F398026

General Info

Members Datasets Scaffolds Average Seq Length
305 245 610 112

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100462469|Ga0068856_1004624691
Length 129
Sequence MAVRQRMKRGEVWTIAGGSDYAGKPRPVAIVQDDIFDATDSITVCPFTTDETEAPLFRLQVEPNERNGLRALSRLMVDKITTVPKAEVGTLVGRLDDDDLLRLNRAILVFLGLAGSQKKHRCRLARVPD

Samples

Sample ID Description Type Environment
1 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
7 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
8 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
9 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
10 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
104 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
105 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
106 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
107 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
108 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
109 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
110 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
111 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
112 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
113 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
114 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
115 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
116 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
117 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
118 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
119 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
120 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
121 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
124 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
125 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
130 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
131 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
132 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
133 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
134 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
135 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
136 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
137 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
138 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
139 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
140 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
141 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
142 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
143 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
144 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
145 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
146 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
147 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
148 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
149 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
150 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
151 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
152 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
153 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
154 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
155 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
156 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
157 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
163 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
164 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
165 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
166 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
167 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
168 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
169 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
170 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
183 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
184 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
185 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
186 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
187 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
188 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
189 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
190 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
191 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
192 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
194 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
195 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
196 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
197 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
198 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
199 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
200 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
201 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
202 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
203 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
204 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
205 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
206 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
207 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
208 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
209 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
210 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
211 2922368715
212 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
213 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
214 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
215 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
216 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
217 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
218 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
219 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
220 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
221 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
222 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
223 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
224 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
225 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
226 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
227 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
228 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
229 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
230 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
231 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
232 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
233 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
234 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
235 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
236 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
237 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
238 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
239 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
240 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
241 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
242 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
243 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
244 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
245 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.83
Metatranscriptomes 0
Isolates 12.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.64
Nodule 11.8
Rhizoplane 2.3
Rhizosphere 80
Stem 0
Stem Tuber 0
