_10302540 3300025945 Bacteria 1379
148 Ga0207679_10634055 3300025945 Bacteria 965
149 Ga0207667_10154181 3300025949 Bacteria 2364
150 Ga0207667_10216779 3300025949 Bacteria 1961
151 Ga0207667_10242097 3300025949 Bacteria 1846
152 Ga0207651_10176867 3300025960 Bacteria 1689
153 Ga0207677_10085519 3300026023 Bacteria 2277
154 Ga0207677_10170994 3300026023 Bacteria 1699
155 Ga0207677_10260079 3300026023 Bacteria 1414
156 Ga0207703_10216787 3300026035 Unclassified 1709
157 Ga0207703_11621412 3300026035 Bacteria 622
158 Ga0207678_10149216 3300026067 Bacteria 1996
159 Ga0207708_10002521 3300026075 Bacteria 13466
160 Ga0207702_10607886 3300026078 Bacteria 1073
161 Ga0207641_10410915 3300026088 Bacteria 1301
162 Ga0207648_10005008 3300026089 Bacteria 13454
163 Ga0207648_10039785 3300026089 Bacteria 4133
164 Ga0207648_10278804 3300026089 Bacteria 1495
165 Ga0207676_11230753 3300026095 Bacteria 742
166 Ga0207674_10012794 3300026116 Bacteria 9369
167 Ga0207674_10865065 3300026116 Bacteria 872
168 Ga0207675_100507058 3300026118 Bacteria 1202
169 Ga0207683_10020677 3300026121 Bacteria 5631
170 Ga0207698_12170374 3300026142 Bacteria 568
171 Ga0268266_10471029 3300028379 Bacteria 1196
172 Ga0268264_10130111 3300028381 Bacteria 2230
173 Ga0265337_1000762 3300028556 Bacteria 16965
174 Ga0265326_10000666 3300028558 Bacteria 12742
175 Ga0265319_1000034 3300028563 Bacteria 117363
176 Ga0265319_1000065 3300028563 Bacteria 85273
177 Ga0265318_10000518 3300028577 Bacteria 27733
178 Ga0265336_10000001 3300028666 Bacteria 916179
179 Ga0265338_10000004 3300028800 Bacteria 644793
180 Ga0265338_10311574 3300028800 Bacteria 1141
181 Ga0265324_10013592 3300029957 Bacteria 3031
182 Ga0265330_10043343 3300031235 Bacteria 1991
183 Ga0265320_10016927 3300031240 Bacteria 4066
184 Ga0265340_10000002 3300031247 Bacteria 711693
185 Ga0265327_10238586 3300031251 Bacteria 813
186 Ga0265316_10008742 3300031344 Bacteria 9368
187 Ga0265314_10023282 3300031711 Bacteria 4725
188 Ga0265342_10106034 3300031712 Bacteria 1595
189 Ga0307406_10479316 3300031901 Bacteria 1004
190 Ga0307415_100540649 3300032126 Bacteria 1026
191 Ga0436364_0918908 3300037853 Bacteria 4863
192 Ga0395901_0347224 3300038443 Bacteria 1532
193 Ga0436365_0986987 3300039437 Bacteria 8602
194 Ga0436361_0346645 3300039447 Bacteria 577
195 Ga0436363_1571582 3300039450 Bacteria 586
196 Ga0436362_1185631 3300039453 Bacteria 1350
197 Ga0436362_1238080 3300039453 Bacteria 677
198 Ga0439450_008554 3300042008 Bacteria 1913
199 Ga0439440_0028017 3300042993 Bacteria 1313
200 Ga0466966_0042179 3300044684 Bacteria 2931
201 Ga0466961_0008887 3300044693 Bacteria 6407
202 Ga0466963_0072737 3300044694 Bacteria 2316
203 Ga0466964_0148716 3300044706 Bacteria 1084
204 Ga0466971_0003614 3300044719 Bacteria 6605
205 Ga0466968_0702324 3300044735 Bacteria 516
206 Ga0466970_0022627 3300044765 Bacteria 3281
207 Ga0466970_0135457 3300044765 Bacteria 1355
208 Ga0466959_0616238 3300045049 Bacteria 729
209 Ga0466958_0004797 3300045836 Bacteria 7195
210 Ga0466958_0565451 3300045836 Bacteria 739
211 Ga0466967_0913638 3300045976 Bacteria 873
212 Ga0495580_0236151 3300046472 Bacteria 1254
213 Ga0495605_0186773 3300046474 Bacteria 909
214 Ga0495584_0208200 3300046491 Bacteria 994
215 Ga0495628_0409122 3300046516 Bacteria 990
216 Ga0495640_0212575 3300046533 Bacteria 1222
217 Ga0495645_0425155 3300046543 Bacteria 842
218 Ga0495668_0154458 3300046616 Bacteria 1257
219 Ga0495635_0074038 3300046663 Bacteria 2333
