F398068
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 305 | 216 | 300 | 152 |
Family's Representative Sequence
| Representative Sequence | 3300006852|Ga0075433_10287017|Ga0075433_102870172 |
| Length | 173 |
| Sequence | MARRAVWAILDLSLLSERTVMVEVGQPAPDFELPDQNGEPVRLSELRGQRVVVYFYPKADTPGCTTQACGIRDHTADYDAAGAEVLGISPDPVEDVKKFADKFDLRFHLLADADHAVADTYGVWVEKTKYGRTYWGNERTTFVIDADGRVAEVLRNVKPAEHDDLVLGALSGV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2651869818 | Vibrio splendidus UCD-SED10 | Isolate | Rhizosphere |
| 2 | 2919493220 | Aeromonas salmonicida salmonicida 3466 | Isolate | Unclassified |
| 3 | 2919497567 | Shewanella putrefaciens 3469 | Isolate | Unclassified |
| 4 | 2919543075 | Aeromonas salmonicida masoucida 4076 | Isolate | Unclassified |
| 5 | 2923525760 | Aeromonas caviae SLBN-129 | Isolate | Rhizosphere |
| 6 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 25 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 32 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 34 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 35 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 37 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 38 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 39 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 40 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 41 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 42 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 43 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 46 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 47 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 48 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 49 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 50 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 51 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 52 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 75 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 79 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 121 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 122 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 123 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 124 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 125 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 126 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 127 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 128 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 129 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 130 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 131 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 132 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 133 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 134 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 135 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 136 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 137 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 138 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 139 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 140 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 141 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 142 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 143 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 144 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 145 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 146 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 147 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 148 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 149 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 150 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 151 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 152 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 153 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 154 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 166 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 167 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 168 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 169 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 170 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 171 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 172 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 173 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 174 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 175 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 176 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 187 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 188 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 195 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 196 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 201 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 205 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 206 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 207 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 208 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 209 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 210 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 211 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 212 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 213 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 214 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 216 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.36 |
| Metatranscriptomes | 0 |
| Isolates | 1.64 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.98 |
| Nodule | 0 |
| Rhizoplane | 4.59 |
| Rhizosphere | 92.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065714_10074682 | 3300005288 | Bacteria | 3004 |
| 2 | Ga0070683_100373892 | 3300005329 | Bacteria | 1358 |
| 3 | Ga0070680_100274325 | 3300005336 | Bacteria | 1428 |
| 4 | Ga0070682_100032463 | 3300005337 | Bacteria | 3166 |