Unclassified 14.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068856_100462469 3300005614 Bacteria 1289
2 LJQas_1002180 3300000549 Bacteria 2764
3 JGI24740J21852_10037807 3300001979 Bacteria 1486
4 JGI24739J22299_10187412 3300001989 Bacteria 608
5 JGI24737J22298_10043105 3300001990 Bacteria 1381
6 JGI24748J21848_1000092 3300002074 Bacteria 25065
7 JGI24749J21850_1001790 3300002076 Bacteria 3040
8 JGI24034J26672_10000040 3300002239 Bacteria 72195
9 JGI24742J22300_10002584 3300002244 Bacteria 2896
10 JGI24751J29686_10048435 3300002459 Bacteria 877
11 Ga0070683_100000042 3300005329 Bacteria 115507
12 Ga0070670_100020279 3300005331 Bacteria 5712
13 Ga0070670_100824647 3300005331 Bacteria 838
14 Ga0070682_100500262 3300005337 Bacteria 942
15 Ga0068868_100673067 3300005338 Bacteria 923
16 Ga0070661_100874740 3300005344 Bacteria 741
17 Ga0070668_100099336 3300005347 Bacteria 2304
18 Ga0070669_100000953 3300005353 Bacteria 21108
19 Ga0070671_100048860 3300005355 Unclassified 3519
20 Ga0070671_100097224 3300005355 Bacteria 2469
21 Ga0070674_101748170 3300005356 Bacteria 563
22 Ga0070688_100003271 3300005365 Bacteria 8310
23 Ga0070667_100059889 3300005367 Bacteria 3222
24 Ga0070694_100922027 3300005444 Unclassified 722
25 Ga0070663_100031812 3300005455 Bacteria 3630
26 Ga0070663_100181871 3300005455 Bacteria 1631
27 Ga0070662_100225359 3300005457 Bacteria 1497
28 Ga0068867_100997311 3300005459 Unclassified 759
29 Ga0070685_10000102 3300005466 Bacteria 53800
30 Ga0070707_100007703 3300005468 Bacteria 10002
31 Ga0070707_101078766 3300005468 Unclassified 769
32 Ga0070699_100225998 3300005518 Unclassified 1669
33 Ga0070684_100000303 3300005535 Bacteria 34159
34 Ga0070697_100130038 3300005536 Unclassified 2111
35 Ga0070697_101643751 3300005536 Unclassified 574
36 Ga0068853_100061533 3300005539 Bacteria 3247
37 Ga0070672_100143084 3300005543 Bacteria 1974
38 Ga0070672_100226076 3300005543 Bacteria 1571
39 Ga0070686_101132456 3300005544 Bacteria 647
40 Ga0070696_100590253 3300005546 Bacteria 894
41 Ga0070665_100000510 3300005548 Bacteria 55798
42 Ga0070665_100112932 3300005548 Bacteria 2720
43 Ga0070665_101197075 3300005548 Bacteria 770
44 Ga0068855_100081423 3300005563 Bacteria 3752
45 Ga0068855_101367491 3300005563 Bacteria 731
46 Ga0070664_100224214 3300005564 Bacteria 1682
47 Ga0068856_100484687 3300005614 Unclassified 1258
48 Ga0068852_100252699 3300005616 Bacteria 1689
49 Ga0068859_100029617 3300005617 Bacteria 5493
50 Ga0068859_101129503 3300005617 Unclassified 862
51 Ga0068864_100025910 3300005618 Bacteria 4942
52 Ga0068861_100024201 3300005719 Bacteria 4389
53 Ga0068863_100000109 3300005841 Bacteria 86619
54 Ga0068858_100014536 3300005842 Bacteria 7416
55 Ga0068862_100002140 3300005844 Bacteria 17790
56 Ga0070717_11348859 3300006028 Unclassified 648
57 Ga0075365_10133795 3300006038 Bacteria 1717
58 Ga0075366_10278826 3300006195 Bacteria 1021
59 Ga0068871_102255297 3300006358 Unclassified 519
60 Ga0075428_100042105 3300006844 Bacteria 5024
61 Ga0075430_100032433 3300006846 Bacteria 4435
62 Ga0075431_100018225 3300006847 Bacteria 7142
63 Ga0075431_100046452 3300006847 Bacteria 4478
64 Ga0075433_10037964 3300006852 Bacteria 4158
65 Ga0075434_100177086 3300006871 Bacteria 2153
66 Ga0075429_100254553 3300006880 Bacteria 1537
67 Ga0097620_100029619 3300006931 Bacteria 5493
68 Ga0097620_101129407 3300006931 Unclassified 862
69 Ga0075435_100082309 3300007076 Bacteria 2646
70 Ga0105244_10322531 3300009036 Unclassified 713
71 Ga0105240_10450666 3300009093 Bacteria 1440
72 Ga0105245_11343906 3300009098 Bacteria 764
73 Ga0114129_10022545 3300009147 Bacteria 8934
74 Ga0114129_10661721 3300009147 Bacteria 1347
75 Ga0114129_12765836 3300009147 Bacteria 584
76 Ga0105241_10022953 3300009174 Bacteria 4625
77 Ga0105242_12256891 3300009176 Bacteria 590
78 Ga0105248_10216098 3300009177 Bacteria 2159
79 Ga0105248_12675360 3300009177 Bacteria 569