220 Ga0495635_0329687 3300046663 Bacteria 1021
221 Ga0495604_0189957 3300047317 Bacteria 1432
222 Ga0495676_0690624 3300047321 Bacteria 661
223 Ga0495602_0809257 3300048088 Bacteria 629
224 Ga0496101_0744076 3300048904 Bacteria 774
225 Ga0496105_0122269 3300048908 Bacteria 2146
226 Ga0496106_0334062 3300048909 Bacteria 1217
227 Ga0496107_0112480 3300048910 Bacteria 2002
228 Ga0496108_0049880 3300048911 Bacteria 3501
229 Ga0496109_0059190 3300048912 Bacteria 3500
230 Ga0496110_0053311 3300048913 Bacteria 3555
231 Ga0496111_0193996 3300048914 Bacteria 1510
232 Ga0496112_0450415 3300048915 Bacteria 1225
233 Ga0496113_0469142 3300048916 Bacteria 1011
234 Ga0496113_0557245 3300048916 Bacteria 919
235 Ga0496115_0077036 3300048918 Bacteria 2711
236 Ga0496115_0416453 3300048918 Bacteria 1089
237 Ga0496115_0501857 3300048918 Unclassified 975
238 Ga0501031_0117458 3300049568 Bacteria 1738
239 Ga0501031_0257305 3300049568 Bacteria 1134
240 Ga0501031_0334386 3300049568 Bacteria 981
241 Ga0501032_0136819 3300049569 Bacteria 1614
242 Ga0501033_0049040 3300049570 Bacteria 3135
243 Ga0501033_0366103 3300049570 Unclassified 1008
244 Ga0501034_0068087 3300049571 Bacteria 3571
245 Ga0501036_0013387 3300049572 Bacteria 6817
246 Ga0501036_0022934 3300049572 Bacteria 5255
247 Ga0501037_0082986 3300049573 Bacteria 2321
248 Ga0501038_0044873 3300049574 Bacteria 3838
249 Ga0501038_0764705 3300049574 Bacteria 720
250 Ga0501039_0602473 3300049575 Bacteria 861
251 Ga0501040_0071627 3300049576 Bacteria 2393
252 Ga0501041_0572966 3300049577 Bacteria 720
253 Ga0501042_0054163 3300049578 Bacteria 2861
254 Ga0501042_0671205 3300049578 Bacteria 753
255 Ga0501043_0068296 3300049579 Bacteria 2790
256 Ga0501043_0932697 3300049579 Bacteria 621
257 Ga0501046_0049419 3300049580 Bacteria 3326
258 Ga0501046_0778517 3300049580 Unclassified 671
259 Ga0501047_0306387 3300049581 Bacteria 1430
260 Ga0501048_0132574 3300049582 Bacteria 1761
261 Ga0501068_0070230 3300049584 Bacteria 2136
262 Ga0501070_0082813 3300049586 Bacteria 2655
263 Ga0501071_0051772 3300049587 Bacteria 2960
264 Ga0501071_0294868 3300049587 Bacteria 1229
265 Ga0501071_0390269 3300049587 Bacteria 1062
266 Ga0501071_0927444 3300049587 Unclassified 672
267 Ga0501072_0118143 3300049588 Bacteria 2112
268 Ga0501072_0266295 3300049588 Unclassified 1364
269 Ga0501072_0735611 3300049588 Bacteria 774
270 Ga0501073_0009321 3300049589 Bacteria 7242
271 Ga0501074_0086301 3300049590 Bacteria 2248
272 Ga0501076_0539942 3300049592 Bacteria 961
273 Ga0501077_0668281 3300049593 Bacteria 667
274 Ga0501077_0920171 3300049593 Unclassified 563
275 Ga0501080_0511797 3300049742 Unclassified 1072
276 Ga0501081_0005192 3300049743 Bacteria 8385
277 Ga0501081_0483690 3300049743 Unclassified 922
278 Ga0501035_0051863 3300049822 Bacteria 3671
279 Ga0501044_0093919 3300049823 Bacteria 3024
280 Ga0501045_1087625 3300049824 Bacteria 585
281 nmdc:mga05p37_1430569_c1 3300050507 Bacteria 694
282 nmdc:mga05p37_174177_c1 3300050507 Bacteria 2622
283 nmdc:mga06r32_12409_c1 3300050510 Bacteria 7689
284 nmdc:mga06r32_756675_c1 3300050510 Bacteria 934
285 nmdc:mga08y16_92245_c1 3300050511 Bacteria 3156
286 nmdc:mga08y16_958920_c1 3300050511 Bacteria 838
287 nmdc:mga0n895_809548_c1 3300050512 Bacteria 927
288 nmdc:mga08x19_381307_c1 3300050514 Bacteria 987
289 nmdc:mga08x19_384534_c1 3300050514 Bacteria 983
290 nmdc:mga0a205_81003_c1 3300050515 Bacteria 3136
291 Ga0500556_0000362 3300053104 Bacteria 33773
292 Ga0500616_0006341 3300053153 Bacteria 7763