| 5 | Ga0068868_100079689 | 3300005338 | Bacteria | 2623 |
| 6 | Ga0068868_100251544 | 3300005338 | Bacteria | 1487 |
| 7 | Ga0068868_100428585 | 3300005338 | Bacteria | 1146 |
| 8 | Ga0068868_100512505 | 3300005338 | Bacteria | 1052 |
| 9 | Ga0070661_100156557 | 3300005344 | Bacteria | 1724 |
| 10 | Ga0070692_10185026 | 3300005345 | Bacteria | 1210 |
| 11 | Ga0070668_100997222 | 3300005347 | Bacteria | 752 |
| 12 | Ga0070675_100352017 | 3300005354 | Bacteria | 1306 |
| 13 | Ga0070675_101044733 | 3300005354 | Bacteria | 751 |
| 14 | Ga0070673_100207312 | 3300005364 | Bacteria | 1691 |
| 15 | Ga0070667_100210818 | 3300005367 | Bacteria | 1726 |
| 16 | Ga0070709_11026492 | 3300005434 | Bacteria | 657 |
| 17 | Ga0070710_10237707 | 3300005437 | Bacteria | 1166 |
| 18 | Ga0070711_100623141 | 3300005439 | Bacteria | 902 |
| 19 | Ga0070700_100002408 | 3300005441 | Bacteria | 9535 |
| 20 | Ga0070708_100068104 | 3300005445 | Bacteria | 3199 |
| 21 | Ga0070708_101349016 | 3300005445 | Bacteria | 666 |
| 22 | Ga0070663_100109262 | 3300005455 | Bacteria | 2076 |
| 23 | Ga0070681_10018848 | 3300005458 | Bacteria | 6906 |
| 24 | Ga0068867_100058762 | 3300005459 | Bacteria | 2850 |
| 25 | Ga0068867_101330119 | 3300005459 | Bacteria | 664 |
| 26 | Ga0070679_100004965 | 3300005530 | Bacteria | 12282 |
| 27 | Ga0070684_100246177 | 3300005535 | Bacteria | 1634 |
| 28 | Ga0070697_100484559 | 3300005536 | Bacteria | 1080 |
| 29 | Ga0070695_101107347 | 3300005545 | Bacteria | 648 |
| 30 | Ga0070665_101292271 | 3300005548 | Bacteria | 740 |
| 31 | Ga0070704_100876651 | 3300005549 | Bacteria | 806 |
| 32 | Ga0068855_100448994 | 3300005563 | Bacteria | 1407 |
| 33 | Ga0068855_102358444 | 3300005563 | Bacteria | 532 |
| 34 | Ga0070664_100812641 | 3300005564 | Bacteria | 875 |
| 35 | Ga0070664_102116301 | 3300005564 | Bacteria | 534 |
| 36 | Ga0068857_100091005 | 3300005577 | Bacteria | 2730 |
| 37 | Ga0068857_100604703 | 3300005577 | Bacteria | 1037 |
| 38 | Ga0068856_100030271 | 3300005614 | Bacteria | 5291 |
| 39 | Ga0070702_100028226 | 3300005615 | Bacteria | 3040 |
| 40 | Ga0068864_100588448 | 3300005618 | Bacteria | 1079 |
| 41 | Ga0068866_10297922 | 3300005718 | Bacteria | 1006 |
| 42 | Ga0068863_100340290 | 3300005841 | Bacteria | 1459 |
| 43 | Ga0068858_100007802 | 3300005842 | Bacteria | 10332 |
| 44 | Ga0068860_100009357 | 3300005843 | Bacteria | 9736 |
| 45 | Ga0081538_10002606 | 3300005981 | Bacteria | 17484 |
| 46 | Ga0081538_10014149 | 3300005981 | Bacteria | 6268 |
| 47 | Ga0081538_10063147 | 3300005981 | Bacteria | 2105 |
| 48 | Ga0081540_1028862 | 3300005983 | Bacteria | 3103 |
| 49 | Ga0081540_1040320 | 3300005983 | Bacteria | 2435 |
| 50 | Ga0070712_100162196 | 3300006175 | Bacteria | 1727 |
| 51 | Ga0070712_100926776 | 3300006175 | Bacteria | 752 |
| 52 | Ga0070712_101215591 | 3300006175 | Bacteria | 656 |
| 53 | Ga0097621_100092231 | 3300006237 | Bacteria | 2536 |
| 54 | Ga0097621_100100970 | 3300006237 | Bacteria | 2427 |
| 55 | Ga0068871_100143126 | 3300006358 | Bacteria | 2034 |
| 56 | Ga0068871_100466027 | 3300006358 | Bacteria | 1134 |
| 57 | Ga0075428_101819444 | 3300006844 | Bacteria | 634 |
| 58 | Ga0075431_100051293 | 3300006847 | Bacteria | 4255 |
| 59 | Ga0075431_100410869 | 3300006847 | Bacteria | 1354 |
| 60 | Ga0075433_10287017 | 3300006852 | Bacteria | 1458 |
| 61 | Ga0075434_100200666 | 3300006871 | Bacteria | 2014 |
| 62 | Ga0068865_100147499 | 3300006881 | Bacteria | 1781 |
| 63 | Ga0075436_100022562 | 3300006914 | Bacteria | 4322 |
| 64 | Ga0105240_10013554 | 3300009093 | Bacteria | 11189 |
| 65 | Ga0105240_10372893 | 3300009093 | Bacteria | 1613 |
| 66 | Ga0111539_10786780 | 3300009094 | Bacteria | 1107 |
| 67 | Ga0105245_10001860 | 3300009098 | Bacteria | 19182 |
| 68 | Ga0105245_10017667 | 3300009098 | Bacteria | 6226 |
| 69 | Ga0105245_10138089 | 3300009098 | Bacteria | 2293 |
| 70 | Ga0105247_10204203 | 3300009101 | Bacteria | 1329 |
| 71 | Ga0105247_10329335 | 3300009101 | Bacteria | 1068 |
| 72 | Ga0114129_10321950 | 3300009147 | Bacteria | 2055 |
| 73 | Ga0114129_11111667 | 3300009147 | Bacteria | 989 |
| 74 | Ga0105243_10235100 | 3300009148 | Bacteria | 1628 |
| 75 | Ga0105243_10727900 | 3300009148 | Bacteria | 970 |
| 76 | Ga0105243_10941240 | 3300009148 | Bacteria | 862 |
| 77 | Ga0105242_10203114 | 3300009176 | Bacteria | 1761 |
| 78 | Ga0105242_10279206 | 3300009176 | Bacteria | 1516 |
| 79 | Ga0105242_10770828 | 3300009176 | Bacteria | 949 |
| 80 | Ga0105242_10868416 | 3300009176 | Bacteria | 899 |
| 81 | Ga0105242_11400628 | 3300009176 | Unclassified | 726 |
| 82 | Ga0105248_10272473 | 3300009177 | Bacteria | 1906 |
| 83 | Ga0105248_10273559 | 3300009177 | Unclassified | 1902 |
| 84 | Ga0105248_10695987 | 3300009177 | Bacteria | 1147 |
| 85 | Ga0105237_11064891 | 3300009545 | Bacteria | 815 |
| 86 | Ga0105238_10049828 | 3300009551 | Bacteria | 4217 |
| 87 | Ga0105249_10397271 | 3300009553 | Bacteria | 1408 |
| 88 | Ga0105239_10315813 | 3300010375 | Bacteria | 1761 |
| 89 | Ga0105239_10393966 | 3300010375 | Bacteria | 1567 |
| 90 | Ga0105246_10014340 | 3300011119 | Bacteria | 4984 |
| 91 | Ga0105246_10367683 | 3300011119 | Bacteria | 1184 |
| 92 | Ga0157370_10071463 | 3300013104 | Bacteria | 3274 |
| 93 | Ga0157369_10727860 | 3300013105 | Bacteria | 1021 |
| 94 | Ga0157374_10190792 | 3300013296 | Bacteria | 2004 |
| 95 | Ga0157374_10322084 | 3300013296 | Bacteria | 1532 |
| 96 | Ga0157378_10127678 | 3300013297 | Bacteria | 2351 |
| 97 | Ga0163162_10144517 | 3300013306 | Bacteria | 2494 |
| 98 | Ga0163162_10320532 | 3300013306 | Bacteria | 1682 |
| 99 | Ga0157372_11087430 | 3300013307 | Bacteria | 925 |
| 100 | Ga0157375_10281644 | 3300013308 | Bacteria | 1825 |
| 101 | Ga0163163_10014430 | 3300014325 | Bacteria | 7262 |
| 102 | Ga0163163_10833189 | 3300014325 | Bacteria | 986 |
| 103 | Ga0157380_10010302 | 3300014326 | Bacteria | 6721 |
| 104 | Ga0182008_10191441 | 3300014497 | Bacteria | 1038 |