80 Ga0105237_10268485 3300009545 Bacteria 1709
81 Ga0105237_11477139 3300009545 Bacteria 686
82 Ga0105239_10615108 3300010375 Bacteria 1240
83 Ga0105239_10900460 3300010375 Bacteria 1015
84 Ga0105239_11852442 3300010375 Bacteria 699
85 Ga0157370_10667126 3300013104 Bacteria 950
86 Ga0163162_10093185 3300013306 Bacteria 3097
87 Ga0163162_13453207 3300013306 Bacteria 503
88 Ga0157372_10255498 3300013307 Bacteria 2034
89 Ga0157375_10003294 3300013308 Bacteria 13982
90 Ga0157375_10724939 3300013308 Bacteria 1147
91 Ga0157375_13799436 3300013308 Bacteria 501
92 Ga0163163_10192789 3300014325 Bacteria 2086
93 Ga0157379_10042852 3300014968 Bacteria 4041
94 Ga0157376_10359266 3300014969 Bacteria 1396
95 Ga0213873_10098225 3300021358 Bacteria 839
96 Ga0213876_10163449 3300021384 Bacteria 1184
97 Ga0213871_10064725 3300021441 Bacteria 1023
98 Ga0207654_10087606 3300025911 Bacteria 1890
99 Ga0207695_10340985 3300025913 Unclassified 1386
100 Ga0207671_10030702 3300025914 Bacteria 4005
101 Ga0207646_10021635 3300025922 Bacteria 5937
102 Ga0207646_10797959 3300025922 Bacteria 841
103 Ga0207681_10000133 3300025923 Bacteria 60815
104 Ga0207650_10019024 3300025925 Bacteria 4827
105 Ga0207650_10356714 3300025925 Bacteria 1204
106 Ga0207687_10249012 3300025927 Unclassified 1411
107 Ga0207687_10412309 3300025927 Bacteria 1113
108 Ga0207644_10075061 3300025931 Bacteria 2483
109 Ga0207690_10204288 3300025932 Bacteria 1502
110 Ga0207706_10347704 3300025933 Bacteria 1289
111 Ga0207691_10321165 3300025940 Bacteria 1327
112 Ga0207661_10000002 3300025944 Bacteria 816104
113 Ga0207679_10212353 3300025945 Bacteria 1624
114 Ga0207667_10066057 3300025949 Bacteria 3771
115 Ga0207667_11788005 3300025949 Bacteria 579
116 Ga0207658_10014887 3300025986 Bacteria 5330
117 Ga0207658_11615063 3300025986 Bacteria 593
118 Ga0207677_11619201 3300026023 Unclassified 600
119 Ga0207703_10002038 3300026035 Bacteria 17838
120 Ga0207639_10043897 3300026041 Bacteria 3359
121 Ga0207639_12067377 3300026041 Bacteria 531
122 Ga0207678_10039559 3300026067 Bacteria 4093
123 Ga0207678_10057469 3300026067 Bacteria 3348
124 Ga0207678_10310705 3300026067 Bacteria 1355
125 Ga0207702_11387560 3300026078 Unclassified 696
126 Ga0207641_10000274 3300026088 Bacteria 65428
127 Ga0207676_10034709 3300026095 Bacteria 3820
128 Ga0207674_10069263 3300026116 Bacteria 3549
129 Ga0207675_100004736 3300026118 Bacteria 13101
130 Ga0207698_10033575 3300026142 Bacteria 3730
131 Ga0268266_10000009 3300028379 Bacteria 1097737
132 Ga0268266_10243484 3300028379 Bacteria 1661
133 Ga0268266_10417197 3300028379 Bacteria 1271
134 Ga0268266_10465136 3300028379 Bacteria 1204
135 Ga0268266_11145684 3300028379 Bacteria 752
136 Ga0268265_10000095 3300028380 Bacteria 112751
137 Ga0307515_10587341 3300028794 Bacteria 724
138 Ga0265338_10288837 3300028800 Unclassified 1196
139 Ga0265331_10001159 3300031250 Bacteria 20100
140 Ga0265327_10001468 3300031251 Bacteria 29534
141 Ga0265313_10000509 3300031595 Bacteria 40853
142 Ga0307508_10175834 3300031616 Bacteria 1744
143 Ga0316579_10049058 3300031691 Bacteria 1973
144 Ga0265314_10017537 3300031711 Bacteria 5617
145 Ga0265342_10022447 3300031712 Bacteria 4011
146 Ga0316576_10400368 3300031727 Bacteria 1017
147 Ga0316578_10024772 3300031728 Bacteria 3369
148 Ga0316578_10718590 3300031728 Bacteria 581
149 Ga0316577_10000667 3300031733 Bacteria 14363
150 Ga0316577_10197646 3300031733 Bacteria 1136
151 Ga0307407_10699004 3300031903 Bacteria 764
152 Ga0307412_11265032 3300031911 Unclassified 663
153 Ga0307411_10337110 3300032005 Unclassified 1224
154 Ga0373954_0662496 3300035118 Unclassified 517
155 Ga0373946_0086453 3300035171 Bacteria 1382
156 Ga0316574_0061203 3300035398 Unclassified 2364
157 Ga0373927_0001151 3300035695 Bacteria 20007
158 Ga0373927_0290862 3300035695 Bacteria 1075