293 Ga0500599_000981 3300053736 Bacteria 3195
294 Ga0501084_0073796 3300054114 Bacteria 2857
295 Ga0501084_0129328 3300054114 Bacteria 2125
296 Ga0501082_0026673 3300060353 Bacteria 4980
297 Ga0501082_0508752 3300060353 Bacteria 1053
298 Ga0501082_0647481 3300060353 Bacteria 925
299 Ga0466962_0006848 3300061719 Bacteria 5467
300 Ga0530510_0002809 3300061734 Bacteria 11975

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039450 Ga0436363_1571582 Ga0436363_1571582_58_525 145
2 3300005338 Ga0068868_100251544 Ga0068868_1002515442 148
3 3300005338 Ga0068868_100428585 Ga0068868_1004285852 148
4 3300005367 Ga0070667_100210818 Ga0070667_1002108182 148
5 3300005445 Ga0070708_101349016 Ga0070708_1013490161 148
6 3300005458 Ga0070681_10018848 Ga0070681_100188482 148
7 3300005459 Ga0068867_100058762 Ga0068867_1000587623 148
8 3300005535 Ga0070684_100246177 Ga0070684_1002461772 148
9 3300005536 Ga0070697_100484559 Ga0070697_1004845592 148
10 3300005548 Ga0070665_101292271 Ga0070665_1012922712 148
11 3300005563 Ga0068855_100448994 Ga0068855_1004489944 148
12 3300005563 Ga0068855_102358444 Ga0068855_1023584441 148
13 3300005564 Ga0070664_102116301 Ga0070664_1021163011 148
14 3300005577 Ga0068857_100091005 Ga0068857_1000910056 148
15 3300005618 Ga0068864_100588448 Ga0068864_1005884482 148
16 3300005841 Ga0068863_100340290 Ga0068863_1003402901 148
17 3300005842 Ga0068858_100007802 Ga0068858_10000780211 148
18 3300005843 Ga0068860_100009357 Ga0068860_1000093577 148
19 3300006237 Ga0097621_100092231 Ga0097621_1000922317 148
20 3300006237 Ga0097621_100100970 Ga0097621_1001009703 148
21 3300006358 Ga0068871_100143126 Ga0068871_1001431262 148
22 3300006358 Ga0068871_100466027 Ga0068871_1004660272 148
23 3300009093 Ga0105240_10013554 Ga0105240_100135543 148
24 3300009093 Ga0105240_10372893 Ga0105240_103728932 148
25 3300009098 Ga0105245_10017667 Ga0105245_100176674 148
26 3300009101 Ga0105247_10329335 Ga0105247_103293353 148
27 3300009148 Ga0105243_10235100 Ga0105243_102351002 148
28 3300009176 Ga0105242_10279206 Ga0105242_102792062 148
29 3300009176 Ga0105242_11400628 Ga0105242_114006282 148
30 3300009177 Ga0105248_10272473 Ga0105248_102724732 148
31 3300009177 Ga0105248_10273559 Ga0105248_102735593 148
32 3300009545 Ga0105237_11064891 Ga0105237_110648912 148
33 3300009551 Ga0105238_10049828 Ga0105238_100498282 148
34 3300009553 Ga0105249_10397271 Ga0105249_103972714 148
35 3300010375 Ga0105239_10393966 Ga0105239_103939663 148
36 3300011119 Ga0105246_10367683 Ga0105246_103676832 148
37 3300013104 Ga0157370_10071463 Ga0157370_100714633 148
38 3300013296 Ga0157374_10190792 Ga0157374_101907921 148
39 3300013297 Ga0157378_10127678 Ga0157378_101276782 148
40 3300013306 Ga0163162_10144517 Ga0163162_101445173 148
41 3300013306 Ga0163162_10320532 Ga0163162_103205322 148
42 3300014325 Ga0163163_10014430 Ga0163163_1001443013 148
43 3300014968 Ga0157379_10119644 Ga0157379_101196442 148
44 3300014969 Ga0157376_10011621 Ga0157376_100116216 148
45 3300025899 Ga0207642_10369574 Ga0207642_103695742 148
46 3300025903 Ga0207680_10034308 Ga0207680_100343083 148
47 3300025911 Ga0207654_10316228 Ga0207654_103162282 148
48 3300025912 Ga0207707_10003370 Ga0207707_100033705 148
49 3300025913 Ga0207695_10036793 Ga0207695_100367933 148
50 3300025914 Ga0207671_10285301 Ga0207671_102853012 148
51 3300025921 Ga0207652_10115658 Ga0207652_101156583 148
52 3300025924 Ga0207694_10339368 Ga0207694_103393683 148
53 3300025927 Ga0207687_10050762 Ga0207687_100507624 148