| 105 | Ga0157377_10011559 | 3300014745 | Bacteria | 4412 |
| 106 | Ga0157377_11490980 | 3300014745 | Bacteria | 537 |
| 107 | Ga0157379_10119644 | 3300014968 | Bacteria | 2369 |
| 108 | Ga0157376_10011621 | 3300014969 | Bacteria | 6499 |
| 109 | Ga0157376_10986379 | 3300014969 | Bacteria | 864 |
| 110 | Ga0213875_10074832 | 3300021388 | Bacteria | 1580 |
| 111 | Ga0207642_10183348 | 3300025899 | Bacteria | 1142 |
| 112 | Ga0207642_10204137 | 3300025899 | Bacteria | 1094 |
| 113 | Ga0207642_10369574 | 3300025899 | Bacteria | 851 |
| 114 | Ga0207710_10208313 | 3300025900 | Bacteria | 967 |
| 115 | Ga0207688_10023342 | 3300025901 | Bacteria | 3387 |
| 116 | Ga0207680_10034308 | 3300025903 | Bacteria | 2903 |
| 117 | Ga0207645_10074013 | 3300025907 | Bacteria | 2181 |
| 118 | Ga0207654_10316228 | 3300025911 | Bacteria | 1066 |
| 119 | Ga0207707_10003370 | 3300025912 | Bacteria | 14184 |
| 120 | Ga0207695_10036793 | 3300025913 | Bacteria | 5287 |
| 121 | Ga0207671_10285301 | 3300025914 | Bacteria | 1303 |
| 122 | Ga0207671_10589188 | 3300025914 | Bacteria | 886 |
| 123 | Ga0207693_10062714 | 3300025915 | Bacteria | 2912 |
| 124 | Ga0207693_10375891 | 3300025915 | Bacteria | 1111 |
| 125 | Ga0207652_10003837 | 3300025921 | Bacteria | 12331 |
| 126 | Ga0207652_10115658 | 3300025921 | Bacteria | 2382 |
| 127 | Ga0207694_10339368 | 3300025924 | Bacteria | 1242 |
| 128 | Ga0207687_10001660 | 3300025927 | Bacteria | 15354 |
| 129 | Ga0207687_10050762 | 3300025927 | Bacteria | 2889 |
| 130 | Ga0207687_11617913 | 3300025927 | Bacteria | 556 |
| 131 | Ga0207664_10248952 | 3300025929 | Bacteria | 1550 |
| 132 | Ga0207690_10604830 | 3300025932 | Bacteria | 895 |
| 133 | Ga0207706_10427282 | 3300025933 | Bacteria | 1147 |
| 134 | Ga0207686_10046515 | 3300025934 | Unclassified | 2677 |
| 135 | Ga0207686_10095832 | 3300025934 | Bacteria | 1970 |
| 136 | Ga0207686_10635433 | 3300025934 | Bacteria | 843 |
| 137 | Ga0207686_11326340 | 3300025934 | Bacteria | 591 |
| 138 | Ga0207709_10321640 | 3300025935 | Bacteria | 1158 |
| 139 | Ga0207669_10428895 | 3300025937 | Bacteria | 1042 |
| 140 | Ga0207704_10348570 | 3300025938 | Bacteria | 1152 |
| 141 | Ga0207665_10078490 | 3300025939 | Bacteria | 2268 |
| 142 | Ga0207711_10740867 | 3300025941 | Unclassified | 916 |
| 143 | Ga0207689_10054380 | 3300025942 | Bacteria | 3297 |
| 144 | Ga0207689_10310723 | 3300025942 | Bacteria | 1307 |
| 145 | Ga0207661_10426712 | 3300025944 | Bacteria | 1205 |
| 146 | Ga0207661_11140214 | 3300025944 | Bacteria | 718 |
| 147 | Ga0207679_10302540 | 3300025945 | Bacteria | 1379 |
| 148 | Ga0207679_10634055 | 3300025945 | Bacteria | 965 |
| 149 | Ga0207667_10154181 | 3300025949 | Bacteria | 2364 |
| 150 | Ga0207667_10216779 | 3300025949 | Bacteria | 1961 |
| 151 | Ga0207667_10242097 | 3300025949 | Bacteria | 1846 |
| 152 | Ga0207651_10176867 | 3300025960 | Bacteria | 1689 |
| 153 | Ga0207677_10085519 | 3300026023 | Bacteria | 2277 |
| 154 | Ga0207677_10170994 | 3300026023 | Bacteria | 1699 |
| 155 | Ga0207677_10260079 | 3300026023 | Bacteria | 1414 |
| 156 | Ga0207703_10216787 | 3300026035 | Unclassified | 1709 |
| 157 | Ga0207703_11621412 | 3300026035 | Bacteria | 622 |
| 158 | Ga0207678_10149216 | 3300026067 | Bacteria | 1996 |
| 159 | Ga0207708_10002521 | 3300026075 | Bacteria | 13466 |
| 160 | Ga0207702_10607886 | 3300026078 | Bacteria | 1073 |
| 161 | Ga0207641_10410915 | 3300026088 | Bacteria | 1301 |
| 162 | Ga0207648_10005008 | 3300026089 | Bacteria | 13454 |
| 163 | Ga0207648_10039785 | 3300026089 | Bacteria | 4133 |
| 164 | Ga0207648_10278804 | 3300026089 | Bacteria | 1495 |
| 165 | Ga0207676_11230753 | 3300026095 | Bacteria | 742 |
| 166 | Ga0207674_10012794 | 3300026116 | Bacteria | 9369 |
| 167 | Ga0207674_10865065 | 3300026116 | Bacteria | 872 |
| 168 | Ga0207675_100507058 | 3300026118 | Bacteria | 1202 |
| 169 | Ga0207683_10020677 | 3300026121 | Bacteria | 5631 |
| 170 | Ga0207698_12170374 | 3300026142 | Bacteria | 568 |
| 171 | Ga0268266_10471029 | 3300028379 | Bacteria | 1196 |
| 172 | Ga0268264_10130111 | 3300028381 | Bacteria | 2230 |
| 173 | Ga0265337_1000762 | 3300028556 | Bacteria | 16965 |
| 174 | Ga0265326_10000666 | 3300028558 | Bacteria | 12742 |
| 175 | Ga0265319_1000034 | 3300028563 | Bacteria | 117363 |
| 176 | Ga0265319_1000065 | 3300028563 | Bacteria | 85273 |
| 177 | Ga0265318_10000518 | 3300028577 | Bacteria | 27733 |
| 178 | Ga0265336_10000001 | 3300028666 | Bacteria | 916179 |
| 179 | Ga0265338_10000004 | 3300028800 | Bacteria | 644793 |
| 180 | Ga0265338_10311574 | 3300028800 | Bacteria | 1141 |
| 181 | Ga0265324_10013592 | 3300029957 | Bacteria | 3031 |
| 182 | Ga0265330_10043343 | 3300031235 | Bacteria | 1991 |
| 183 | Ga0265320_10016927 | 3300031240 | Bacteria | 4066 |
| 184 | Ga0265340_10000002 | 3300031247 | Bacteria | 711693 |
| 185 | Ga0265327_10238586 | 3300031251 | Bacteria | 813 |
| 186 | Ga0265316_10008742 | 3300031344 | Bacteria | 9368 |
| 187 | Ga0265314_10023282 | 3300031711 | Bacteria | 4725 |
| 188 | Ga0265342_10106034 | 3300031712 | Bacteria | 1595 |
| 189 | Ga0307406_10479316 | 3300031901 | Bacteria | 1004 |
| 190 | Ga0307415_100540649 | 3300032126 | Bacteria | 1026 |
| 191 | Ga0436364_0918908 | 3300037853 | Bacteria | 4863 |
| 192 | Ga0395901_0347224 | 3300038443 | Bacteria | 1532 |
| 193 | Ga0436365_0986987 | 3300039437 | Bacteria | 8602 |
| 194 | Ga0436361_0346645 | 3300039447 | Bacteria | 577 |
| 195 | Ga0436363_1571582 | 3300039450 | Bacteria | 586 |
| 196 | Ga0436362_1185631 | 3300039453 | Bacteria | 1350 |
| 197 | Ga0436362_1238080 | 3300039453 | Bacteria | 677 |
| 198 | Ga0439450_008554 | 3300042008 | Bacteria | 1913 |
| 199 | Ga0439440_0028017 | 3300042993 | Bacteria | 1313 |
| 200 | Ga0466966_0042179 | 3300044684 | Bacteria | 2931 |
| 201 | Ga0466961_0008887 | 3300044693 | Bacteria | 6407 |
| 202 | Ga0466963_0072737 | 3300044694 | Bacteria | 2316 |
| 203 | Ga0466964_0148716 | 3300044706 | Bacteria | 1084 |
| 204 | Ga0466971_0003614 | 3300044719 | Bacteria | 6605 |
