F397838
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 304 | 205 | 608 | 358 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2643221576|2643893315 |
| Length | 381 |
| Sequence | RGRACLTGPVSPPHDLDLSTDVVSLTRALVDIESVSRNEQVIADAVEVALQGLSHLTVTRHGNTLVARTDLGRPSRVVIAGHLDTVPLNDNLPSRLEDGLLHGLGTCDMKGGDAVILRLAATVPEPVHDVTFVLYDCEEIDSALNGLRLLSVSDPALLEADFAILMEPSNGVVEAGCQGTLRVDVRTRGERAHSARSWKGVNAIHAAAAVLTRLNEYDARRPVIDGLEYHEGLNAVGISGGVAGNVIPDECVVSVNFRFAPDRSETDALAFVREFFDGFDVTLTDSAPGALPGLDQPAARAFVDAVGGEVNPKFGWTDVARFTALGVPAVNYGPGDPLLAHKQEEFVEVAQIEECERQLRQWLLTDVPADVPADPTREVQR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 24 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 25 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 27 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 28 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 29 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 30 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 31 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 32 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 33 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 34 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 35 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 36 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 37 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 39 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 59 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 88 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 89 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 90 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 91 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 92 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 93 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 94 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 95 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 96 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 97 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 98 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 99 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 100 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 101 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 102 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 103 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 104 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 105 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 106 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 107 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 108 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 109 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 110 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 111 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 112 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 113 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 114 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 115 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 116 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 117 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 118 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 120 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 121 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 122 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 123 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 124 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 125 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 126 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 127 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 128 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 129 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 130 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 131 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 132 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 133 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 134 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 135 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 136 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 137 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 138 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 139 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 140 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 141 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 142 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 143 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 144 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 145 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 