54 3300025934 Ga0207686_10046515 Ga0207686_100465153 148
55 3300025934 Ga0207686_10635433 Ga0207686_106354332 148
56 3300025934 Ga0207686_11326340 Ga0207686_113263401 148
57 3300025938 Ga0207704_10348570 Ga0207704_103485702 148
58 3300025941 Ga0207711_10740867 Ga0207711_107408672 148
59 3300025942 Ga0207689_10310723 Ga0207689_103107232 148
60 3300025945 Ga0207679_10634055 Ga0207679_106340551 148
61 3300025949 Ga0207667_10154181 Ga0207667_101541814 148
62 3300025949 Ga0207667_10216779 Ga0207667_102167794 148
63 3300026023 Ga0207677_10085519 Ga0207677_100855193 148
64 3300026023 Ga0207677_10170994 Ga0207677_101709943 148
65 3300026035 Ga0207703_10216787 Ga0207703_102167872 148
66 3300026088 Ga0207641_10410915 Ga0207641_104109152 148
67 3300026089 Ga0207648_10005008 Ga0207648_100050088 148
68 3300026095 Ga0207676_11230753 Ga0207676_112307532 148
69 3300026116 Ga0207674_10012794 Ga0207674_1001279411 148
70 3300026142 Ga0207698_12170374 Ga0207698_121703741 148
71 3300028379 Ga0268266_10471029 Ga0268266_104710292 148
72 3300028381 Ga0268264_10130111 Ga0268264_101301111 148
73 3300031711 Ga0265314_10023282 Ga0265314_100232825 148
74 3300046472 Ga0495580_0236151 Ga0495580_0236151_388_834 148
75 3300048918 Ga0496115_0077036 Ga0496115_0077036_663_1109 148
76 3300048918 Ga0496115_0501857 Ga0496115_0501857_292_738 148
77 iso_pu_bacteria 2651869818 2652974025 149
78 iso_pu_bacteria 2919493220 2919494928 150
79 iso_pu_bacteria 2919543075 2919545883 150
80 iso_pu_bacteria 2923525760 2923529817 150
81 3300005337 Ga0070682_100032463 Ga0070682_1000324632 151
82 3300005338 Ga0068868_100079689 Ga0068868_1000796892 151
83 3300005344 Ga0070661_100156557 Ga0070661_1001565571 151
84 3300005347 Ga0070668_100997222 Ga0070668_1009972221 151
85 3300005354 Ga0070675_101044733 Ga0070675_1010447331 151
86 3300005364 Ga0070673_100207312 Ga0070673_1002073122 151
87 3300005437 Ga0070710_10237707 Ga0070710_102377072 151
88 3300005441 Ga0070700_100002408 Ga0070700_10000240812 151
89 3300005445 Ga0070708_100068104 Ga0070708_1000681044 151
90 3300005455 Ga0070663_100109262 Ga0070663_1001092623 151
91 3300005459 Ga0068867_101330119 Ga0068867_1013301191 151
92 3300005545 Ga0070695_101107347 Ga0070695_1011073471 151
93 3300005549 Ga0070704_100876651 Ga0070704_1008766511 151
94 3300005564 Ga0070664_100812641 Ga0070664_1008126412 151
95 3300005577 Ga0068857_100604703 Ga0068857_1006047032 151
96 3300005614 Ga0068856_100030271 Ga0068856_1000302717 151
97 3300005615 Ga0070702_100028226 Ga0070702_1000282262 151
98 3300005718 Ga0068866_10297922 Ga0068866_102979222 151
99 3300005981 Ga0081538_10002606 Ga0081538_1000260613 151
100 3300005981 Ga0081538_10014149 Ga0081538_100141495 151
101 3300005981 Ga0081538_10063147 Ga0081538_100631472 151
102 3300005983 Ga0081540_1028862 Ga0081540_10288622 151
103 3300006175 Ga0070712_100926776 Ga0070712_1009267762 151
104 3300006881 Ga0068865_100147499 Ga0068865_1001474992 151
105 3300009098 Ga0105245_10001860 Ga0105245_100018604 151
106 3300009098 Ga0105245_10138089 Ga0105245_101380893 151
107 3300009101 Ga0105247_10204203 Ga0105247_102042032 151
108 3300009148 Ga0105243_10727900 Ga0105243_107279002 151
109 3300009148 Ga0105243_10941240 Ga0105243_109412402 151
110 3300009176 Ga0105242_10203114 Ga0105242_102031142 151
111 3300009176 Ga0105242_10770828 Ga0105242_107708282 151
112 3300009176 Ga0105242_10868416 Ga0105242_108684162 151
113 3300009177 Ga0105248_10695987 Ga0105248_106959872 151
114 3300010375 Ga0105239_10315813 Ga0105239_103158131 151