| 205 | Ga0466968_0702324 | 3300044735 | Bacteria | 516 |
| 206 | Ga0466970_0022627 | 3300044765 | Bacteria | 3281 |
| 207 | Ga0466970_0135457 | 3300044765 | Bacteria | 1355 |
| 208 | Ga0466959_0616238 | 3300045049 | Bacteria | 729 |
| 209 | Ga0466958_0004797 | 3300045836 | Bacteria | 7195 |
| 210 | Ga0466958_0565451 | 3300045836 | Bacteria | 739 |
| 211 | Ga0466967_0913638 | 3300045976 | Bacteria | 873 |
| 212 | Ga0495580_0236151 | 3300046472 | Bacteria | 1254 |
| 213 | Ga0495605_0186773 | 3300046474 | Bacteria | 909 |
| 214 | Ga0495584_0208200 | 3300046491 | Bacteria | 994 |
| 215 | Ga0495628_0409122 | 3300046516 | Bacteria | 990 |
| 216 | Ga0495640_0212575 | 3300046533 | Bacteria | 1222 |
| 217 | Ga0495645_0425155 | 3300046543 | Bacteria | 842 |
| 218 | Ga0495668_0154458 | 3300046616 | Bacteria | 1257 |
| 219 | Ga0495635_0074038 | 3300046663 | Bacteria | 2333 |
| 220 | Ga0495635_0329687 | 3300046663 | Bacteria | 1021 |
| 221 | Ga0495604_0189957 | 3300047317 | Bacteria | 1432 |
| 222 | Ga0495676_0690624 | 3300047321 | Bacteria | 661 |
| 223 | Ga0495602_0809257 | 3300048088 | Bacteria | 629 |
| 224 | Ga0496101_0744076 | 3300048904 | Bacteria | 774 |
| 225 | Ga0496105_0122269 | 3300048908 | Bacteria | 2146 |
| 226 | Ga0496106_0334062 | 3300048909 | Bacteria | 1217 |
| 227 | Ga0496107_0112480 | 3300048910 | Bacteria | 2002 |
| 228 | Ga0496108_0049880 | 3300048911 | Bacteria | 3501 |
| 229 | Ga0496109_0059190 | 3300048912 | Bacteria | 3500 |
| 230 | Ga0496110_0053311 | 3300048913 | Bacteria | 3555 |
| 231 | Ga0496111_0193996 | 3300048914 | Bacteria | 1510 |
| 232 | Ga0496112_0450415 | 3300048915 | Bacteria | 1225 |
| 233 | Ga0496113_0469142 | 3300048916 | Bacteria | 1011 |
| 234 | Ga0496113_0557245 | 3300048916 | Bacteria | 919 |
| 235 | Ga0496115_0077036 | 3300048918 | Bacteria | 2711 |
| 236 | Ga0496115_0416453 | 3300048918 | Bacteria | 1089 |
| 237 | Ga0496115_0501857 | 3300048918 | Unclassified | 975 |
| 238 | Ga0501031_0117458 | 3300049568 | Bacteria | 1738 |
| 239 | Ga0501031_0257305 | 3300049568 | Bacteria | 1134 |
| 240 | Ga0501031_0334386 | 3300049568 | Bacteria | 981 |
| 241 | Ga0501032_0136819 | 3300049569 | Bacteria | 1614 |
| 242 | Ga0501033_0049040 | 3300049570 | Bacteria | 3135 |
| 243 | Ga0501033_0366103 | 3300049570 | Unclassified | 1008 |
| 244 | Ga0501034_0068087 | 3300049571 | Bacteria | 3571 |
| 245 | Ga0501036_0013387 | 3300049572 | Bacteria | 6817 |
| 246 | Ga0501036_0022934 | 3300049572 | Bacteria | 5255 |
| 247 | Ga0501037_0082986 | 3300049573 | Bacteria | 2321 |
| 248 | Ga0501038_0044873 | 3300049574 | Bacteria | 3838 |
| 249 | Ga0501038_0764705 | 3300049574 | Bacteria | 720 |
| 250 | Ga0501039_0602473 | 3300049575 | Bacteria | 861 |
| 251 | Ga0501040_0071627 | 3300049576 | Bacteria | 2393 |
| 252 | Ga0501041_0572966 | 3300049577 | Bacteria | 720 |
| 253 | Ga0501042_0054163 | 3300049578 | Bacteria | 2861 |
| 254 | Ga0501042_0671205 | 3300049578 | Bacteria | 753 |
| 255 | Ga0501043_0068296 | 3300049579 | Bacteria | 2790 |
| 256 | Ga0501043_0932697 | 3300049579 | Bacteria | 621 |
| 257 | Ga0501046_0049419 | 3300049580 | Bacteria | 3326 |
| 258 | Ga0501046_0778517 | 3300049580 | Unclassified | 671 |
| 259 | Ga0501047_0306387 | 3300049581 | Bacteria | 1430 |
| 260 | Ga0501048_0132574 | 3300049582 | Bacteria | 1761 |
| 261 | Ga0501068_0070230 | 3300049584 | Bacteria | 2136 |
| 262 | Ga0501070_0082813 | 3300049586 | Bacteria | 2655 |
| 263 | Ga0501071_0051772 | 3300049587 | Bacteria | 2960 |
| 264 | Ga0501071_0294868 | 3300049587 | Bacteria | 1229 |
| 265 | Ga0501071_0390269 | 3300049587 | Bacteria | 1062 |
| 266 | Ga0501071_0927444 | 3300049587 | Unclassified | 672 |
| 267 | Ga0501072_0118143 | 3300049588 | Bacteria | 2112 |
| 268 | Ga0501072_0266295 | 3300049588 | Unclassified | 1364 |
| 269 | Ga0501072_0735611 | 3300049588 | Bacteria | 774 |
| 270 | Ga0501073_0009321 | 3300049589 | Bacteria | 7242 |
| 271 | Ga0501074_0086301 | 3300049590 | Bacteria | 2248 |
| 272 | Ga0501076_0539942 | 3300049592 | Bacteria | 961 |
| 273 | Ga0501077_0668281 | 3300049593 | Bacteria | 667 |
| 274 | Ga0501077_0920171 | 3300049593 | Unclassified | 563 |
| 275 | Ga0501080_0511797 | 3300049742 | Unclassified | 1072 |
| 276 | Ga0501081_0005192 | 3300049743 | Bacteria | 8385 |
| 277 | Ga0501081_0483690 | 3300049743 | Unclassified | 922 |
| 278 | Ga0501035_0051863 | 3300049822 | Bacteria | 3671 |
| 279 | Ga0501044_0093919 | 3300049823 | Bacteria | 3024 |
| 280 | Ga0501045_1087625 | 3300049824 | Bacteria | 585 |
| 281 | nmdc:mga05p37_1430569_c1 | 3300050507 | Bacteria | 694 |
| 282 | nmdc:mga05p37_174177_c1 | 3300050507 | Bacteria | 2622 |
| 283 | nmdc:mga06r32_12409_c1 | 3300050510 | Bacteria | 7689 |
| 284 | nmdc:mga06r32_756675_c1 | 3300050510 | Bacteria | 934 |
| 285 | nmdc:mga08y16_92245_c1 | 3300050511 | Bacteria | 3156 |
| 286 | nmdc:mga08y16_958920_c1 | 3300050511 | Bacteria | 838 |
| 287 | nmdc:mga0n895_809548_c1 | 3300050512 | Bacteria | 927 |
| 288 | nmdc:mga08x19_381307_c1 | 3300050514 | Bacteria | 987 |
| 289 | nmdc:mga08x19_384534_c1 | 3300050514 | Bacteria | 983 |
| 290 | nmdc:mga0a205_81003_c1 | 3300050515 | Bacteria | 3136 |
| 291 | Ga0500556_0000362 | 3300053104 | Bacteria | 33773 |
| 292 | Ga0500616_0006341 | 3300053153 | Bacteria | 7763 |
| 293 | Ga0500599_000981 | 3300053736 | Bacteria | 3195 |
| 294 | Ga0501084_0073796 | 3300054114 | Bacteria | 2857 |
| 295 | Ga0501084_0129328 | 3300054114 | Bacteria | 2125 |
| 296 | Ga0501082_0026673 | 3300060353 | Bacteria | 4980 |
| 297 | Ga0501082_0508752 | 3300060353 | Bacteria | 1053 |
| 298 | Ga0501082_0647481 | 3300060353 | Bacteria | 925 |
| 299 | Ga0466962_0006848 | 3300061719 | Bacteria | 5467 |
| 300 | Ga0530510_0002809 | 3300061734 | Bacteria | 11975 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039450 | Ga0436363_1571582 | Ga0436363_1571582_58_525 | 145 |
| 2 | 3300005338 | Ga0068868_100251544 | Ga0068868_1002515442 | 148 |
| 3 | 3300005338 | Ga0068868_100428585 | Ga0068868_1004285852 | 148 |
| 4 | 3300005367 | Ga0070667_100210818 | Ga0070667_1002108182 | 148 |