159 Ga0373937_0139449 3300036401 Bacteria 2268
160 Ga0316582_0207106 3300036647 Unclassified 1339
161 Ga0316582_0403734 3300036647 Bacteria 941
162 Ga0316584_0008120 3300036712 Bacteria 7212
163 Ga0316584_0390870 3300036712 Bacteria 992
164 Ga0373925_0001742 3300037068 Bacteria 18219
165 Ga0373925_0268426 3300037068 Bacteria 1372
166 Ga0373925_1280488 3300037068 Unclassified 602
167 Ga0395905_0003128 3300037471 Bacteria 17853
168 Ga0316581_0045749 3300037588 Unclassified 1337
169 Ga0395901_0479469 3300038443 Bacteria 1269
170 Ga0436365_1237344 3300039437 Bacteria 785
171 Ga0436365_1314960 3300039437 Bacteria 2877
172 Ga0436365_1841274 3300039437 Unclassified 842
173 Ga0436360_0448838 3300039438 Bacteria 1489
174 Ga0436360_1027822 3300039438 Bacteria 3425
175 Ga0436361_1062981 3300039447 Bacteria 1257
176 Ga0436362_0374844 3300039453 Bacteria 3001
177 Ga0466966_0001161 3300044684 Bacteria 16930
178 Ga0451576_0005687 3300045051 Bacteria 15555
179 Ga0495592_0133623 3300046454 Bacteria 1733
180 Ga0495603_0044757 3300046455 Bacteria 2641
181 Ga0495603_0104341 3300046455 Bacteria 1654
182 Ga0495629_0168737 3300046459 Unclassified 1519
183 Ga0495651_0352240 3300046462 Unclassified 973
184 Ga0495582_0422645 3300046473 Bacteria 769
185 Ga0495664_0020829 3300046477 Bacteria 3786
186 Ga0495616_0270204 3300046513 Bacteria 725
187 Ga0495628_0269065 3300046516 Bacteria 1268
188 Ga0495648_0275555 3300046524 Bacteria 800
189 Ga0495652_0942405 3300046529 Unclassified 567
190 Ga0495609_0178379 3300046538 Bacteria 895
191 Ga0495645_0036449 3300046543 Bacteria 3585
192 Ga0495622_0031300 3300046557 Bacteria 2487
193 Ga0495588_0351006 3300046674 Bacteria 775
194 Ga0495588_0569054 3300046674 Unclassified 594
195 Ga0495599_0095062 3300046678 Bacteria 1859
196 Ga0495623_0175535 3300046679 Bacteria 1249
197 Ga0495658_0961367 3300046683 Unclassified 546
198 Ga0495613_0204314 3300046689 Unclassified 1392
199 Ga0495670_0405166 3300046691 Bacteria 737
200 Ga0495671_0079533 3300046692 Bacteria 1607
201 Ga0495581_0329879 3300047315 Unclassified 891
202 Ga0495604_0455551 3300047317 Bacteria 835
203 Ga0495602_0219392 3300048088 Unclassified 1437
204 Ga0496100_0198081 3300048903 Bacteria 1462
205 Ga0496102_0651229 3300048905 Bacteria 976
206 Ga0496103_0010377 3300048906 Bacteria 5512
207 Ga0496104_0211261 3300048907 Bacteria 1852
208 Ga0496106_0078035 3300048909 Bacteria 2540
209 Ga0496107_0066514 3300048910 Bacteria 2613
210 Ga0496115_0724163 3300048918 Bacteria 780
211 Ga0496116_0188936 3300048919 Bacteria 1093
212 Ga0496117_0004644 3300048920 Bacteria 14954
213 Ga0496118_0034462 3300048921 Bacteria 4129
214 Ga0496121_0227834 3300048924 Bacteria 1307
215 Ga0496126_0789663 3300048929 Bacteria 729
216 Ga0501031_0051608 3300049568 Bacteria 2679
217 Ga0501032_0784631 3300049569 Unclassified 602
218 Ga0501034_0004381 3300049571 Bacteria 15728
219 Ga0501037_0161114 3300049573 Bacteria 1599
220 Ga0501038_0012846 3300049574 Bacteria 7644
221 Ga0501038_0166783 3300049574 Bacteria 1786
222 Ga0501038_0332758 3300049574 Bacteria 1186
223 Ga0501038_1248407 3300049574 Bacteria 538
224 Ga0501039_0145238 3300049575 Bacteria 1864
225 Ga0501040_0058028 3300049576 Bacteria 2658
226 Ga0501041_0022154 3300049577 Bacteria 3804
227 Ga0501042_0134577 3300049578 Bacteria 1782
228 Ga0501042_1423066 3300049578 Unclassified 506
229 Ga0501043_0862599 3300049579 Bacteria 651
230 Ga0501046_0259177 3300049580 Bacteria 1278
231 Ga0501047_0024042 3300049581 Bacteria 5852
232 Ga0501047_0162073 3300049581 Bacteria 2108
233 Ga0501047_0603475 3300049581 Unclassified 919
234 Ga0501068_0089679 3300049584 Bacteria 1896
235 Ga0501069_0837329 3300049585 Unclassified 558
236 Ga0501070_0000118 3300049586 Bacteria 70586
237 Ga0501071_0098745 3300049587 Bacteria 2151
238 Ga0501072_0293889 3300049588 Bacteria 1291
239 Ga0501074_0203999 3300049590 Bacteria 1409