115 3300011119 Ga0105246_10014340 Ga0105246_100143405 151
116 3300013105 Ga0157369_10727860 Ga0157369_107278602 151
117 3300013296 Ga0157374_10322084 Ga0157374_103220842 151
118 3300013307 Ga0157372_11087430 Ga0157372_110874302 151
119 3300013308 Ga0157375_10281644 Ga0157375_102816443 151
120 3300014325 Ga0163163_10833189 Ga0163163_108331892 151
121 3300014326 Ga0157380_10010302 Ga0157380_100103024 151
122 3300014745 Ga0157377_10011559 Ga0157377_100115591 151
123 3300014969 Ga0157376_10986379 Ga0157376_109863791 151
124 3300025899 Ga0207642_10183348 Ga0207642_101833483 151
125 3300025899 Ga0207642_10204137 Ga0207642_102041372 151
126 3300025900 Ga0207710_10208313 Ga0207710_102083132 151
127 3300025901 Ga0207688_10023342 Ga0207688_100233422 151
128 3300025915 Ga0207693_10375891 Ga0207693_103758912 151
129 3300025927 Ga0207687_10001660 Ga0207687_1000166012 151
130 3300025927 Ga0207687_11617913 Ga0207687_116179131 151
131 3300025932 Ga0207690_10604830 Ga0207690_106048301 151
132 3300025934 Ga0207686_10095832 Ga0207686_100958322 151
133 3300025935 Ga0207709_10321640 Ga0207709_103216402 151
134 3300025937 Ga0207669_10428895 Ga0207669_104288952 151
135 3300025942 Ga0207689_10054380 Ga0207689_100543805 151
136 3300025944 Ga0207661_11140214 Ga0207661_111402142 151
137 3300025945 Ga0207679_10302540 Ga0207679_103025402 151
138 3300025949 Ga0207667_10242097 Ga0207667_102420973 151
139 3300025960 Ga0207651_10176867 Ga0207651_101768673 151
140 3300026023 Ga0207677_10260079 Ga0207677_102600792 151
141 3300026035 Ga0207703_11621412 Ga0207703_116214121 151
142 3300026067 Ga0207678_10149216 Ga0207678_101492162 151
143 3300026075 Ga0207708_10002521 Ga0207708_1000252117 151
144 3300026078 Ga0207702_10607886 Ga0207702_106078862 151
145 3300026089 Ga0207648_10278804 Ga0207648_102788042 151
146 3300026116 Ga0207674_10865065 Ga0207674_108650652 151
147 3300026121 Ga0207683_10020677 Ga0207683_100206773 151
148 3300038443 Ga0395901_0347224 Ga0395901_0347224_785_1246 151
149 3300042008 Ga0439450_008554 Ga0439450_008554_482_937 151
150 3300042993 Ga0439440_0028017 Ga0439440_0028017_681_1136 151
151 3300044735 Ga0466968_0702324 Ga0466968_0702324_36_491 151
152 3300048904 Ga0496101_0744076 Ga0496101_0744076_196_651 151
153 3300048908 Ga0496105_0122269 Ga0496105_0122269_119_574 151
154 3300048909 Ga0496106_0334062 Ga0496106_0334062_282_737 151
155 3300048910 Ga0496107_0112480 Ga0496107_0112480_543_998 151
156 3300048911 Ga0496108_0049880 Ga0496108_0049880_46_501 151
157 3300048912 Ga0496109_0059190 Ga0496109_0059190_2922_3377 151
158 3300048913 Ga0496110_0053311 Ga0496110_0053311_3007_3462 151
159 3300048914 Ga0496111_0193996 Ga0496111_0193996_958_1413 151
160 3300048916 Ga0496113_0469142 Ga0496113_0469142_221_676 151
161 3300048916 Ga0496113_0557245 Ga0496113_0557245_161_616 151
162 3300048918 Ga0496115_0416453 Ga0496115_0416453_406_861 151
163 3300049568 Ga0501031_0117458 Ga0501031_0117458_213_668 151
164 3300049570 Ga0501033_0366103 Ga0501033_0366103_372_827 151
165 3300049572 Ga0501036_0013387 Ga0501036_0013387_207_662 151
166 3300049574 Ga0501038_0764705 Ga0501038_0764705_73_528 151
167 3300049576 Ga0501040_0071627 Ga0501040_0071627_613_1068 151
168 3300049577 Ga0501041_0572966 Ga0501041_0572966_122_577 151
169 3300049578 Ga0501042_0671205 Ga0501042_0671205_190_645 151
170 3300049579 Ga0501043_0932697 Ga0501043_0932697_137_592 151
171 3300049582 Ga0501048_0132574 Ga0501048_0132574_482_937 151