| 5 | 3300005445 | Ga0070708_101349016 | Ga0070708_1013490161 | 148 |
| 6 | 3300005458 | Ga0070681_10018848 | Ga0070681_100188482 | 148 |
| 7 | 3300005459 | Ga0068867_100058762 | Ga0068867_1000587623 | 148 |
| 8 | 3300005535 | Ga0070684_100246177 | Ga0070684_1002461772 | 148 |
| 9 | 3300005536 | Ga0070697_100484559 | Ga0070697_1004845592 | 148 |
| 10 | 3300005548 | Ga0070665_101292271 | Ga0070665_1012922712 | 148 |
| 11 | 3300005563 | Ga0068855_100448994 | Ga0068855_1004489944 | 148 |
| 12 | 3300005563 | Ga0068855_102358444 | Ga0068855_1023584441 | 148 |
| 13 | 3300005564 | Ga0070664_102116301 | Ga0070664_1021163011 | 148 |
| 14 | 3300005577 | Ga0068857_100091005 | Ga0068857_1000910056 | 148 |
| 15 | 3300005618 | Ga0068864_100588448 | Ga0068864_1005884482 | 148 |
| 16 | 3300005841 | Ga0068863_100340290 | Ga0068863_1003402901 | 148 |
| 17 | 3300005842 | Ga0068858_100007802 | Ga0068858_10000780211 | 148 |
| 18 | 3300005843 | Ga0068860_100009357 | Ga0068860_1000093577 | 148 |
| 19 | 3300006237 | Ga0097621_100092231 | Ga0097621_1000922317 | 148 |
| 20 | 3300006237 | Ga0097621_100100970 | Ga0097621_1001009703 | 148 |
| 21 | 3300006358 | Ga0068871_100143126 | Ga0068871_1001431262 | 148 |
| 22 | 3300006358 | Ga0068871_100466027 | Ga0068871_1004660272 | 148 |
| 23 | 3300009093 | Ga0105240_10013554 | Ga0105240_100135543 | 148 |
| 24 | 3300009093 | Ga0105240_10372893 | Ga0105240_103728932 | 148 |
| 25 | 3300009098 | Ga0105245_10017667 | Ga0105245_100176674 | 148 |
| 26 | 3300009101 | Ga0105247_10329335 | Ga0105247_103293353 | 148 |
| 27 | 3300009148 | Ga0105243_10235100 | Ga0105243_102351002 | 148 |
| 28 | 3300009176 | Ga0105242_10279206 | Ga0105242_102792062 | 148 |
| 29 | 3300009176 | Ga0105242_11400628 | Ga0105242_114006282 | 148 |
| 30 | 3300009177 | Ga0105248_10272473 | Ga0105248_102724732 | 148 |
| 31 | 3300009177 | Ga0105248_10273559 | Ga0105248_102735593 | 148 |
| 32 | 3300009545 | Ga0105237_11064891 | Ga0105237_110648912 | 148 |
| 33 | 3300009551 | Ga0105238_10049828 | Ga0105238_100498282 | 148 |
| 34 | 3300009553 | Ga0105249_10397271 | Ga0105249_103972714 | 148 |
| 35 | 3300010375 | Ga0105239_10393966 | Ga0105239_103939663 | 148 |
| 36 | 3300011119 | Ga0105246_10367683 | Ga0105246_103676832 | 148 |
| 37 | 3300013104 | Ga0157370_10071463 | Ga0157370_100714633 | 148 |
| 38 | 3300013296 | Ga0157374_10190792 | Ga0157374_101907921 | 148 |
| 39 | 3300013297 | Ga0157378_10127678 | Ga0157378_101276782 | 148 |
| 40 | 3300013306 | Ga0163162_10144517 | Ga0163162_101445173 | 148 |
| 41 | 3300013306 | Ga0163162_10320532 | Ga0163162_103205322 | 148 |
| 42 | 3300014325 | Ga0163163_10014430 | Ga0163163_1001443013 | 148 |
| 43 | 3300014968 | Ga0157379_10119644 | Ga0157379_101196442 | 148 |
| 44 | 3300014969 | Ga0157376_10011621 | Ga0157376_100116216 | 148 |
| 45 | 3300025899 | Ga0207642_10369574 | Ga0207642_103695742 | 148 |
| 46 | 3300025903 | Ga0207680_10034308 | Ga0207680_100343083 | 148 |
| 47 | 3300025911 | Ga0207654_10316228 | Ga0207654_103162282 | 148 |
| 48 | 3300025912 | Ga0207707_10003370 | Ga0207707_100033705 | 148 |
| 49 | 3300025913 | Ga0207695_10036793 | Ga0207695_100367933 | 148 |
| 50 | 3300025914 | Ga0207671_10285301 | Ga0207671_102853012 | 148 |
| 51 | 3300025921 | Ga0207652_10115658 | Ga0207652_101156583 | 148 |
| 52 | 3300025924 | Ga0207694_10339368 | Ga0207694_103393683 | 148 |
| 53 | 3300025927 | Ga0207687_10050762 | Ga0207687_100507624 | 148 |
| 54 | 3300025934 | Ga0207686_10046515 | Ga0207686_100465153 | 148 |
| 55 | 3300025934 | Ga0207686_10635433 | Ga0207686_106354332 | 148 |
| 56 | 3300025934 | Ga0207686_11326340 | Ga0207686_113263401 | 148 |
| 57 | 3300025938 | Ga0207704_10348570 | Ga0207704_103485702 | 148 |
| 58 | 3300025941 | Ga0207711_10740867 | Ga0207711_107408672 | 148 |
| 59 | 3300025942 | Ga0207689_10310723 | Ga0207689_103107232 | 148 |
| 60 | 3300025945 | Ga0207679_10634055 | Ga0207679_106340551 | 148 |
| 61 | 3300025949 | Ga0207667_10154181 | Ga0207667_101541814 | 148 |
| 62 | 3300025949 | Ga0207667_10216779 | Ga0207667_102167794 | 148 |
| 63 | 3300026023 | Ga0207677_10085519 | Ga0207677_100855193 | 148 |
| 64 | 3300026023 | Ga0207677_10170994 | Ga0207677_101709943 | 148 |
| 65 | 3300026035 | Ga0207703_10216787 | Ga0207703_102167872 | 148 |
| 66 | 3300026088 | Ga0207641_10410915 | Ga0207641_104109152 | 148 |
| 67 | 3300026089 | Ga0207648_10005008 | Ga0207648_100050088 | 148 |
| 68 | 3300026095 | Ga0207676_11230753 | Ga0207676_112307532 | 148 |
| 69 | 3300026116 | Ga0207674_10012794 | Ga0207674_1001279411 | 148 |
| 70 | 3300026142 | Ga0207698_12170374 | Ga0207698_121703741 | 148 |
| 71 | 3300028379 | Ga0268266_10471029 | Ga0268266_104710292 | 148 |
| 72 | 3300028381 | Ga0268264_10130111 | Ga0268264_101301111 | 148 |
| 73 | 3300031711 | Ga0265314_10023282 | Ga0265314_100232825 | 148 |
| 74 | 3300046472 | Ga0495580_0236151 | Ga0495580_0236151_388_834 | 148 |
| 75 | 3300048918 | Ga0496115_0077036 | Ga0496115_0077036_663_1109 | 148 |
| 76 | 3300048918 | Ga0496115_0501857 | Ga0496115_0501857_292_738 | 148 |
| 77 | iso_pu_bacteria | 2651869818 | 2652974025 | 149 |
| 78 | iso_pu_bacteria | 2919493220 | 2919494928 | 150 |
| 79 | iso_pu_bacteria | 2919543075 | 2919545883 | 150 |
| 80 | iso_pu_bacteria | 2923525760 | 2923529817 | 150 |
| 81 | 3300005337 | Ga0070682_100032463 | Ga0070682_1000324632 | 151 |
| 82 | 3300005338 | Ga0068868_100079689 | Ga0068868_1000796892 | 151 |
| 83 | 3300005344 | Ga0070661_100156557 | Ga0070661_1001565571 | 151 |
| 84 | 3300005347 | Ga0070668_100997222 | Ga0070668_1009972221 | 151 |
| 85 | 3300005354 | Ga0070675_101044733 | Ga0070675_1010447331 | 151 |
| 86 | 3300005364 | Ga0070673_100207312 | Ga0070673_1002073122 | 151 |
| 87 | 3300005437 | Ga0070710_10237707 | Ga0070710_102377072 | 151 |
| 88 | 3300005441 | Ga0070700_100002408 | Ga0070700_10000240812 | 151 |
| 89 | 3300005445 | Ga0070708_100068104 | Ga0070708_1000681044 | 151 |
| 90 | 3300005455 | Ga0070663_100109262 | Ga0070663_1001092623 | 151 |