146 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 147 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 149 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 150 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 152 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 155 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 157 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 158 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 159 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 160 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 161 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 162 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 165 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 166 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 167 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 168 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 169 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 171 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 172 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 174 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 175 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 176 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 177 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 178 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 179 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 180 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 181 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 182 | 2643221697 | Aeromicrobium sp. Root495 | Isolate | Unclassified |
| 183 | 2738541305 | Nocardioides sp. CF167 | Isolate | Unclassified |
| 184 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 185 | 2799112218 | Motilibacter rhizosphaerae DSM 45622 | Isolate | Rhizosphere |
| 186 | 2811994874 | Nocardioides sp. SLBN-35 | Isolate | Unclassified |
| 187 | 2855676851 | Micromonospora saelicesensis GAR05 | Isolate | Unclassified |
| 188 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 189 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 190 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 191 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 192 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 193 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 194 | 2867507094 | Micromonospora zingiberis PLAI 1-1 | Isolate | Unclassified |
| 195 | 2869048445 | Micromonospora saelicesensis PSN01 | Isolate | Unclassified |
| 196 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 197 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 198 | 2880489317 | Micromonospora ureilytica DSM 101692 | Isolate | Unclassified |
| 199 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 200 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
| 201 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 202 | 2929219909 | Micromonospora sp. R-75348 Hybrid assembly | Isolate | Unclassified |
| 203 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 204 | 8001781756 | Catellatospora tritici NEAU-YM18 | Isolate | Rhizosphere |
| 205 | 8054704163 | Micromonospora trifolii NIE79 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.47 |
| Metatranscriptomes | 0.33 |
| Isolates | 10.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.95 |
| Nodule | 0.66 |
| Rhizoplane | 11.51 |
| Rhizosphere | 73.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1002852 | 3300000549 | Bacteria | 2364 |
| 2 | JGI24735J21928_10038846 | 3300002067 | Bacteria | 1392 |
| 3 | Ga0070658_10087607 | 3300005327 | Bacteria | 2563 |
| 4 | Ga0070683_100000566 | 3300005329 | Bacteria | 26326 |
| 5 | Ga0070666_10136476 | 3300005335 | Bacteria | 1707 |
| 6 | Ga0070680_100127210 | 3300005336 | Bacteria | 2129 |
| 7 | Ga0070682_100061158 | 3300005337 | Bacteria | 2383 |
| 8 | Ga0070660_100003517 | 3300005339 | Bacteria | 10797 |
| 9 | Ga0070660_100027131 | 3300005339 | Bacteria | 4272 |
| 10 | Ga0070687_100085997 | 3300005343 | Bacteria | 1727 |
| 11 | Ga0070668_100016248 | 3300005347 | Bacteria | 5567 |
| 12 | Ga0070673_100104419 | 3300005364 | Bacteria | 2339 |
| 13 | Ga0070659_100027577 | 3300005366 | Bacteria | 4378 |
| 14 | Ga0070659_100144967 | 3300005366 | Bacteria | 1934 |
| 15 | Ga0070667_100001309 | 3300005367 | Bacteria | 22415 |
| 16 | Ga0070667_100091665 | 3300005367 | Bacteria | 2613 |
| 17 | Ga0070714_100007169 | 3300005435 | Bacteria | 8650 |
| 18 | Ga0070701_10033291 | 3300005438 | Bacteria | 2574 |
| 19 | Ga0070663_100007824 | 3300005455 | Bacteria | 6534 |
| 20 | Ga0070698_100003056 | 3300005471 | Bacteria | 18446 |
| 21 | Ga0070684_100001014 | 3300005535 | Bacteria | 20027 |
| 22 | Ga0070684_100093239 | 3300005535 | Bacteria | 2680 |