172 3300049587 Ga0501071_0390269 Ga0501071_0390269_407_862 151
173 3300049588 Ga0501072_0118143 Ga0501072_0118143_1144_1599 151
174 3300049592 Ga0501076_0539942 Ga0501076_0539942_448_903 151
175 3300049593 Ga0501077_0668281 Ga0501077_0668281_63_518 151
176 3300049743 Ga0501081_0005192 Ga0501081_0005192_7709_8164 151
177 3300050511 nmdc:mga08y16_958920_c1 nmdc:mga08y16_958920_c1_166_621 151
178 3300050514 nmdc:mga08x19_381307_c1 nmdc:mga08x19_381307_c1_308_763 151
179 3300054114 Ga0501084_0129328 Ga0501084_0129328_881_1336 151
180 3300061734 Ga0530510_0002809 Ga0530510_0002809_5059_5514 151
181 iso_pu_bacteria 2919497567 2919499828 151
182 3300005329 Ga0070683_100373892 Ga0070683_1003738922 152
183 3300005336 Ga0070680_100274325 Ga0070680_1002743252 152
184 3300005338 Ga0068868_100512505 Ga0068868_1005125051 152
185 3300005345 Ga0070692_10185026 Ga0070692_101850262 152
186 3300005434 Ga0070709_11026492 Ga0070709_110264921 152
187 3300005439 Ga0070711_100623141 Ga0070711_1006231411 152
188 3300005530 Ga0070679_100004965 Ga0070679_1000049655 152
189 3300006175 Ga0070712_100162196 Ga0070712_1001621962 152
190 3300006175 Ga0070712_101215591 Ga0070712_1012155911 152
191 3300006844 Ga0075428_101819444 Ga0075428_1018194441 152
192 3300006847 Ga0075431_100051293 Ga0075431_1000512933 152
193 3300006847 Ga0075431_100410869 Ga0075431_1004108692 152
194 3300006871 Ga0075434_100200666 Ga0075434_1002006662 152
195 3300006914 Ga0075436_100022562 Ga0075436_1000225626 152
196 3300009094 Ga0111539_10786780 Ga0111539_107867802 152
197 3300009147 Ga0114129_11111667 Ga0114129_111116672 152
198 3300014497 Ga0182008_10191441 Ga0182008_101914412 152
199 3300025914 Ga0207671_10589188 Ga0207671_105891882 152
200 3300025915 Ga0207693_10062714 Ga0207693_100627143 152
201 3300025921 Ga0207652_10003837 Ga0207652_1000383710 152
202 3300025929 Ga0207664_10248952 Ga0207664_102489523 152
203 3300025939 Ga0207665_10078490 Ga0207665_100784902 152
204 3300025944 Ga0207661_10426712 Ga0207661_104267122 152
205 3300026089 Ga0207648_10039785 Ga0207648_100397853 152
206 3300026118 Ga0207675_100507058 Ga0207675_1005070582 152
207 3300028556 Ga0265337_1000762 Ga0265337_10007621 152
208 3300028558 Ga0265326_10000666 Ga0265326_100006666 152
209 3300028563 Ga0265319_1000034 Ga0265319_1000034113 152
210 3300028563 Ga0265319_1000065 Ga0265319_100006516 152
211 3300028577 Ga0265318_10000518 Ga0265318_100005189 152
212 3300028666 Ga0265336_10000001 Ga0265336_10000001333 152
213 3300028800 Ga0265338_10000004 Ga0265338_10000004548 152
214 3300028800 Ga0265338_10311574 Ga0265338_103115743 152
215 3300029957 Ga0265324_10013592 Ga0265324_100135922 152
216 3300031235 Ga0265330_10043343 Ga0265330_100433433 152
217 3300031240 Ga0265320_10016927 Ga0265320_100169274 152
218 3300031247 Ga0265340_10000002 Ga0265340_10000002548 152
219 3300031251 Ga0265327_10238586 Ga0265327_102385861 152
220 3300031344 Ga0265316_10008742 Ga0265316_100087423 152
221 3300031712 Ga0265342_10106034 Ga0265342_101060342 152
222 3300031901 Ga0307406_10479316 Ga0307406_104793162 152
223 3300032126 Ga0307415_100540649 Ga0307415_1005406491 152
224 3300044693 Ga0466961_0008887 Ga0466961_0008887_743_1204 152
225 3300044694 Ga0466963_0072737 Ga0466963_0072737_305_766 152
226 3300044706 Ga0466964_0148716 Ga0466964_0148716_480_941 152
227 3300044719 Ga0466971_0003614 Ga0466971_0003614_4416_4877 152
228 3300044765 Ga0466970_0022627 Ga0466970_0022627_1757_2218 152
229 3300045049 Ga0466959_0616238 Ga0466959_0616238_49_510 152
230 3300045836 Ga0466958_0004797 Ga0466958_0004797_4037_4498 152
231 3300045976 Ga0466967_0913638 Ga0466967_0913638_159_623 152
232 3300046474 Ga0495605_0186773 Ga0495605_0186773_100_573 152
233 3300046491 Ga0495584_0208200 Ga0495584_0208200_93_566 152
234 3300046543 Ga0495645_0425155 Ga0495645_0425155_101_559 152
235 3300046616 Ga0495668_0154458 Ga0495668_0154458_761_1234 152
236 3300048088 Ga0495602_0809257 Ga0495602_0809257_127_588 152
237 3300048915 Ga0496112_0450415 Ga0496112_0450415_702_1166 152
238 3300049568 Ga0501031_0257305 Ga0501031_0257305_451_909 152
239 3300049568 Ga0501031_0334386 Ga0501031_0334386_135_593 152
240 3300049569 Ga0501032_0136819 Ga0501032_0136819_1113_1571 152
241 3300049570 Ga0501033_0049040 Ga0501033_0049040_152_610 152
242 3300049571 Ga0501034_0068087 Ga0501034_0068087_3048_3506 152
243 3300049572 Ga0501036_0022934 Ga0501036_0022934_2895_3353 152
244 3300049573 Ga0501037_0082986 Ga0501037_0082986_409_867 152
245 3300049574 Ga0501038_0044873 Ga0501038_0044873_2042_2500 152
246 3300049575 Ga0501039_0602473 Ga0501039_0602473_64_522 152
247 3300049578 Ga0501042_0054163 Ga0501042_0054163_483_941 152
248 3300049579 Ga0501043_0068296 Ga0501043_0068296_1474_1932 152
249 3300049580 Ga0501046_0049419 Ga0501046_0049419_966_1424 152
250 3300049581 Ga0501047_0306387 Ga0501047_0306387_41_499 152
251 3300049584 Ga0501068_0070230 Ga0501068_0070230_1501_1959 152
252 3300049586 Ga0501070_0082813 Ga0501070_0082813_510_968 152
253 3300049587 Ga0501071_0294868 Ga0501071_0294868_698_1156 152
254 3300049589 Ga0501073_0009321 Ga0501073_0009321_4518_4976 152
255 3300049590 Ga0501074_0086301 Ga0501074_0086301_1085_1543 152
256 3300049822 Ga0501035_0051863 Ga0501035_0051863_62_520 152
257 3300049823 Ga0501044_0093919 Ga0501044_0093919_1114_1572 152
258 3300049824 Ga0501045_1087625 Ga0501045_1087625_19_501 152
259 3300050507 nmdc:mga05p37_1430569_c1 nmdc:mga05p37_1430569_c1_215_676 152
260 3300050510 nmdc:mga06r32_756675_c1 nmdc:mga06r32_756675_c1_59_520 152
261 3300050511 nmdc:mga08y16_92245_c1 nmdc:mga08y16_92245_c1_2587_3048 152
262 3300050514 nmdc:mga08x19_384534_c1 nmdc:mga08x19_384534_c1_360_821 152
263 3300050515 nmdc:mga0a205_81003_c1 nmdc:mga0a205_81003_c1_769_1230 152
264 3300053104 Ga0500556_0000362 Ga0500556_0000362_2673_3131 152
265 3300053153 Ga0500616_0006341 Ga0500616_0006341_6595_7053 152
266 3300053736 Ga0500599_000981 Ga0500599_000981_2063_2521 152
267 3300054114 Ga0501084_0073796 Ga0501084_0073796_117_578 152
268 3300060353 Ga0501082_0026673 Ga0501082_0026673_1054_1512 152
269 3300061719 Ga0466962_0006848 Ga0466962_0006848_146_607 152
270 3300005983 Ga0081540_1040320 Ga0081540_10403201 153
271 3300021388 Ga0213875_10074832 Ga0213875_100748322 153
272 3300025933 Ga0207706_10427282 Ga0207706_104272821 153
273 3300037853 Ga0436364_0918908 Ga0436364_0918908_1649_2113 153
274 3300039437 Ga0436365_0986987 Ga0436365_0986987_4975_5439 153
275 3300039453 Ga0436362_1185631 Ga0436362_1185631_387_851 153
276 3300044765 Ga0466970_0135457 Ga0466970_0135457_99_560 153
277 3300045836 Ga0466958_0565451 Ga0466958_0565451_238_699 153
278 3300049580 Ga0501046_0778517 Ga0501046_0778517_152_628 153
279 3300049587 Ga0501071_0051772 Ga0501071_0051772_15_491 153
280 3300049587 Ga0501071_0927444 Ga0501071_0927444_87_563 153
281 3300049588 Ga0501072_0266295 Ga0501072_0266295_361_837 153
282 3300049588 Ga0501072_0735611 Ga0501072_0735611_252_713 153
283 3300049593 Ga0501077_0920171 Ga0501077_0920171_20_496 153