| 91 | 3300005459 | Ga0068867_101330119 | Ga0068867_1013301191 | 151 |
| 92 | 3300005545 | Ga0070695_101107347 | Ga0070695_1011073471 | 151 |
| 93 | 3300005549 | Ga0070704_100876651 | Ga0070704_1008766511 | 151 |
| 94 | 3300005564 | Ga0070664_100812641 | Ga0070664_1008126412 | 151 |
| 95 | 3300005577 | Ga0068857_100604703 | Ga0068857_1006047032 | 151 |
| 96 | 3300005614 | Ga0068856_100030271 | Ga0068856_1000302717 | 151 |
| 97 | 3300005615 | Ga0070702_100028226 | Ga0070702_1000282262 | 151 |
| 98 | 3300005718 | Ga0068866_10297922 | Ga0068866_102979222 | 151 |
| 99 | 3300005981 | Ga0081538_10002606 | Ga0081538_1000260613 | 151 |
| 100 | 3300005981 | Ga0081538_10014149 | Ga0081538_100141495 | 151 |
| 101 | 3300005981 | Ga0081538_10063147 | Ga0081538_100631472 | 151 |
| 102 | 3300005983 | Ga0081540_1028862 | Ga0081540_10288622 | 151 |
| 103 | 3300006175 | Ga0070712_100926776 | Ga0070712_1009267762 | 151 |
| 104 | 3300006881 | Ga0068865_100147499 | Ga0068865_1001474992 | 151 |
| 105 | 3300009098 | Ga0105245_10001860 | Ga0105245_100018604 | 151 |
| 106 | 3300009098 | Ga0105245_10138089 | Ga0105245_101380893 | 151 |
| 107 | 3300009101 | Ga0105247_10204203 | Ga0105247_102042032 | 151 |
| 108 | 3300009148 | Ga0105243_10727900 | Ga0105243_107279002 | 151 |
| 109 | 3300009148 | Ga0105243_10941240 | Ga0105243_109412402 | 151 |
| 110 | 3300009176 | Ga0105242_10203114 | Ga0105242_102031142 | 151 |
| 111 | 3300009176 | Ga0105242_10770828 | Ga0105242_107708282 | 151 |
| 112 | 3300009176 | Ga0105242_10868416 | Ga0105242_108684162 | 151 |
| 113 | 3300009177 | Ga0105248_10695987 | Ga0105248_106959872 | 151 |
| 114 | 3300010375 | Ga0105239_10315813 | Ga0105239_103158131 | 151 |
| 115 | 3300011119 | Ga0105246_10014340 | Ga0105246_100143405 | 151 |
| 116 | 3300013105 | Ga0157369_10727860 | Ga0157369_107278602 | 151 |
| 117 | 3300013296 | Ga0157374_10322084 | Ga0157374_103220842 | 151 |
| 118 | 3300013307 | Ga0157372_11087430 | Ga0157372_110874302 | 151 |
| 119 | 3300013308 | Ga0157375_10281644 | Ga0157375_102816443 | 151 |
| 120 | 3300014325 | Ga0163163_10833189 | Ga0163163_108331892 | 151 |
| 121 | 3300014326 | Ga0157380_10010302 | Ga0157380_100103024 | 151 |
| 122 | 3300014745 | Ga0157377_10011559 | Ga0157377_100115591 | 151 |
| 123 | 3300014969 | Ga0157376_10986379 | Ga0157376_109863791 | 151 |
| 124 | 3300025899 | Ga0207642_10183348 | Ga0207642_101833483 | 151 |
| 125 | 3300025899 | Ga0207642_10204137 | Ga0207642_102041372 | 151 |
| 126 | 3300025900 | Ga0207710_10208313 | Ga0207710_102083132 | 151 |
| 127 | 3300025901 | Ga0207688_10023342 | Ga0207688_100233422 | 151 |
| 128 | 3300025915 | Ga0207693_10375891 | Ga0207693_103758912 | 151 |
| 129 | 3300025927 | Ga0207687_10001660 | Ga0207687_1000166012 | 151 |
| 130 | 3300025927 | Ga0207687_11617913 | Ga0207687_116179131 | 151 |
| 131 | 3300025932 | Ga0207690_10604830 | Ga0207690_106048301 | 151 |
| 132 | 3300025934 | Ga0207686_10095832 | Ga0207686_100958322 | 151 |
| 133 | 3300025935 | Ga0207709_10321640 | Ga0207709_103216402 | 151 |
| 134 | 3300025937 | Ga0207669_10428895 | Ga0207669_104288952 | 151 |
| 135 | 3300025942 | Ga0207689_10054380 | Ga0207689_100543805 | 151 |
| 136 | 3300025944 | Ga0207661_11140214 | Ga0207661_111402142 | 151 |
| 137 | 3300025945 | Ga0207679_10302540 | Ga0207679_103025402 | 151 |
| 138 | 3300025949 | Ga0207667_10242097 | Ga0207667_102420973 | 151 |
| 139 | 3300025960 | Ga0207651_10176867 | Ga0207651_101768673 | 151 |
| 140 | 3300026023 | Ga0207677_10260079 | Ga0207677_102600792 | 151 |
| 141 | 3300026035 | Ga0207703_11621412 | Ga0207703_116214121 | 151 |
| 142 | 3300026067 | Ga0207678_10149216 | Ga0207678_101492162 | 151 |
| 143 | 3300026075 | Ga0207708_10002521 | Ga0207708_1000252117 | 151 |
| 144 | 3300026078 | Ga0207702_10607886 | Ga0207702_106078862 | 151 |
| 145 | 3300026089 | Ga0207648_10278804 | Ga0207648_102788042 | 151 |
| 146 | 3300026116 | Ga0207674_10865065 | Ga0207674_108650652 | 151 |
| 147 | 3300026121 | Ga0207683_10020677 | Ga0207683_100206773 | 151 |
| 148 | 3300038443 | Ga0395901_0347224 | Ga0395901_0347224_785_1246 | 151 |
| 149 | 3300042008 | Ga0439450_008554 | Ga0439450_008554_482_937 | 151 |
| 150 | 3300042993 | Ga0439440_0028017 | Ga0439440_0028017_681_1136 | 151 |
| 151 | 3300044735 | Ga0466968_0702324 | Ga0466968_0702324_36_491 | 151 |
| 152 | 3300048904 | Ga0496101_0744076 | Ga0496101_0744076_196_651 | 151 |
| 153 | 3300048908 | Ga0496105_0122269 | Ga0496105_0122269_119_574 | 151 |
| 154 | 3300048909 | Ga0496106_0334062 | Ga0496106_0334062_282_737 | 151 |
| 155 | 3300048910 | Ga0496107_0112480 | Ga0496107_0112480_543_998 | 151 |
| 156 | 3300048911 | Ga0496108_0049880 | Ga0496108_0049880_46_501 | 151 |
| 157 | 3300048912 | Ga0496109_0059190 | Ga0496109_0059190_2922_3377 | 151 |
| 158 | 3300048913 | Ga0496110_0053311 | Ga0496110_0053311_3007_3462 | 151 |
| 159 | 3300048914 | Ga0496111_0193996 | Ga0496111_0193996_958_1413 | 151 |
| 160 | 3300048916 | Ga0496113_0469142 | Ga0496113_0469142_221_676 | 151 |
| 161 | 3300048916 | Ga0496113_0557245 | Ga0496113_0557245_161_616 | 151 |
| 162 | 3300048918 | Ga0496115_0416453 | Ga0496115_0416453_406_861 | 151 |
| 163 | 3300049568 | Ga0501031_0117458 | Ga0501031_0117458_213_668 | 151 |
| 164 | 3300049570 | Ga0501033_0366103 | Ga0501033_0366103_372_827 | 151 |
| 165 | 3300049572 | Ga0501036_0013387 | Ga0501036_0013387_207_662 | 151 |
| 166 | 3300049574 | Ga0501038_0764705 | Ga0501038_0764705_73_528 | 151 |
| 167 | 3300049576 | Ga0501040_0071627 | Ga0501040_0071627_613_1068 | 151 |
| 168 | 3300049577 | Ga0501041_0572966 | Ga0501041_0572966_122_577 | 151 |
| 169 | 3300049578 | Ga0501042_0671205 | Ga0501042_0671205_190_645 | 151 |
| 170 | 3300049579 | Ga0501043_0932697 | Ga0501043_0932697_137_592 | 151 |
| 171 | 3300049582 | Ga0501048_0132574 | Ga0501048_0132574_482_937 | 151 |
| 172 | 3300049587 | Ga0501071_0390269 | Ga0501071_0390269_407_862 | 151 |
| 173 | 3300049588 | Ga0501072_0118143 | Ga0501072_0118143_1144_1599 | 151 |