| 23 | Ga0070684_100187205 | 3300005535 | Bacteria | 1883 |
| 24 | Ga0070695_100057148 | 3300005545 | Bacteria | 2520 |
| 25 | Ga0070665_100001318 | 3300005548 | Bacteria | 29616 |
| 26 | Ga0070665_100009311 | 3300005548 | Bacteria | 9941 |
| 27 | Ga0070665_100145547 | 3300005548 | Bacteria | 2373 |
| 28 | Ga0070704_100015882 | 3300005549 | Bacteria | 4742 |
| 29 | Ga0070664_100051540 | 3300005564 | Bacteria | 3485 |
| 30 | Ga0068857_100012416 | 3300005577 | Bacteria | 7415 |
| 31 | Ga0068856_100031077 | 3300005614 | Bacteria | 5223 |
| 32 | Ga0070702_100015779 | 3300005615 | Bacteria | 3863 |
| 33 | Ga0070702_100029423 | 3300005615 | Bacteria | 2987 |
| 34 | Ga0070702_100111154 | 3300005615 | Bacteria | 1699 |
| 35 | Ga0068852_100068923 | 3300005616 | Bacteria | 3098 |
| 36 | Ga0068859_100148236 | 3300005617 | Bacteria | 2422 |
| 37 | Ga0068870_10041815 | 3300005840 | Bacteria | 2384 |
| 38 | Ga0068870_10150589 | 3300005840 | Bacteria | 1370 |
| 39 | Ga0068863_100018933 | 3300005841 | Bacteria | 6589 |
| 40 | Ga0068858_100016437 | 3300005842 | Bacteria | 6949 |
| 41 | Ga0068858_100114301 | 3300005842 | Bacteria | 2521 |
| 42 | Ga0068860_100000345 | 3300005843 | Bacteria | 62383 |
| 43 | Ga0068860_100053734 | 3300005843 | Bacteria | 3829 |
| 44 | Ga0068860_100086233 | 3300005843 | Bacteria | 2988 |
| 45 | Ga0068862_100260400 | 3300005844 | Bacteria | 1583 |
| 46 | Ga0081540_1003681 | 3300005983 | Bacteria | 12022 |
| 47 | Ga0075365_10008217 | 3300006038 | Bacteria | 5905 |
| 48 | Ga0075365_10215421 | 3300006038 | Bacteria | 1346 |
| 49 | Ga0075363_100061545 | 3300006048 | Bacteria | 2023 |
| 50 | Ga0075364_10037147 | 3300006051 | Bacteria | 3152 |
| 51 | Ga0075364_10154569 | 3300006051 | Bacteria | 1547 |
| 52 | Ga0070712_100108699 | 3300006175 | Bacteria | 2065 |
| 53 | Ga0075362_10023228 | 3300006177 | Bacteria | 2621 |
| 54 | Ga0097621_100356654 | 3300006237 | Bacteria | 1302 |
| 55 | Ga0097620_100148237 | 3300006931 | Bacteria | 2422 |
| 56 | Ga0105245_10060106 | 3300009098 | Bacteria | 3423 |
| 57 | Ga0105245_10465494 | 3300009098 | Bacteria | 1275 |
| 58 | Ga0105243_10031986 | 3300009148 | Bacteria | 4060 |
| 59 | Ga0105241_10026313 | 3300009174 | Bacteria | 4327 |
| 60 | Ga0105237_10224881 | 3300009545 | Bacteria | 1877 |
| 61 | Ga0105249_10402987 | 3300009553 | Bacteria | 1398 |
| 62 | Ga0105239_10001058 | 3300010375 | Bacteria | 38262 |
| 63 | Ga0105246_10150976 | 3300011119 | Bacteria | 1758 |
| 64 | Ga0157373_10045829 | 3300013100 | Bacteria | 3121 |
| 65 | Ga0157370_10060912 | 3300013104 | Bacteria | 3582 |
| 66 | Ga0157369_10047547 | 3300013105 | Bacteria | 4657 |
| 67 | Ga0163162_10020330 | 3300013306 | Bacteria | 6522 |
| 68 | Ga0163162_10203538 | 3300013306 | Bacteria | 2109 |
| 69 | Ga0157372_10002293 | 3300013307 | Bacteria | 20744 |
| 70 | Ga0157372_10269910 | 3300013307 | Bacteria | 1976 |
| 71 | Ga0157372_10372082 | 3300013307 | Bacteria | 1665 |
| 72 | Ga0157375_10054232 | 3300013308 | Bacteria | 3948 |
| 73 | Ga0157375_10115648 | 3300013308 | Bacteria | 2785 |
| 74 | Ga0163163_10129787 | 3300014325 | Bacteria | 2560 |
| 75 | Ga0157380_10071601 | 3300014326 | Bacteria | 2805 |
| 76 | Ga0157379_10026044 | 3300014968 | Bacteria | 5202 |
| 77 | Ga0157379_10305258 | 3300014968 | Bacteria | 1451 |
| 78 | Ga0163161_10041940 | 3300017792 | Bacteria | 3289 |
| 79 | Ga0206353_11175304 | 3300020082 | Bacteria | 2212 |
| 80 | Ga0207688_10003164 | 3300025901 | Bacteria | 8979 |
| 81 | Ga0207680_10039159 | 3300025903 | Bacteria | 2748 |
| 82 | Ga0207647_10135085 | 3300025904 | Bacteria | 1448 |
| 83 | Ga0207705_10231779 | 3300025909 | Bacteria | 1405 |
| 84 | Ga0207654_10006100 | 3300025911 | Bacteria | 6059 |
| 85 | Ga0207707_10196579 | 3300025912 | Bacteria | 1759 |
| 86 | Ga0207693_10009301 | 3300025915 | Bacteria | 8019 |
| 87 | Ga0207663_10198745 | 3300025916 | Bacteria | 1445 |
| 88 | Ga0207657_10010073 | 3300025919 | Bacteria | 9451 |
| 89 | Ga0207657_10022465 | 3300025919 | Bacteria | 5900 |
| 90 | Ga0207657_10104280 | 3300025919 | Bacteria | 2349 |
| 91 | Ga0207657_10162258 | 3300025919 | Bacteria | 1815 |
| 92 | Ga0207694_10181205 | 3300025924 | Bacteria | 1708 |
| 93 | Ga0207664_10063383 | 3300025929 | Bacteria | 2954 |
| 94 | Ga0207664_10090826 | 3300025929 | Bacteria | 2503 |
| 95 | Ga0207690_10102948 | 3300025932 | Bacteria | 2043 |
| 96 | Ga0207704_10021494 | 3300025938 | Bacteria | 3439 |
| 97 | Ga0207691_10289268 | 3300025940 | Bacteria | 1409 |
| 98 | Ga0207679_10055076 | 3300025945 | Bacteria | 2930 |
| 99 | Ga0207668_10107385 | 3300025972 | Bacteria | 2087 |
| 100 | Ga0207668_10131497 | 3300025972 | Bacteria | 1912 |
| 101 | Ga0207658_10012115 | 3300025986 | Bacteria | 5881 |
| 102 | Ga0207677_10123513 | 3300026023 | Bacteria | 1952 |
| 103 | Ga0207677_10245351 | 3300026023 | Bacteria | 1451 |
| 104 | Ga0207703_10045242 | 3300026035 | Bacteria | 3540 |
| 105 | Ga0207678_10017500 | 3300026067 | Bacteria | 6294 |
| 106 | Ga0207702_10121741 | 3300026078 | Bacteria | 2336 |
| 107 | Ga0207702_10209633 | 3300026078 | Bacteria | 1811 |
| 108 | Ga0207641_10000562 | 3300026088 | Bacteria | 41565 |
| 109 | Ga0207641_10041488 | 3300026088 | Bacteria | 3857 |
| 110 | Ga0207641_10042557 | 3300026088 | Bacteria | 3811 |
| 111 | Ga0207676_10063826 | 3300026095 | Bacteria | 2926 |
| 112 | Ga0207683_10015426 | 3300026121 | Bacteria | 6507 |
| 113 | Ga0207683_10188317 | 3300026121 | Bacteria | 1873 |
| 114 | Ga0207698_10089796 | 3300026142 | Bacteria | 2511 |
| 115 | Ga0268266_10000794 | 3300028379 | Bacteria | 42029 |
| 116 | Ga0268266_10001153 | 3300028379 | Bacteria | 32787 |
| 117 | Ga0268265_10432558 | 3300028380 | Bacteria | 1225 |
| 118 | Ga0268264_10000257 | 3300028381 | Bacteria | 96251 |
| 119 | Ga0316181_1123477 | 3300030744 | Bacteria | 2212 |
| 120 | Ga0307408_100078104 | 3300031548 | Bacteria | 2467 |
| 121 | Ga0307508_10035486 | 3300031616 | Bacteria | 4494 |
| 122 | Ga0316576_10002847 | 3300031727 | Bacteria | 9972 |
| 123 | Ga0316578_10025320 | 3300031728 | Bacteria | 3335 |
| 124 | Ga0307405_10030057 | 3300031731 | Bacteria | 3182 |
| 125 | Ga0307405_10200240 | 3300031731 | Bacteria | 1450 |
| 126 | Ga0307407_10184581 | 3300031903 | Bacteria | 1385 |
| 127 | Ga0307412_10065067 | 3300031911 | Bacteria | 2466 |
| 128 | Ga0307409_100025810 | 3300031995 | Bacteria | 4130 |
| 129 | Ga0307416_100365149 | 3300032002 | Bacteria | 1467 |
| 130 | Ga0307411_10124514 | 3300032005 | Bacteria | 1872 |
| 131 | Ga0307415_100185666 | 3300032126 | Bacteria | 1636 |
| 132 | Ga0316574_0047394 | 3300035398 | Bacteria | 2667 |
| 133 | Ga0373931_0021587 | 3300035691 | Bacteria | 3231 |
| 134 | Ga0395899_0016451 | 3300037312 | Bacteria | 5639 |
| 135 | Ga0395899_0037638 | 3300037312 | Bacteria | 3627 |
| 136 | Ga0395900_0003395 | 3300037418 | Bacteria | 17196 |
| 137 | Ga0395900_0059293 | 3300037418 | Bacteria | 3940 |
| 138 | Ga0395900_0073968 | 3300037418 | Bacteria | 3504 |
| 139 | Ga0395898_0233460 | 3300037466 | Bacteria | 1754 |
| 140 | Ga0395901_0090992 | 3300038443 | Bacteria | 3193 |
| 141 | Ga0395901_0114129 | 3300038443 | Bacteria | 2837 |
| 142 | Ga0451853_1736039 | 3300041512 | Bacteria | 1548 |
| 143 | Ga0450907_003560 | 3300042146 | Bacteria | 2770 |
| 144 | Ga0451577_0121415 | 3300042876 | Bacteria | 2341 |
| 145 | Ga0466965_0001939 | 3300044683 | Bacteria | 8640 |
| 146 | Ga0466965_0004870 | 3300044683 | Bacteria | 5995 |
| 147 | Ga0466965_0020476 | 3300044683 | Bacteria | 3180 |
| 148 | Ga0466965_0099518 | 3300044683 | Bacteria | 1486 |
| 149 | Ga0466963_0011310 | 3300044694 | Bacteria | 5431 |
| 150 | Ga0466963_0044204 | 3300044694 | Bacteria | 2932 |
| 151 | Ga0466963_0051723 | 3300044694 | Bacteria | 2724 |
| 152 | Ga0466964_0004033 | 3300044706 | Bacteria | 5398 |
| 153 | Ga0466971_0012684 | 3300044719 | Bacteria | 3696 |
| 154 | Ga0466971_0055719 | 3300044719 | Bacteria | 1782 |
| 155 | Ga0466970_0001549 | 3300044765 | Bacteria | 11072 |
| 156 | Ga0466970_0011340 | 3300044765 | Bacteria | 4543 |
| 157 | Ga0466970_0015639 | 3300044765 | Bacteria | 3905 |
| 158 | Ga0466970_0030794 | 3300044765 | Bacteria | 2831 |
| 159 | Ga0466957_0017810 | 3300044842 | Bacteria | 4167 |
| 160 | Ga0466957_0057838 | 3300044842 | Bacteria | 2374 |
| 161 | Ga0466960_0002271 | 3300044901 | Bacteria | 7189 |
| 162 | Ga0466960_0012672 | 3300044901 | Bacteria | 3565 |
| 163 | Ga0466960_0017164 | 3300044901 | Bacteria | 3151 |
| 164 | Ga0466960_0040381 | 3300044901 | Bacteria | 2206 |
| 165 | Ga0466960_0150175 | 3300044901 | Bacteria | 1244 |
| 166 | Ga0451576_0293737 | 3300045051 | Bacteria | 1699 |
| 167 | Ga0466958_0100325 | 3300045836 | Bacteria | 1799 |
| 168 | Ga0466967_0014503 | 3300045976 | Bacteria | 6141 |
| 169 | Ga0466967_0029383 | 3300045976 | Bacteria | 4600 |
| 170 | Ga0466967_0059889 | 3300045976 | Bacteria | 3372 |
| 171 | Ga0466967_0072563 | 3300045976 | Bacteria | 3086 |
| 172 | Ga0466967_0225706 | 3300045976 | Bacteria | 1782 |
| 173 | Ga0495629_0057861 | 3300046459 | Bacteria | 2710 |
| 174 | Ga0496101_0031923 | 3300048904 | Bacteria | 3705 |
| 175 | Ga0496101_0057294 | 3300048904 | Bacteria | 2818 |
| 176 | Ga0496102_0001789 | 3300048905 | Bacteria | 18636 |
| 177 | Ga0496102_0004193 | 3300048905 | Bacteria | 12194 |
| 178 | Ga0496102_0007250 | 3300048905 | Bacteria | 9463 |
| 179 | Ga0496102_0282913 | 3300048905 | Bacteria | 1563 |
| 180 | Ga0496103_0018847 | 3300048906 | Bacteria | 4143 |
| 181 | Ga0496104_0006528 | 3300048907 | Bacteria | 10257 |
| 182 | Ga0496105_0000345 | 3300048908 | Bacteria | 30539 |
| 183 | Ga0496105_0029201 | 3300048908 | Bacteria | 4513 |
| 184 | Ga0496105_0149673 | 3300048908 | Bacteria | 1919 |
| 185 | Ga0496106_0005157 | 3300048909 | Bacteria | 9680 |
| 186 | Ga0496106_0013882 | 3300048909 | Bacteria | 5953 |
| 187 | Ga0496107_0052965 | 3300048910 | Bacteria | 2927 |
| 188 | Ga0496107_0122081 | 3300048910 | Bacteria | 1919 |
| 189 | Ga0496107_0269528 | 3300048910 | Bacteria | 1267 |
| 190 | Ga0496108_0036497 | 3300048911 | Bacteria | 4089 |
| 191 | Ga0496108_0044064 | 3300048911 | Bacteria | 3726 |
| 192 | Ga0496108_0139327 | 3300048911 | Bacteria | 2090 |
| 193 | Ga0496109_0005719 | 3300048912 | Bacteria | 10407 |
| 194 | Ga0496109_0009281 | 3300048912 | Bacteria | 8380 |
| 195 | Ga0496109_0063396 | 3300048912 | Bacteria | 3381 |
| 196 | Ga0496109_0074084 | 3300048912 | Bacteria | 3129 |
| 197 | Ga0496109_0125878 | 3300048912 | Bacteria | 2389 |
| 198 | Ga0496109_0276167 | 3300048912 | Bacteria | 1583 |
| 199 | Ga0496110_0014442 | 3300048913 | Bacteria | 6559 |
| 200 | Ga0496110_0305012 | 3300048913 | Bacteria | 1450 |
| 201 | Ga0496111_0002891 | 3300048914 | Bacteria | 10485 |
| 202 | Ga0496112_0383773 | 3300048915 | Bacteria | 1346 |
| 203 | Ga0496113_0065541 | 3300048916 | Bacteria | 2749 |
| 204 | Ga0496114_0009013 | 3300048917 | Bacteria | 7909 |
| 205 | Ga0496114_0052279 | 3300048917 | Bacteria | 3403 |
| 206 | Ga0496114_0073755 | 3300048917 | Bacteria | 2872 |
| 207 | Ga0496115_0001682 | 3300048918 | Bacteria | 15899 |
| 208 | Ga0496115_0012989 | 3300048918 | Bacteria | 6283 |
| 209 | Ga0496118_0074775 | 3300048921 | Bacteria | 2420 |
| 210 | Ga0496119_0000282 | 3300048922 | Bacteria | 71403 |
| 211 | Ga0496120_0005229 | 3300048923 | Bacteria | 10437 |
| 212 | Ga0496126_0000035 | 3300048929 | Bacteria | 361590 |
| 213 | Ga0501031_0131897 | 3300049568 | Bacteria | 1632 |
| 214 | Ga0501032_0028305 | 3300049569 | Bacteria | 3851 |
| 215 | Ga0501032_0090954 | 3300049569 | Bacteria | 2025 |
| 216 | Ga0501034_0005212 | 3300049571 | Bacteria | 14263 |
| 217 | Ga0501034_0058249 | 3300049571 | Bacteria | 3882 |
| 218 | Ga0501034_0158297 | 3300049571 | Bacteria | 2238 |
| 219 | Ga0501034_0473924 | 3300049571 | Bacteria | 1168 |
| 220 | Ga0501036_0003724 | 3300049572 | Bacteria | 12224 |
| 221 | Ga0501037_0176532 | 3300049573 | Bacteria | 1517 |
| 222 | Ga0501038_0009052 | 3300049574 | Bacteria | 9138 |
| 223 | Ga0501038_0009638 | 3300049574 | Bacteria | 8859 |
| 224 | Ga0501039_0022756 | 3300049575 | Bacteria | 4808 |
| 225 | Ga0501039_0031621 | 3300049575 | Bacteria | 4081 |
| 226 | Ga0501039_0058188 | 3300049575 | Bacteria | 2993 |
| 227 | Ga0501039_0187558 | 3300049575 | Bacteria | 1626 |
| 228 | Ga0501042_0097135 | 3300049578 | Bacteria | 2117 |
| 229 | Ga0501042_0100796 | 3300049578 | Bacteria | 2076 |
| 230 | Ga0501046_0008983 | 3300049580 | Bacteria | 8675 |
| 231 | Ga0501047_0118784 | 3300049581 | Bacteria | 2526 |
| 232 | Ga0501048_0140382 | 3300049582 | Bacteria | 1708 |
| 233 | Ga0501067_0000288 | 3300049583 | Bacteria | 27513 |
| 234 | Ga0501067_0005438 | 3300049583 | Bacteria | 7072 |
| 235 | Ga0501067_0070771 | 3300049583 | Bacteria | 1931 |
| 236 | Ga0501067_0107695 | 3300049583 | Bacteria | 1549 |
| 237 | Ga0501068_0042383 | 3300049584 | Bacteria | 2737 |
| 238 | Ga0501068_0092939 | 3300049584 | Bacteria | 1863 |
| 239 | Ga0501069_0048925 | 3300049585 | Bacteria | 2349 |
| 240 | Ga0501070_0000826 | 3300049586 | Bacteria | 28120 |
| 241 | Ga0501070_0078600 | 3300049586 | Bacteria | 2730 |
| 242 | Ga0501070_0127433 | 3300049586 | Bacteria | 2103 |
| 243 | Ga0501070_0207581 | 3300049586 | Bacteria | 1608 |
| 244 | Ga0501071_0006094 | 3300049587 | Bacteria | 7817 |
| 245 | Ga0501071_0214862 | 3300049587 | Bacteria | 1447 |
| 246 | Ga0501073_0022412 | 3300049589 | Bacteria | 4548 |
| 247 | Ga0501073_0056773 | 3300049589 | Bacteria | 2738 |
| 248 | Ga0501073_0076695 | 3300049589 | Bacteria | 2326 |
| 249 | Ga0501074_0018526 | 3300049590 | Bacteria | 5058 |
| 250 | Ga0501074_0024371 | 3300049590 | Bacteria | 4397 |
| 251 | Ga0501075_0134324 | 3300049591 | Bacteria | 1885 |
| 252 | Ga0501077_0009157 | 3300049593 | Bacteria | 6149 |
| 253 | Ga0501079_0107289 | 3300049741 | Bacteria | 2168 |
| 254 | Ga0501080_0005549 | 3300049742 | Bacteria | 11264 |
| 255 | Ga0501080_0010859 | 3300049742 | Bacteria | 8334 |
| 256 | Ga0501081_0178296 | 3300049743 | Bacteria | 1536 |
| 257 | Ga0501083_0009218 | 3300049744 | Bacteria | 6970 |
| 258 | Ga0501083_0122778 | 3300049744 | Bacteria | 1703 |
| 259 | Ga0501035_0014584 | 3300049822 | Bacteria | 7253 |
| 260 | Ga0501044_0006086 | 3300049823 | Bacteria | 13314 |
| 261 | Ga0501044_0348074 | 3300049823 | Bacteria | 1402 |
| 262 | Ga0501045_0123849 | 3300049824 | Bacteria | 1920 |
| 263 | nmdc:mga00v17_16960_c1 | 3300050491 | Bacteria | 4113 |
| 264 | nmdc:mga00v17_51704_c1 | 3300050491 | Bacteria | 2498 |
| 265 | nmdc:mga0yw44_14753_c1 | 3300050492 | Bacteria | 4160 |
| 266 | nmdc:mga07m45_30190_c1 | 3300050496 | Bacteria | 3001 |
| 267 | nmdc:mga0a205_27627_c1 | 3300050515 | Bacteria | 5419 |
| 268 | Ga0495595_0026265 | 3300053084 | Bacteria | 2587 |
| 269 | Ga0500644_0000249 | 3300053088 | Bacteria | 30553 |
| 270 | Ga0500573_0005347 | 3300053140 | Bacteria | 6872 |
| 271 | Ga0501084_0045045 | 3300054114 | Bacteria | 3694 |
| 272 | Ga0466962_0010555 | 3300061719 | Bacteria | 4443 |
| 273 | Ga0530510_0087180 | 3300061734 | Bacteria | 2275 |
| 274 | 2643893315 | 2643221576 | Bacteria | 5214352 |
| 275 | 2643961626 | 2643221590 | Bacteria | 5214697 |
| 276 | 2644035231 | 2643221604 | Bacteria | 5014917 |
| 277 | 2644091638 | 2643221615 | Bacteria | 5487866 |
| 278 | 2644173550 | 2643221631 | Bacteria | 8168043 |
| 279 | 2644231094 | 2643221641 | Bacteria | 4490190 |
| 280 | 2644321441 | 2643221657 | Bacteria | 5490246 |
| 281 | 2644538326 | 2643221697 | Bacteria | 3575694 |
| 282 | 2738867652 | 2738541305 | Bacteria | 4910150 |
| 283 | 2740166445 | 2739367898 | Bacteria | 4367674 |
| 284 | 2799185489 | 2799112218 | Bacteria | 4315149 |
| 285 | 2812331905 | 2811994874 | Bacteria | 5367947 |
| 286 | 2855680195 | 2855676851 | Bacteria | 7063653 |
| 287 | 2857289226 | 2857288857 | Bacteria | 7189066 |
| 288 | 2857482721 | 2857481737 | Bacteria | 4761446 |
| 289 | 2858854750 | 2858848962 | Bacteria | 6963058 |
| 290 | 2858887301 | 2858882152 | Bacteria | 7230291 |
| 291 | 2858892996 | 2858888857 | Bacteria | 7060307 |
| 292 | 2858902164 | 2858895516 | Bacteria | 7378898 |
| 293 | 2867512174 | 2867507094 | Bacteria | 6506033 |
| 294 | 2869050632 | 2869048445 | Bacteria | 6875584 |
| 295 | 2869063933 | 2869061728 | Bacteria | 7112407 |
| 296 | 2869070491 | 2869068681 | Bacteria | 7205615 |
| 297 | 2880495465 | 2880489317 | Bacteria | 7096270 |
| 298 | 2880496891 | 2880495981 | Bacteria | 7340502 |
| 299 | 2887484738 | 2887478801 | Bacteria | 8972725 |
| 300 | 2895433976 | 2895427314 | Bacteria | 13147766 |
| 301 | 2929225510 | 2929219909 | Bacteria | 6984360 |
| 302 | 2929231511 | 2929226422 | Bacteria | 7248583 |
| 303 | 8001782315 | 8001781756 | Bacteria | 9586736 |
| 304 | 8054704423 | 8054704163 | Bacteria | 7247792 |
| 305 | LJQas_1002852 | |||
| 306 | JGI24735J21928_10038846 | |||
| 307 | Ga0070658_10087607 | |||
| 308 | Ga0070683_100000566 | |||
| 309 | Ga0070666_10136476 | |||
| 310 | Ga0070680_100127210 | |||
| 311 | Ga0070682_100061158 | |||
| 312 | Ga0070660_100003517 | |||
| 313 | Ga0070660_100027131 | |||
| 314 | Ga0070687_100085997 | |||
| 315 | Ga0070668_100016248 | |||
| 316 | Ga0070673_100104419 | |||
| 317 | Ga0070659_100027577 | |||
| 318 | Ga0070659_100144967 | |||
| 319 | Ga0070667_100001309 | |||
| 320 | Ga0070667_100091665 | |||
| 321 | Ga0070714_100007169 | |||
| 322 | Ga0070701_10033291 | |||
| 323 | Ga0070663_100007824 | |||
| 324 | Ga0070698_100003056 | |||
| 325 | Ga0070684_100001014 | |||
| 326 | Ga0070684_100093239 | |||
| 327 | Ga0070684_100187205 | |||
| 328 | Ga0070695_100057148 | |||
| 329 | Ga0070665_100001318 | |||
| 330 | Ga0070665_100009311 | |||
| 331 | Ga0070665_100145547 | |||
| 332 | Ga0070704_100015882 | |||
| 333 | Ga0070664_100051540 | |||
| 334 | Ga0068857_100012416 | |||
| 335 | Ga0068856_100031077 | |||
| 336 | Ga0070702_100015779 | |||
| 337 | Ga0070702_100029423 | |||
| 338 | Ga0070702_100111154 | |||
| 339 | Ga0068852_100068923 | |||
| 340 | Ga0068859_100148236 | |||
| 341 | Ga0068870_10041815 | |||
| 342 | Ga0068870_10150589 | |||
| 343 | Ga0068863_100018933 | |||
| 344 | Ga0068858_100016437 | |||
| 345 | Ga0068858_100114301 | |||
| 346 | Ga0068860_100000345 | |||
| 347 | Ga0068860_100053734 | |||
| 348 | Ga0068860_100086233 | |||
| 349 | Ga0068862_100260400 | |||
| 350 | Ga0081540_1003681 | |||
| 351 | Ga0075365_10008217 | |||
| 352 | Ga0075365_10215421 | |||
| 353 | Ga0075363_100061545 | |||
| 354 | Ga0075364_10037147 | |||
| 355 | Ga0075364_10154569 | |||
| 356 | Ga0070712_100108699 | |||
| 357 | Ga0075362_10023228 | |||
| 358 | Ga0097621_100356654 | |||
| 359 | Ga0097620_100148237 | |||
| 360 | Ga0105245_10060106 | |||
| 361 | Ga0105245_10465494 | |||
| 362 | Ga0105243_10031986 | |||
| 363 | Ga0105241_10026313 | |||
| 364 | Ga0105237_10224881 | |||
| 365 | Ga0105249_10402987 | |||
| 366 | Ga0105239_10001058 | |||
| 367 | Ga0105246_10150976 | |||
| 368 | Ga0157373_10045829 | |||
| 369 | Ga0157370_10060912 | |||
| 370 | Ga0157369_10047547 | |||
| 371 | Ga0163162_10020330 | |||
| 372 | Ga0163162_10203538 | |||
| 373 | Ga0157372_10002293 | |||
| 374 | Ga0157372_10269910 | |||
| 375 | Ga0157372_10372082 | |||
| 376 | Ga0157375_10054232 | |||
| 377 | Ga0157375_10115648 | |||
| 378 | Ga0163163_10129787 | |||
| 379 | Ga0157380_10071601 | |||
| 380 | Ga0157379_10026044 | |||
| 381 | Ga0157379_10305258 | |||
| 382 | Ga0163161_10041940 | |||
| 383 | Ga0206353_11175304 | |||
| 384 | Ga0207688_10003164 | |||
| 385 | Ga0207680_10039159 | |||
| 386 | Ga0207647_10135085 | |||
| 387 | Ga0207705_10231779 | |||
| 388 | Ga0207654_10006100 | |||
| 389 | Ga0207707_10196579 | |||
| 390 | Ga0207693_10009301 | |||
| 391 | Ga0207663_10198745 | |||
| 392 | Ga0207657_10010073 | |||
| 393 | Ga0207657_10022465 | |||
| 394 | Ga0207657_10104280 | |||
| 395 | Ga0207657_10162258 | |||
| 396 | Ga0207694_10181205 | |||
| 397 | Ga0207664_10063383 | |||
| 398 | Ga0207664_10090826 | |||
| 399 | Ga0207690_10102948 | |||
| 400 | Ga0207704_10021494 | |||
| 401 | Ga0207691_10289268 | |||
| 402 | Ga0207679_10055076 | |||
| 403 | Ga0207668_10107385 | |||
| 404 | Ga0207668_10131497 | |||
| 405 | Ga0207658_10012115 | |||
| 406 | Ga0207677_10123513 | |||
| 407 | Ga0207677_10245351 | |||
| 408 | Ga0207703_10045242 | |||
| 409 | Ga0207678_10017500 | |||
| 410 | Ga0207702_10121741 | |||
| 411 | Ga0207702_10209633 | |||
| 412 | Ga0207641_10000562 | |||
| 413 | Ga0207641_10041488 | |||
| 414 | Ga0207641_10042557 | |||
| 415 | Ga0207676_10063826 | |||
| 416 | Ga0207683_10015426 | |||
| 417 | Ga0207683_10188317 | |||
| 418 | Ga0207698_10089796 | |||
| 419 | Ga0268266_10000794 | |||
| 420 | Ga0268266_10001153 | |||
| 421 | Ga0268265_10432558 | |||
| 422 | Ga0268264_10000257 | |||
| 423 | Ga0316181_1123477 | |||
| 424 | Ga0307408_100078104 | |||
| 425 | Ga0307508_10035486 | |||
| 426 | Ga0316576_10002847 | |||
| 427 | Ga0316578_10025320 | |||
| 428 | Ga0307405_10030057 | |||
| 429 | Ga0307405_10200240 | |||
| 430 | Ga0307407_10184581 | |||
| 431 | Ga0307412_10065067 | |||
| 432 | Ga0307409_100025810 | |||
| 433 | Ga0307416_100365149 | |||
| 434 | Ga0307411_10124514 | |||
| 435 | Ga0307415_100185666 | |||
| 436 | Ga0316574_0047394 | |||
| 437 | Ga0373931_0021587 | |||
| 438 | Ga0395899_0016451 | |||
| 439 | Ga0395899_0037638 | |||
| 440 | Ga0395900_0003395 | |||
| 441 | Ga0395900_0059293 | |||
| 442 | Ga0395900_0073968 | |||
| 443 | Ga0395898_0233460 | |||
| 444 | Ga0395901_0090992 | |||
| 445 | Ga0395901_0114129 | |||
| 446 | Ga0451853_1736039 | |||
| 447 | Ga0450907_003560 | |||
| 448 | Ga0451577_0121415 | |||
| 449 | Ga0466965_0001939 | |||
| 450 | Ga0466965_0004870 | |||
| 451 | Ga0466965_0020476 | |||
| 452 | Ga0466965_0099518 | |||
| 453 | Ga0466963_0011310 | |||
| 454 | Ga0466963_0044204 | |||
| 455 | Ga0466963_0051723 | |||
| 456 | Ga0466964_0004033 | |||
| 457 | Ga0466971_0012684 | |||
| 458 | Ga0466971_0055719 | |||
| 459 | Ga0466970_0001549 | |||
| 460 | Ga0466970_0011340 | |||
| 461 | Ga0466970_0015639 | |||
| 462 | Ga0466970_0030794 | |||
| 463 | Ga0466957_0017810 | |||
| 464 | Ga0466957_0057838 | |||
| 465 | Ga0466960_0002271 | |||
| 466 | Ga0466960_0012672 | |||
| 467 | Ga0466960_0017164 | |||
| 468 | Ga0466960_0040381 | |||
| 469 | Ga0466960_0150175 | |||
| 470 | Ga0451576_0293737 | |||
| 471 | Ga0466958_0100325 | |||
| 472 | Ga0466967_0014503 | |||
| 473 | Ga0466967_0029383 | |||
| 474 | Ga0466967_0059889 | |||
| 475 | Ga0466967_0072563 | |||
| 476 | Ga0466967_0225706 | |||
| 477 | Ga0495629_0057861 | |||
| 478 | Ga0496101_0031923 | |||
| 479 | Ga0496101_0057294 | |||
| 480 | Ga0496102_0001789 | |||
| 481 | Ga0496102_0004193 | |||
| 482 | Ga0496102_0007250 | |||
| 483 | Ga0496102_0282913 | |||
| 484 | Ga0496103_0018847 | |||
| 485 | Ga0496104_0006528 | |||
| 486 | Ga0496105_0000345 | |||
| 487 | Ga0496105_0029201 | |||
| 488 | Ga0496105_0149673 | |||
| 489 | Ga0496106_0005157 | |||
| 490 | Ga0496106_0013882 | |||
| 491 | Ga0496107_0052965 | |||
| 492 | Ga0496107_0122081 | |||
| 493 | Ga0496107_0269528 | |||
| 494 | Ga0496108_0036497 | |||
| 495 | Ga0496108_0044064 | |||
| 496 | Ga0496108_0139327 | |||
| 497 | Ga0496109_0005719 | |||
| 498 | Ga0496109_0009281 | |||
| 499 | Ga0496109_0063396 | |||
| 500 | Ga0496109_0074084 | |||
| 501 | Ga0496109_0125878 | |||
| 502 | Ga0496109_0276167 | |||
| 503 | Ga0496110_0014442 | |||
| 504 | Ga0496110_0305012 | |||
| 505 | Ga0496111_0002891 | |||
| 506 | Ga0496112_0383773 | |||
| 507 | Ga0496113_0065541 | |||
| 508 | Ga0496114_0009013 | |||
| 509 | Ga0496114_0052279 | |||
| 510 | Ga0496114_0073755 | |||
| 511 | Ga0496115_0001682 | |||
| 512 | Ga0496115_0012989 | |||
| 513 | Ga0496118_0074775 | |||
| 514 | Ga0496119_0000282 | |||
| 515 | Ga0496120_0005229 | |||
| 516 | Ga0496126_0000035 | |||
| 517 | Ga0501031_0131897 | |||
| 518 | Ga0501032_0028305 | |||
| 519 | Ga0501032_0090954 | |||
| 520 | Ga0501034_0005212 | |||
| 521 | Ga0501034_0058249 | |||
| 522 | Ga0501034_0158297 | |||
| 523 | Ga0501034_0473924 | |||
| 524 | Ga0501036_0003724 | |||
| 525 | Ga0501037_0176532 | |||
| 526 | Ga0501038_0009052 | |||
| 527 | Ga0501038_0009638 | |||
| 528 | Ga0501039_0022756 | |||
| 529 | Ga0501039_0031621 | |||
| 530 | Ga0501039_0058188 | |||
| 531 | Ga0501039_0187558 | |||
| 532 | Ga0501042_0097135 | |||
| 533 | Ga0501042_0100796 | |||
| 534 | Ga0501046_0008983 | |||
| 535 | Ga0501047_0118784 | |||
| 536 | Ga0501048_0140382 | |||
| 537 | Ga0501067_0000288 | |||
| 538 | Ga0501067_0005438 | |||
| 539 | Ga0501067_0070771 | |||
| 540 | Ga0501067_0107695 | |||
| 541 | Ga0501068_0042383 | |||
| 542 | Ga0501068_0092939 | |||
| 543 | Ga0501069_0048925 | |||
| 544 | Ga0501070_0000826 | |||
| 545 | Ga0501070_0078600 | |||
| 546 | Ga0501070_0127433 | |||
| 547 | Ga0501070_0207581 | |||
| 548 | Ga0501071_0006094 | |||
| 549 | Ga0501071_0214862 | |||
| 550 | Ga0501073_0022412 | |||
| 551 | Ga0501073_0056773 | |||
| 552 | Ga0501073_0076695 | |||
| 553 | Ga0501074_0018526 | |||
| 554 | Ga0501074_0024371 | |||
| 555 | Ga0501075_0134324 | |||
| 556 | Ga0501077_0009157 | |||
| 557 | Ga0501079_0107289 | |||
| 558 | Ga0501080_0005549 | |||
| 559 | Ga0501080_0010859 | |||
| 560 | Ga0501081_0178296 | |||
| 561 | Ga0501083_0009218 | |||
| 562 | Ga0501083_0122778 | |||
| 563 | Ga0501035_0014584 | |||
| 564 | Ga0501044_0006086 | |||
| 565 | Ga0501044_0348074 | |||
| 566 | Ga0501045_0123849 | |||
| 567 | nmdc:mga00v17_16960_c1 | |||
| 568 | nmdc:mga00v17_51704_c1 | |||
| 569 | nmdc:mga0yw44_14753_c1 | |||
| 570 | nmdc:mga07m45_30190_c1 | |||
| 571 | nmdc:mga0a205_27627_c1 | |||
| 572 | Ga0495595_0026265 | |||
| 573 | Ga0500644_0000249 | |||
| 574 | Ga0500573_0005347 | |||
| 575 | Ga0501084_0045045 | |||
| 576 | Ga0466962_0010555 | |||
| 577 | Ga0530510_0087180 | |||
| 578 | 2643893315 | |||
| 579 | 2643961626 | |||
| 580 | 2644035231 | |||
| 581 | 2644091638 | |||
| 582 | 2644173550 | |||
| 583 | 2644231094 | |||
| 584 | 2644321441 | |||
| 585 | 2644538326 | |||
| 586 | 2738867652 | |||
| 587 | 2740166445 | |||
| 588 | 2799185489 | |||
| 589 | 2812331905 | |||
| 590 | 2855680195 | |||
| 591 | 2857289226 | |||
| 592 | 2857482721 | |||
| 593 | 2858854750 | |||
| 594 | 2858887301 | |||
| 595 | 2858892996 | |||
| 596 | 2858902164 | |||
| 597 | 2867512174 | |||
| 598 | 2869050632 | |||
| 599 | 2869063933 | |||
| 600 | 2869070491 | |||
| 601 | 2880495465 | |||
| 602 | 2880496891 | |||
| 603 | 2887484738 | |||
| 604 | 2895433976 | |||
| 605 | 2929225510 | |||
| 606 | 2929231511 | |||
| 607 | 8001782315 | |||
| 608 | 8054704423 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3tx8-assembly1.cif.gz_A-2 | crystal structure of a succinyl-diaminopimelate desuccinylase (arge) from corynebacterium glutamicum atcc 13032 at 2.97 a resolution | 0.9342 | 5 | 351 |
| 3tx8-assembly1.cif.gz_A-2 | crystal structure of a succinyl-diaminopimelate desuccinylase (arge) from corynebacterium glutamicum atcc 13032 at 2.97 a resolution | 0.9117 | 5 | 351 |
| 3ct9-assembly1.cif.gz_B | crystal structure of a putative zinc peptidase (np_812461.1) from bacteroides thetaiotaomicron vpi-5482 at 2.31 a resolution | 0.8812 | 6 | 355 |
| 3ct9-assembly1.cif.gz_B | crystal structure of a putative zinc peptidase (np_812461.1) from bacteroides thetaiotaomicron vpi-5482 at 2.31 a resolution | 0.8646 | 6 | 355 |
| 7lgp-assembly1.cif.gz_A | dape enzyme from shigella flexneri | 0.8447 | 10 | 351 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WHS9_166_276_3.40.630.10 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.9707 | 168 | 275 | 3.40.630.10 |
| 3tx8A01 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.9399 | 5 | 351 | 3.40.630.10 |
| af_P9WHS9_166_276_3.40.630.10 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.9368 | 168 | 275 | 3.40.630.10 |
| 3tx8A01 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.9285 | 5 | 351 | 3.40.630.10 |
| af_Q2FWN8_3_180_3.40.630.10 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases | 0.85 | 10 | 159 | 3.40.630.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7G7MK06-F1-model_v4 | Succinyl-diaminopimelate desuccinylase (EC 3.5.1.18) | 0.9892 | 2 | 352 |
GO:0006526
GO:0008777 GO:0009014 GO:0009089 GO:0046872 |
| AF-A0A7I7JJV7-F1-model_v4 | Succinyl-diaminopimelate desuccinylase (EC 3.5.1.18) | 0.9803 | 1 | 351 |
GO:0006526
GO:0008777 GO:0009014 GO:0009089 GO:0046872 |
| AF-A0A6G9ZAZ3-F1-model_v4 | Succinyl-diaminopimelate desuccinylase (EC 3.5.1.18) | 0.98 | 2 | 354 |
GO:0006526
GO:0008777 GO:0009014 GO:0009089 GO:0046872 |
| AF-A0A370H8M9-F1-model_v4 | Succinyl-diaminopimelate desuccinylase (EC 3.5.1.18) | 0.9795 | 2 | 355 |
GO:0006526
GO:0008777 GO:0009014 GO:0009089 GO:0046872 |
| AF-A0A7Y3LFU2-F1-model_v4 | Succinyl-diaminopimelate desuccinylase (EC 3.5.1.18) | 0.9766 | 8 | 351 |
GO:0006526
GO:0008777 GO:0009014 GO:0009089 GO:0046872 |