284 3300049742 Ga0501080_0511797 Ga0501080_0511797_388_864 153
285 3300049743 Ga0501081_0483690 Ga0501081_0483690_218_694 153
286 3300060353 Ga0501082_0508752 Ga0501082_0508752_18_479 153
287 3300060353 Ga0501082_0647481 Ga0501082_0647481_252_728 153
288 3300005354 Ga0070675_100352017 Ga0070675_1003520171 154
289 3300006852 Ga0075433_10287017 Ga0075433_102870172 154
290 3300009147 Ga0114129_10321950 Ga0114129_103219502 154
291 3300014745 Ga0157377_11490980 Ga0157377_114909801 154
292 3300025907 Ga0207645_10074013 Ga0207645_100740132 154
293 3300039447 Ga0436361_0346645 Ga0436361_0346645_15_488 154
294 3300039453 Ga0436362_1238080 Ga0436362_1238080_83_550 154
295 3300044684 Ga0466966_0042179 Ga0466966_0042179_438_908 154
296 3300046516 Ga0495628_0409122 Ga0495628_0409122_152_628 154
297 3300046533 Ga0495640_0212575 Ga0495640_0212575_124_600 154
298 3300046663 Ga0495635_0074038 Ga0495635_0074038_1430_1906 154
299 3300046663 Ga0495635_0329687 Ga0495635_0329687_460_939 154
300 3300047317 Ga0495604_0189957 Ga0495604_0189957_335_811 154
301 3300047321 Ga0495676_0690624 Ga0495676_0690624_70_546 154
302 3300050507 nmdc:mga05p37_174177_c1 nmdc:mga05p37_174177_c1_2078_2596 154
303 3300050510 nmdc:mga06r32_12409_c1 nmdc:mga06r32_12409_c1_7079_7597 154
304 3300050512 nmdc:mga0n895_809548_c1 nmdc:mga0n895_809548_c1_15_533 154
305 3300005288 Ga0065714_10074682 Ga0065714_100746822 155

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

24

153

0.99

PF08534

Redoxin

Redoxin

23

167

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5iph-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - c84s mutant 0.9455 13 154
5imf-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - structure f5 0.9434 13 154
5io2-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - c48s mutant 0.9433 13 154
3gkm-assembly1.cif.gz_A insights into the alkyl peroxide reduction activity of xanthomonas campestris bacterioferritin comigratory protein from the trapped intermediate/ligand complex structures 0.9426 13 154
3ixr-assembly1.cif.gz_A crystal structure of xylella fastidiosa prxq c47s mutant 0.9271 1 154
ID Description Score Start End Superfamily
af_P0AE52_4_156_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9927 4 154 3.40.30.10
af_P0AE52_4_156_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.967 4 154 3.40.30.10
af_Q2G280_3_151_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9601 6 155 3.40.30.10
af_P9WIE1_7_157_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9483 4 155 3.40.30.10
af_Q2G280_3_151_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9476 6 155 3.40.30.10
ID Description Score Start End GO Terms
AF-W0Q5S7-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin Bcp) 0.993 2 155 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A359EDY2-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9918 44 154 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A841GN13-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Bacterioferritin comigratory protein) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin Bcp) 0.9909 1 154 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A1F8TUU8-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin Bcp) 0.9907 17 155 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A5C8LTU4-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin Bcp) 0.9906 1 121 GO:0005737
GO:0008379
GO:0034599
GO:0045454

Feature Viewer

pLDDT pTM Quality
94.3 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map