| 174 | 3300049592 | Ga0501076_0539942 | Ga0501076_0539942_448_903 | 151 |
| 175 | 3300049593 | Ga0501077_0668281 | Ga0501077_0668281_63_518 | 151 |
| 176 | 3300049743 | Ga0501081_0005192 | Ga0501081_0005192_7709_8164 | 151 |
| 177 | 3300050511 | nmdc:mga08y16_958920_c1 | nmdc:mga08y16_958920_c1_166_621 | 151 |
| 178 | 3300050514 | nmdc:mga08x19_381307_c1 | nmdc:mga08x19_381307_c1_308_763 | 151 |
| 179 | 3300054114 | Ga0501084_0129328 | Ga0501084_0129328_881_1336 | 151 |
| 180 | 3300061734 | Ga0530510_0002809 | Ga0530510_0002809_5059_5514 | 151 |
| 181 | iso_pu_bacteria | 2919497567 | 2919499828 | 151 |
| 182 | 3300005329 | Ga0070683_100373892 | Ga0070683_1003738922 | 152 |
| 183 | 3300005336 | Ga0070680_100274325 | Ga0070680_1002743252 | 152 |
| 184 | 3300005338 | Ga0068868_100512505 | Ga0068868_1005125051 | 152 |
| 185 | 3300005345 | Ga0070692_10185026 | Ga0070692_101850262 | 152 |
| 186 | 3300005434 | Ga0070709_11026492 | Ga0070709_110264921 | 152 |
| 187 | 3300005439 | Ga0070711_100623141 | Ga0070711_1006231411 | 152 |
| 188 | 3300005530 | Ga0070679_100004965 | Ga0070679_1000049655 | 152 |
| 189 | 3300006175 | Ga0070712_100162196 | Ga0070712_1001621962 | 152 |
| 190 | 3300006175 | Ga0070712_101215591 | Ga0070712_1012155911 | 152 |
| 191 | 3300006844 | Ga0075428_101819444 | Ga0075428_1018194441 | 152 |
| 192 | 3300006847 | Ga0075431_100051293 | Ga0075431_1000512933 | 152 |
| 193 | 3300006847 | Ga0075431_100410869 | Ga0075431_1004108692 | 152 |
| 194 | 3300006871 | Ga0075434_100200666 | Ga0075434_1002006662 | 152 |
| 195 | 3300006914 | Ga0075436_100022562 | Ga0075436_1000225626 | 152 |
| 196 | 3300009094 | Ga0111539_10786780 | Ga0111539_107867802 | 152 |
| 197 | 3300009147 | Ga0114129_11111667 | Ga0114129_111116672 | 152 |
| 198 | 3300014497 | Ga0182008_10191441 | Ga0182008_101914412 | 152 |
| 199 | 3300025914 | Ga0207671_10589188 | Ga0207671_105891882 | 152 |
| 200 | 3300025915 | Ga0207693_10062714 | Ga0207693_100627143 | 152 |
| 201 | 3300025921 | Ga0207652_10003837 | Ga0207652_1000383710 | 152 |
| 202 | 3300025929 | Ga0207664_10248952 | Ga0207664_102489523 | 152 |
| 203 | 3300025939 | Ga0207665_10078490 | Ga0207665_100784902 | 152 |
| 204 | 3300025944 | Ga0207661_10426712 | Ga0207661_104267122 | 152 |
| 205 | 3300026089 | Ga0207648_10039785 | Ga0207648_100397853 | 152 |
| 206 | 3300026118 | Ga0207675_100507058 | Ga0207675_1005070582 | 152 |
| 207 | 3300028556 | Ga0265337_1000762 | Ga0265337_10007621 | 152 |
| 208 | 3300028558 | Ga0265326_10000666 | Ga0265326_100006666 | 152 |
| 209 | 3300028563 | Ga0265319_1000034 | Ga0265319_1000034113 | 152 |
| 210 | 3300028563 | Ga0265319_1000065 | Ga0265319_100006516 | 152 |
| 211 | 3300028577 | Ga0265318_10000518 | Ga0265318_100005189 | 152 |
| 212 | 3300028666 | Ga0265336_10000001 | Ga0265336_10000001333 | 152 |
| 213 | 3300028800 | Ga0265338_10000004 | Ga0265338_10000004548 | 152 |
| 214 | 3300028800 | Ga0265338_10311574 | Ga0265338_103115743 | 152 |
| 215 | 3300029957 | Ga0265324_10013592 | Ga0265324_100135922 | 152 |
| 216 | 3300031235 | Ga0265330_10043343 | Ga0265330_100433433 | 152 |
| 217 | 3300031240 | Ga0265320_10016927 | Ga0265320_100169274 | 152 |
| 218 | 3300031247 | Ga0265340_10000002 | Ga0265340_10000002548 | 152 |
| 219 | 3300031251 | Ga0265327_10238586 | Ga0265327_102385861 | 152 |
| 220 | 3300031344 | Ga0265316_10008742 | Ga0265316_100087423 | 152 |
| 221 | 3300031712 | Ga0265342_10106034 | Ga0265342_101060342 | 152 |
| 222 | 3300031901 | Ga0307406_10479316 | Ga0307406_104793162 | 152 |
| 223 | 3300032126 | Ga0307415_100540649 | Ga0307415_1005406491 | 152 |
| 224 | 3300044693 | Ga0466961_0008887 | Ga0466961_0008887_743_1204 | 152 |
| 225 | 3300044694 | Ga0466963_0072737 | Ga0466963_0072737_305_766 | 152 |
| 226 | 3300044706 | Ga0466964_0148716 | Ga0466964_0148716_480_941 | 152 |
| 227 | 3300044719 | Ga0466971_0003614 | Ga0466971_0003614_4416_4877 | 152 |
| 228 | 3300044765 | Ga0466970_0022627 | Ga0466970_0022627_1757_2218 | 152 |
| 229 | 3300045049 | Ga0466959_0616238 | Ga0466959_0616238_49_510 | 152 |
| 230 | 3300045836 | Ga0466958_0004797 | Ga0466958_0004797_4037_4498 | 152 |
| 231 | 3300045976 | Ga0466967_0913638 | Ga0466967_0913638_159_623 | 152 |
| 232 | 3300046474 | Ga0495605_0186773 | Ga0495605_0186773_100_573 | 152 |
| 233 | 3300046491 | Ga0495584_0208200 | Ga0495584_0208200_93_566 | 152 |
| 234 | 3300046543 | Ga0495645_0425155 | Ga0495645_0425155_101_559 | 152 |
| 235 | 3300046616 | Ga0495668_0154458 | Ga0495668_0154458_761_1234 | 152 |
| 236 | 3300048088 | Ga0495602_0809257 | Ga0495602_0809257_127_588 | 152 |
| 237 | 3300048915 | Ga0496112_0450415 | Ga0496112_0450415_702_1166 | 152 |
| 238 | 3300049568 | Ga0501031_0257305 | Ga0501031_0257305_451_909 | 152 |
| 239 | 3300049568 | Ga0501031_0334386 | Ga0501031_0334386_135_593 | 152 |
| 240 | 3300049569 | Ga0501032_0136819 | Ga0501032_0136819_1113_1571 | 152 |
| 241 | 3300049570 | Ga0501033_0049040 | Ga0501033_0049040_152_610 | 152 |
| 242 | 3300049571 | Ga0501034_0068087 | Ga0501034_0068087_3048_3506 | 152 |
| 243 | 3300049572 | Ga0501036_0022934 | Ga0501036_0022934_2895_3353 | 152 |
| 244 | 3300049573 | Ga0501037_0082986 | Ga0501037_0082986_409_867 | 152 |
| 245 | 3300049574 | Ga0501038_0044873 | Ga0501038_0044873_2042_2500 | 152 |
| 246 | 3300049575 | Ga0501039_0602473 | Ga0501039_0602473_64_522 | 152 |
| 247 | 3300049578 | Ga0501042_0054163 | Ga0501042_0054163_483_941 | 152 |
| 248 | 3300049579 | Ga0501043_0068296 | Ga0501043_0068296_1474_1932 | 152 |
| 249 | 3300049580 | Ga0501046_0049419 | Ga0501046_0049419_966_1424 | 152 |
| 250 | 3300049581 | Ga0501047_0306387 | Ga0501047_0306387_41_499 | 152 |
| 251 | 3300049584 | Ga0501068_0070230 | Ga0501068_0070230_1501_1959 | 152 |
| 252 | 3300049586 | Ga0501070_0082813 | Ga0501070_0082813_510_968 | 152 |
| 253 | 3300049587 | Ga0501071_0294868 | Ga0501071_0294868_698_1156 | 152 |
| 254 | 3300049589 | Ga0501073_0009321 | Ga0501073_0009321_4518_4976 | 152 |
| 255 | 3300049590 | Ga0501074_0086301 | Ga0501074_0086301_1085_1543 | 152 |