240 Ga0501074_0485834 3300049590 Bacteria 875
241 Ga0501074_0847784 3300049590 Unclassified 644
242 Ga0501076_0040359 3300049592 Bacteria 3668
243 Ga0501076_0881195 3300049592 Unclassified 738
244 Ga0501077_0093042 3300049593 Bacteria 1911
245 Ga0501079_0072302 3300049741 Bacteria 2665
246 Ga0501081_0196649 3300049743 Bacteria 1461
247 Ga0501035_0108937 3300049822 Bacteria 2428
248 Ga0501035_0605734 3300049822 Unclassified 892
249 Ga0501044_0001611 3300049823 Bacteria 26427
250 Ga0501044_0022396 3300049823 Bacteria 6733
251 Ga0501044_1542710 3300049823 Unclassified 529
252 nmdc:mga0yw44_170426_c1 3300050492 Bacteria 1429
253 nmdc:mga0k408_38682_c2 3300050493 Bacteria 1477
254 nmdc:mga05p37_16265_c1 3300050507 Bacteria 8957
255 nmdc:mga09592_75004_c1 3300050508 Bacteria 2875
256 nmdc:mga0qj67_24900_c1 3300050509 Bacteria 4618
257 nmdc:mga06r32_16482_c1 3300050510 Bacteria 6734
258 nmdc:mga0n895_338183_c1 3300050512 Bacteria 1525
259 nmdc:mga0rr50_159366_c1 3300050513 Bacteria 1830
260 nmdc:mga0a205_94841_c1 3300050515 Bacteria 2883
261 Ga0495619_0187613 3300053085 Unclassified 1431
262 Ga0500568_0017477 3300053139 Bacteria 3165
263 Ga0501084_0074694 3300054114 Bacteria 2839
264 Ga0501084_0184286 3300054114 Bacteria 1762
265 Ga0501082_0055792 3300060353 Bacteria 3403
266 Ga0501082_1079211 3300060353 Bacteria 702
267 Ga0530510_0058480 3300061734 Bacteria 2787
268 2528850993 2528768022 Bacteria 10457665
269 2841965842 2841957949 Bacteria 8652217
270 2844534574 2844533157 Bacteria 7517899
271 2922376369
272 2929624025 2929615660 Bacteria 9193770
273 2929633166 2929624759 Bacteria 9339455
274 2932792664 2932784394 Bacteria 9704911
275 2932832125 2932828146 Bacteria 9745859
276 2933585926 2933577622 Bacteria 9116884
277 2935622063 2935616580 Bacteria 9032984
278 2935643926 2935638405 Bacteria 10015038
279 2935669158 2935665750 Bacteria 9571747
280 2935683284 2935675223 Bacteria 9928132
281 2935692225 2935684952 Bacteria 9590419
282 2935700604 2935694250 Bacteria 9291695
283 2935708766 2935703347 Bacteria 10242284
284 2935720537 2935713505 Bacteria 9608509
285 2935729818 2935722832 Bacteria 9608746
286 2935739200 2935732158 Bacteria 9706831
287 2935748259 2935741537 Bacteria 9707219
288 2935758462 2935750917 Bacteria 9590372
289 2935805874 2935801545 Bacteria 9301974
290 2935833178 2935827899 Bacteria 10038562
291 2935843251 2935837841 Bacteria 9454360
292 2935860310 2935855204 Bacteria 9035059
293 2935867708 2935864058 Bacteria 9784707
294 2935878483 2935873716 Bacteria 9632195
295 2935998634 2935992306 Bacteria 9802711
296 2936006940 2936002035 Bacteria 9362176
297 2940564366 2940556831 Bacteria 9590747
298 2941544797 2941538514 Bacteria 9402094
299 8016520039 8016511872 Bacteria 9921665
300 8017065513 8017057580 Bacteria 10023680
301 8019584917 8019576017 Bacteria 10049540
302 8019592871 8019586578 Bacteria 10212056
303 8019598587 8019597564 Bacteria 10041141
304 8019609789 8019608314 Bacteria 10042931
305 8055744503 8055742211 Bacteria 9226248
306 Ga0068856_100462469
307 LJQas_1002180
308 JGI24740J21852_10037807
309 JGI24739J22299_10187412
310 JGI24737J22298_10043105
311 JGI24748J21848_1000092
312 JGI24749J21850_1001790
313 JGI24034J26672_10000040
314 JGI24742J22300_10002584
315 JGI24751J29686_10048435
316 Ga0070683_100000042
317 Ga0070670_100020279
318 Ga0070670_100824647
319 Ga0070682_100500262
320 Ga0068868_100673067
321 Ga0070661_100874740
322 Ga0070668_100099336
323 Ga0070669_100000953
324 Ga0070671_100048860
325 Ga0070671_100097224
326 Ga0070674_101748170
327 Ga0070688_100003271
328 Ga0070667_100059889
329 Ga0070694_100922027
330 Ga0070663_100031812
331 Ga0070663_100181871
332 Ga0070662_100225359
333 Ga0068867_100997311
334 Ga0070685_10000102
335 Ga0070707_100007703
336 Ga0070707_101078766
337 Ga0070699_100225998
338 Ga0070684_100000303
339 Ga0070697_100130038
340 Ga0070697_101643751
341 Ga0068853_100061533
342 Ga0070672_100143084
343 Ga0070672_100226076
344 Ga0070686_101132456
345 Ga0070696_100590253
346 Ga0070665_100000510
347 Ga0070665_100112932
348 Ga0070665_101197075
349 Ga0068855_100081423
350 Ga0068855_101367491
351 Ga0070664_100224214
352 Ga0068856_100484687
353 Ga0068852_100252699
354 Ga0068859_100029617
355 Ga0068859_101129503
356 Ga0068864_100025910
357 Ga0068861_100024201
358 Ga0068863_100000109
359 Ga0068858_100014536
360 Ga0068862_100002140
361 Ga0070717_11348859
362 Ga0075365_10133795
363 Ga0075366_10278826
364 Ga0068871_102255297
365 Ga0075428_100042105
366 Ga0075430_100032433
367 Ga0075431_100018225
368 Ga0075431_100046452
369 Ga0075433_10037964
370 Ga0075434_100177086
371 Ga0075429_100254553
372 Ga0097620_100029619
373 Ga0097620_101129407
374 Ga0075435_100082309
375 Ga0105244_10322531
376 Ga0105240_10450666
377 Ga0105245_11343906
378 Ga0114129_10022545
379 Ga0114129_10661721
380 Ga0114129_12765836
381 Ga0105241_10022953
382 Ga0105242_12256891
383 Ga0105248_10216098
384 Ga0105248_12675360
385 Ga0105237_10268485
386 Ga0105237_11477139
387 Ga0105239_10615108
388 Ga0105239_10900460
389 Ga0105239_11852442
390 Ga0157370_10667126
391 Ga0163162_10093185
392 Ga0163162_13453207
393 Ga0157372_10255498
394 Ga0157375_10003294
395 Ga0157375_10724939
396 Ga0157375_13799436
397 Ga0163163_10192789
398 Ga0157379_10042852
399 Ga0157376_10359266
400 Ga0213873_10098225
401 Ga0213876_10163449
402 Ga0213871_10064725
403 Ga0207654_10087606
404 Ga0207695_10340985
405 Ga0207671_10030702
406 Ga0207646_10021635
407 Ga0207646_10797959
408 Ga0207681_10000133
409 Ga0207650_10019024
410 Ga0207650_10356714
411 Ga0207687_10249012
412 Ga0207687_10412309
413 Ga0207644_10075061
414 Ga0207690_10204288
415 Ga0207706_10347704
416 Ga0207691_10321165
417 Ga0207661_10000002
418 Ga0207679_10212353
419 Ga0207667_10066057
420 Ga0207667_11788005
421 Ga0207658_10014887
422 Ga0207658_11615063
423 Ga0207677_11619201
424 Ga0207703_10002038
425 Ga0207639_10043897
426 Ga0207639_12067377
427 Ga0207678_10039559
428 Ga0207678_10057469
429 Ga0207678_10310705
430 Ga0207702_11387560
431 Ga0207641_10000274
432 Ga0207676_10034709
433 Ga0207674_10069263
434 Ga0207675_100004736
435 Ga0207698_10033575
436 Ga0268266_10000009
437 Ga0268266_10243484
438 Ga0268266_10417197
439 Ga0268266_10465136
440 Ga0268266_11145684
441 Ga0268265_10000095
442 Ga0307515_10587341
443 Ga0265338_10288837
444 Ga0265331_10001159
445 Ga0265327_10001468
446 Ga0265313_10000509
447 Ga0307508_10175834
448 Ga0316579_10049058
449 Ga0265314_10017537
450 Ga0265342_10022447
451 Ga0316576_10400368
452 Ga0316578_10024772
453 Ga0316578_10718590
454 Ga0316577_10000667
455 Ga0316577_10197646
456 Ga0307407_10699004
457 Ga0307412_11265032
458 Ga0307411_10337110
459 Ga0373954_0662496
460 Ga0373946_0086453
461 Ga0316574_0061203
462 Ga0373927_0001151
463 Ga0373927_0290862
464 Ga0373937_0139449
465 Ga0316582_0207106
466 Ga0316582_0403734
467 Ga0316584_0008120
468 Ga0316584_0390870
469 Ga0373925_0001742
470 Ga0373925_0268426
471 Ga0373925_1280488
472 Ga0395905_0003128
473 Ga0316581_0045749
474 Ga0395901_0479469
475 Ga0436365_1237344
476 Ga0436365_1314960
477 Ga0436365_1841274
478 Ga0436360_0448838
479 Ga0436360_1027822
480 Ga0436361_1062981
481 Ga0436362_0374844
482 Ga0466966_0001161
483 Ga0451576_0005687
484 Ga0495592_0133623
485 Ga0495603_0044757
486 Ga0495603_0104341
487 Ga0495629_0168737
488 Ga0495651_0352240
489 Ga0495582_0422645
490 Ga0495664_0020829
491 Ga0495616_0270204
492 Ga0495628_0269065
493 Ga0495648_0275555
494 Ga0495652_0942405
495 Ga0495609_0178379
496 Ga0495645_0036449
497 Ga0495622_0031300
498 Ga0495588_0351006
499 Ga0495588_0569054
500 Ga0495599_0095062
501 Ga0495623_0175535
502 Ga0495658_0961367
503 Ga0495613_0204314
504 Ga0495670_0405166
505 Ga0495671_0079533
506 Ga0495581_0329879
507 Ga0495604_0455551
508 Ga0495602_0219392
509 Ga0496100_0198081
510 Ga0496102_0651229
511 Ga0496103_0010377
512 Ga0496104_0211261
513 Ga0496106_0078035
514 Ga0496107_0066514
515 Ga0496115_0724163
516 Ga0496116_0188936
517 Ga0496117_0004644
518 Ga0496118_0034462
519 Ga0496121_0227834
520 Ga0496126_0789663
521 Ga0501031_0051608
522 Ga0501032_0784631
523 Ga0501034_0004381
524 Ga0501037_0161114
525 Ga0501038_0012846
526 Ga0501038_0166783
527 Ga0501038_0332758
528 Ga0501038_1248407
529 Ga0501039_0145238
530 Ga0501040_0058028
531 Ga0501041_0022154
532 Ga0501042_0134577
533 Ga0501042_1423066
534 Ga0501043_0862599
535 Ga0501046_0259177
536 Ga0501047_0024042
537 Ga0501047_0162073
538 Ga0501047_0603475
539 Ga0501068_0089679
540 Ga0501069_0837329
541 Ga0501070_0000118
542 Ga0501071_0098745
543 Ga0501072_0293889
544 Ga0501074_0203999
545 Ga0501074_0485834
546 Ga0501074_0847784
547 Ga0501076_0040359
548 Ga0501076_0881195
549 Ga0501077_0093042
550 Ga0501079_0072302
551 Ga0501081_0196649
552 Ga0501035_0108937
553 Ga0501035_0605734
554 Ga0501044_0001611
555 Ga0501044_0022396
556 Ga0501044_1542710
557 nmdc:mga0yw44_170426_c1
558 nmdc:mga0k408_38682_c2
559 nmdc:mga05p37_16265_c1
560 nmdc:mga09592_75004_c1
561 nmdc:mga0qj67_24900_c1
562 nmdc:mga06r32_16482_c1
563 nmdc:mga0n895_338183_c1
564 nmdc:mga0rr50_159366_c1
565 nmdc:mga0a205_94841_c1
566 Ga0495619_0187613
567 Ga0500568_0017477
568 Ga0501084_0074694
569 Ga0501084_0184286
570 Ga0501082_0055792
571 Ga0501082_1079211
572 Ga0530510_0058480
573 2528850993
574 2841965842
575 2844534574
576 2922376369
577 2929624025
578 2929633166
579 2932792664
580 2932832125
581 2933585926
582 2935622063
583 2935643926
584 2935669158
585 2935683284
586 2935692225
587 2935700604
588 2935708766
589 2935720537
590 2935729818
591 2935739200
592 2935748259
593 2935758462
594 2935805874
595 2935833178
596 2935843251
597 2935860310
598 2935867708
599 2935878483
600 2935998634
601 2936006940
602 2940564366
603 2941544797
604 8016520039
605 8017065513
606 8019584917
607 8019592871
608 8019598587
609 8019609789
610 8055744503

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02452

PemK_toxin

PemK-like, MazF-like toxin of type II toxin-antitoxin system

8

111

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xe3-assembly1.cif.gz_B endoribonuclease in complex with its cognate antitoxin from mycobacterial species 0.894 1 109
5xe3-assembly1.cif.gz_A endoribonuclease in complex with its cognate antitoxin from mycobacterial species 0.8905 1 109
5xe2-assembly1.cif.gz_A-2 endoribonuclease from mycobacterial species 0.8898 1 109
4me7-assembly1.cif.gz_D crystal structure of bacillus subtilis toxin mazf in complex with cognate antitoxin maze 0.8765 1 106
5cca-assembly1.cif.gz_B crystal structure of mtb toxin 0.8701 6 101
ID Description Score Start End Superfamily
af_P9WII5_1_103_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.8966 1 108 2.30.30.110
af_P9WII1_5_102_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.8869 5 106 2.30.30.110
af_P95272_7_108_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.8847 3 106 2.30.30.110
5ccaB00 Mainly Beta;Roll;SH3 type barrels.; 0.8701 6 101 2.30.30.110
af_P9WII1_5_102_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.87 5 106 2.30.30.110
ID Description Score Start End GO Terms
AF-A0A521SNA9-F1-model_v4 deleted 0.9643 1 109
AF-A0A3S0XQQ7-F1-model_v4 Type II toxin-antitoxin system PemK/MazF family toxin 0.9632 1 108 GO:0003677
GO:0004521
GO:0006402
GO:0016075
AF-A0A1G5U0X5-F1-model_v4 PemK-like, MazF-like toxin of type II toxin-antitoxin system 0.9618 1 106 GO:0003677
AF-A0A521SNA9-F1-model_v4 deleted 0.9557 1 109
AF-A0A2D3SV13-F1-model_v4 Growth inhibitor PemK (Type II toxin-antitoxin system PemK/MazF family toxin) 0.9552 1 108 GO:0003677
GO:0004521
GO:0006402
GO:0016075

Map