| 256 | 3300049822 | Ga0501035_0051863 | Ga0501035_0051863_62_520 | 152 |
| 257 | 3300049823 | Ga0501044_0093919 | Ga0501044_0093919_1114_1572 | 152 |
| 258 | 3300049824 | Ga0501045_1087625 | Ga0501045_1087625_19_501 | 152 |
| 259 | 3300050507 | nmdc:mga05p37_1430569_c1 | nmdc:mga05p37_1430569_c1_215_676 | 152 |
| 260 | 3300050510 | nmdc:mga06r32_756675_c1 | nmdc:mga06r32_756675_c1_59_520 | 152 |
| 261 | 3300050511 | nmdc:mga08y16_92245_c1 | nmdc:mga08y16_92245_c1_2587_3048 | 152 |
| 262 | 3300050514 | nmdc:mga08x19_384534_c1 | nmdc:mga08x19_384534_c1_360_821 | 152 |
| 263 | 3300050515 | nmdc:mga0a205_81003_c1 | nmdc:mga0a205_81003_c1_769_1230 | 152 |
| 264 | 3300053104 | Ga0500556_0000362 | Ga0500556_0000362_2673_3131 | 152 |
| 265 | 3300053153 | Ga0500616_0006341 | Ga0500616_0006341_6595_7053 | 152 |
| 266 | 3300053736 | Ga0500599_000981 | Ga0500599_000981_2063_2521 | 152 |
| 267 | 3300054114 | Ga0501084_0073796 | Ga0501084_0073796_117_578 | 152 |
| 268 | 3300060353 | Ga0501082_0026673 | Ga0501082_0026673_1054_1512 | 152 |
| 269 | 3300061719 | Ga0466962_0006848 | Ga0466962_0006848_146_607 | 152 |
| 270 | 3300005983 | Ga0081540_1040320 | Ga0081540_10403201 | 153 |
| 271 | 3300021388 | Ga0213875_10074832 | Ga0213875_100748322 | 153 |
| 272 | 3300025933 | Ga0207706_10427282 | Ga0207706_104272821 | 153 |
| 273 | 3300037853 | Ga0436364_0918908 | Ga0436364_0918908_1649_2113 | 153 |
| 274 | 3300039437 | Ga0436365_0986987 | Ga0436365_0986987_4975_5439 | 153 |
| 275 | 3300039453 | Ga0436362_1185631 | Ga0436362_1185631_387_851 | 153 |
| 276 | 3300044765 | Ga0466970_0135457 | Ga0466970_0135457_99_560 | 153 |
| 277 | 3300045836 | Ga0466958_0565451 | Ga0466958_0565451_238_699 | 153 |
| 278 | 3300049580 | Ga0501046_0778517 | Ga0501046_0778517_152_628 | 153 |
| 279 | 3300049587 | Ga0501071_0051772 | Ga0501071_0051772_15_491 | 153 |
| 280 | 3300049587 | Ga0501071_0927444 | Ga0501071_0927444_87_563 | 153 |
| 281 | 3300049588 | Ga0501072_0266295 | Ga0501072_0266295_361_837 | 153 |
| 282 | 3300049588 | Ga0501072_0735611 | Ga0501072_0735611_252_713 | 153 |
| 283 | 3300049593 | Ga0501077_0920171 | Ga0501077_0920171_20_496 | 153 |
| 284 | 3300049742 | Ga0501080_0511797 | Ga0501080_0511797_388_864 | 153 |
| 285 | 3300049743 | Ga0501081_0483690 | Ga0501081_0483690_218_694 | 153 |
| 286 | 3300060353 | Ga0501082_0508752 | Ga0501082_0508752_18_479 | 153 |
| 287 | 3300060353 | Ga0501082_0647481 | Ga0501082_0647481_252_728 | 153 |
| 288 | 3300005354 | Ga0070675_100352017 | Ga0070675_1003520171 | 154 |
| 289 | 3300006852 | Ga0075433_10287017 | Ga0075433_102870172 | 154 |
| 290 | 3300009147 | Ga0114129_10321950 | Ga0114129_103219502 | 154 |
| 291 | 3300014745 | Ga0157377_11490980 | Ga0157377_114909801 | 154 |
| 292 | 3300025907 | Ga0207645_10074013 | Ga0207645_100740132 | 154 |
| 293 | 3300039447 | Ga0436361_0346645 | Ga0436361_0346645_15_488 | 154 |
| 294 | 3300039453 | Ga0436362_1238080 | Ga0436362_1238080_83_550 | 154 |
| 295 | 3300044684 | Ga0466966_0042179 | Ga0466966_0042179_438_908 | 154 |
| 296 | 3300046516 | Ga0495628_0409122 | Ga0495628_0409122_152_628 | 154 |
| 297 | 3300046533 | Ga0495640_0212575 | Ga0495640_0212575_124_600 | 154 |
| 298 | 3300046663 | Ga0495635_0074038 | Ga0495635_0074038_1430_1906 | 154 |
| 299 | 3300046663 | Ga0495635_0329687 | Ga0495635_0329687_460_939 | 154 |
| 300 | 3300047317 | Ga0495604_0189957 | Ga0495604_0189957_335_811 | 154 |
| 301 | 3300047321 | Ga0495676_0690624 | Ga0495676_0690624_70_546 | 154 |
| 302 | 3300050507 | nmdc:mga05p37_174177_c1 | nmdc:mga05p37_174177_c1_2078_2596 | 154 |
| 303 | 3300050510 | nmdc:mga06r32_12409_c1 | nmdc:mga06r32_12409_c1_7079_7597 | 154 |
| 304 | 3300050512 | nmdc:mga0n895_809548_c1 | nmdc:mga0n895_809548_c1_15_533 | 154 |
| 305 | 3300005288 | Ga0065714_10074682 | Ga0065714_100746822 | 155 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5iph-assembly1.cif.gz_A | xanthomonas campestris peroxiredoxin q - c84s mutant | 0.9455 | 13 | 154 |
| 5imf-assembly1.cif.gz_A | xanthomonas campestris peroxiredoxin q - structure f5 | 0.9434 | 13 | 154 |
| 5io2-assembly1.cif.gz_A | xanthomonas campestris peroxiredoxin q - c48s mutant | 0.9433 | 13 | 154 |
| 3gkm-assembly1.cif.gz_A | insights into the alkyl peroxide reduction activity of xanthomonas campestris bacterioferritin comigratory protein from the trapped intermediate/ligand complex structures | 0.9426 | 13 | 154 |
| 3ixr-assembly1.cif.gz_A | crystal structure of xylella fastidiosa prxq c47s mutant | 0.9271 | 1 | 154 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AE52_4_156_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9927 | 4 | 154 | 3.40.30.10 |
| af_P0AE52_4_156_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.967 | 4 | 154 | 3.40.30.10 |
| af_Q2G280_3_151_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9601 | 6 | 155 | 3.40.30.10 |
| af_P9WIE1_7_157_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9483 | 4 | 155 | 3.40.30.10 |
| af_Q2G280_3_151_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9476 | 6 | 155 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-W0Q5S7-F1-model_v4 | thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin Bcp) | 0.993 | 2 | 155 |
GO:0005737
GO:0008379 GO:0034599 GO:0045454 |
| AF-A0A359EDY2-F1-model_v4 | thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) | 0.9918 | 44 | 154 |
GO:0005737
GO:0008379 GO:0034599 GO:0045454 |
| AF-A0A841GN13-F1-model_v4 | thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Bacterioferritin comigratory protein) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin Bcp) | 0.9909 | 1 | 154 |
GO:0005737
GO:0008379 GO:0034599 GO:0045454 |
| AF-A0A1F8TUU8-F1-model_v4 | thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin Bcp) | 0.9907 | 17 | 155 |
GO:0005737
GO:0008379 GO:0034599 GO:0045454 |
| AF-A0A5C8LTU4-F1-model_v4 | thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin Bcp) | 0.9906 | 1 | 121 |
GO:0005737
GO:0008379 GO:0034599 GO:0045454 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar