F397838

General Info

Members Datasets Scaffolds Average Seq Length
304 205 608 358

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221576|2643893315
Length 381
Sequence RGRACLTGPVSPPHDLDLSTDVVSLTRALVDIESVSRNEQVIADAVEVALQGLSHLTVTRHGNTLVARTDLGRPSRVVIAGHLDTVPLNDNLPSRLEDGLLHGLGTCDMKGGDAVILRLAATVPEPVHDVTFVLYDCEEIDSALNGLRLLSVSDPALLEADFAILMEPSNGVVEAGCQGTLRVDVRTRGERAHSARSWKGVNAIHAAAAVLTRLNEYDARRPVIDGLEYHEGLNAVGISGGVAGNVIPDECVVSVNFRFAPDRSETDALAFVREFFDGFDVTLTDSAPGALPGLDQPAARAFVDAVGGEVNPKFGWTDVARFTALGVPAVNYGPGDPLLAHKQEEFVEVAQIEECERQLRQWLLTDVPADVPADPTREVQR

Samples

Sample ID Description Type Environment
1 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
90 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
91 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
92 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
93 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
94 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
95 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
98 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
99 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
100 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
101 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
106 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
107 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
108 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
109 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
110 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
111 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
112 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
113 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
114 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
117 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
118 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
119 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
120 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
121 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
124 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
125 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
126 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
127 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
128 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
129 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
130 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
131 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
132 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
133 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
134 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
135 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
136 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
137 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
138 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
150 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
151 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
152 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
153 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
154 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
155 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
156 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
157 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
158 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
159 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
160 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
161 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
162 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
165 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
166 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
167 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
168 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
169 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
170 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
171 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
172 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
173 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
174 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
175 2643221576 Nocardioides sp. Root614 Isolate Unclassified
176 2643221590 Nocardioides sp. Root682 Isolate Unclassified
177 2643221604 Nocardioides sp. Root190 Isolate Unclassified
178 2643221615 Nocardioides sp. Root224 Isolate Unclassified
179 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
180 2643221641 Nocardioides sp. Root122 Isolate Unclassified
181 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
182 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
183 2738541305 Nocardioides sp. CF167 Isolate Unclassified
184 2739367898 Nocardioides sp. CF479 Isolate Unclassified
185 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
186 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
187 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
188 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
189 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
190 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
191 2858882152 Micromonospora noduli MED15 Isolate Nodule
192 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
193 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
194 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
195 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
196 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
197 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
198 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
199 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
200 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
201 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
202 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
203 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
204 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
205 8054704163 Micromonospora trifolii NIE79 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.47
Metatranscriptomes 0.33
Isolates 10.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.95
Nodule 0.66
Rhizoplane 11.51
Rhizosphere 73.36
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1002852 3300000549 Bacteria 2364
2 JGI24735J21928_10038846 3300002067 Bacteria 1392
3 Ga0070658_10087607 3300005327 Bacteria 2563
4 Ga0070683_100000566 3300005329 Bacteria 26326
5 Ga0070666_10136476 3300005335 Bacteria 1707
6 Ga0070680_100127210 3300005336 Bacteria 2129
7 Ga0070682_100061158 3300005337 Bacteria 2383
8 Ga0070660_100003517 3300005339 Bacteria 10797
9 Ga0070660_100027131 3300005339 Bacteria 4272
10 Ga0070687_100085997 3300005343 Bacteria 1727
11 Ga0070668_100016248 3300005347 Bacteria 5567
12 Ga0070673_100104419 3300005364 Bacteria 2339
13 Ga0070659_100027577 3300005366 Bacteria 4378
14 Ga0070659_100144967 3300005366 Bacteria 1934
15 Ga0070667_100001309 3300005367 Bacteria 22415
16 Ga0070667_100091665 3300005367 Bacteria 2613
17 Ga0070714_100007169 3300005435 Bacteria 8650
18 Ga0070701_10033291 3300005438 Bacteria 2574
19 Ga0070663_100007824 3300005455 Bacteria 6534
20 Ga0070698_100003056 3300005471 Bacteria 18446
21 Ga0070684_100001014 3300005535 Bacteria 20027
22 Ga0070684_100093239 3300005535 Bacteria 2680
23 Ga0070684_100187205 3300005535 Bacteria 1883
24 Ga0070695_100057148 3300005545 Bacteria 2520
25 Ga0070665_100001318 3300005548 Bacteria 29616
26 Ga0070665_100009311 3300005548 Bacteria 9941
27 Ga0070665_100145547 3300005548 Bacteria 2373
28 Ga0070704_100015882 3300005549 Bacteria 4742
29 Ga0070664_100051540 3300005564 Bacteria 3485
30 Ga0068857_100012416 3300005577 Bacteria 7415
31 Ga0068856_100031077 3300005614 Bacteria 5223
32 Ga0070702_100015779 3300005615 Bacteria 3863
33 Ga0070702_100029423 3300005615 Bacteria 2987
34 Ga0070702_100111154 3300005615 Bacteria 1699
35 Ga0068852_100068923 3300005616 Bacteria 3098
36 Ga0068859_100148236 3300005617 Bacteria 2422
37 Ga0068870_10041815 3300005840 Bacteria 2384
38 Ga0068870_10150589 3300005840 Bacteria 1370
39 Ga0068863_100018933 3300005841 Bacteria 6589
40 Ga0068858_100016437 3300005842 Bacteria 6949
41 Ga0068858_100114301 3300005842 Bacteria 2521
42 Ga0068860_100000345 3300005843 Bacteria 62383
43 Ga0068860_100053734 3300005843 Bacteria 3829
44 Ga0068860_100086233 3300005843 Bacteria 2988
45 Ga0068862_100260400 3300005844 Bacteria 1583
46 Ga0081540_1003681 3300005983 Bacteria 12022
47 Ga0075365_10008217 3300006038 Bacteria 5905
48 Ga0075365_10215421 3300006038 Bacteria 1346
49 Ga0075363_100061545 3300006048 Bacteria 2023
50 Ga0075364_10037147 3300006051 Bacteria 3152
51 Ga0075364_10154569 3300006051 Bacteria 1547
52 Ga0070712_100108699 3300006175 Bacteria 2065
53 Ga0075362_10023228 3300006177 Bacteria 2621
54 Ga0097621_100356654 3300006237 Bacteria 1302
55 Ga0097620_100148237 3300006931 Bacteria 2422
56 Ga0105245_10060106 3300009098 Bacteria 3423
57 Ga0105245_10465494 3300009098 Bacteria 1275
58 Ga0105243_10031986 3300009148 Bacteria 4060
59 Ga0105241_10026313 3300009174 Bacteria 4327
60 Ga0105237_10224881 3300009545 Bacteria 1877
61 Ga0105249_10402987 3300009553 Bacteria 1398
62 Ga0105239_10001058 3300010375 Bacteria 38262
63 Ga0105246_10150976 3300011119 Bacteria 1758
64 Ga0157373_10045829 3300013100 Bacteria 3121
65 Ga0157370_10060912 3300013104 Bacteria 3582
66 Ga0157369_10047547 3300013105 Bacteria 4657
67 Ga0163162_10020330 3300013306 Bacteria 6522
68 Ga0163162_10203538 3300013306 Bacteria 2109
69 Ga0157372_10002293 3300013307 Bacteria 20744
70 Ga0157372_10269910 3300013307 Bacteria 1976
71 Ga0157372_10372082 3300013307 Bacteria 1665
72 Ga0157375_10054232 3300013308 Bacteria 3948
73 Ga0157375_10115648 3300013308 Bacteria 2785
74 Ga0163163_10129787 3300014325 Bacteria 2560
75 Ga0157380_10071601 3300014326 Bacteria 2805
76 Ga0157379_10026044 3300014968 Bacteria 5202
77 Ga0157379_10305258 3300014968 Bacteria 1451
78 Ga0163161_10041940 3300017792 Bacteria 3289
79 Ga0206353_11175304 3300020082 Bacteria 2212
80 Ga0207688_10003164 3300025901 Bacteria 8979
81 Ga0207680_10039159 3300025903 Bacteria 2748
82 Ga0207647_10135085 3300025904 Bacteria 1448
83 Ga0207705_10231779 3300025909 Bacteria 1405
84 Ga0207654_10006100 3300025911 Bacteria 6059
85 Ga0207707_10196579 3300025912 Bacteria 1759
86 Ga0207693_10009301 3300025915 Bacteria 8019
87 Ga0207663_10198745 3300025916 Bacteria 1445
88 Ga0207657_10010073 3300025919 Bacteria 9451
89 Ga0207657_10022465 3300025919 Bacteria 5900
90 Ga0207657_10104280 3300025919 Bacteria 2349
91 Ga0207657_10162258 3300025919 Bacteria 1815
92 Ga0207694_10181205 3300025924 Bacteria 1708
93 Ga0207664_10063383 3300025929 Bacteria 2954
94 Ga0207664_10090826 3300025929 Bacteria 2503
95 Ga0207690_10102948 3300025932 Bacteria 2043
96 Ga0207704_10021494 3300025938 Bacteria 3439
97 Ga0207691_10289268 3300025940 Bacteria 1409
98 Ga0207679_10055076 3300025945 Bacteria 2930
99 Ga0207668_10107385 3300025972 Bacteria 2087
100 Ga0207668_10131497 3300025972 Bacteria 1912
101 Ga0207658_10012115 3300025986 Bacteria 5881
102 Ga0207677_10123513 3300026023 Bacteria 1952
103 Ga0207677_10245351 3300026023 Bacteria 1451
104 Ga0207703_10045242 3300026035 Bacteria 3540
105 Ga0207678_10017500 3300026067 Bacteria 6294
106 Ga0207702_10121741 3300026078 Bacteria 2336
107 Ga0207702_10209633 3300026078 Bacteria 1811
108 Ga0207641_10000562 3300026088 Bacteria 41565
109 Ga0207641_10041488 3300026088 Bacteria 3857
110 Ga0207641_10042557 3300026088 Bacteria 3811
111 Ga0207676_10063826 3300026095 Bacteria 2926
112 Ga0207683_10015426 3300026121 Bacteria 6507
113 Ga0207683_10188317 3300026121 Bacteria 1873
114 Ga0207698_10089796 3300026142 Bacteria 2511
115 Ga0268266_10000794 3300028379 Bacteria 42029
116 Ga0268266_10001153 3300028379 Bacteria 32787
117 Ga0268265_10432558 3300028380 Bacteria 1225
118 Ga0268264_10000257 3300028381 Bacteria 96251
119 Ga0316181_1123477 3300030744 Bacteria 2212
120 Ga0307408_100078104 3300031548 Bacteria 2467
121 Ga0307508_10035486 3300031616 Bacteria 4494
122 Ga0316576_10002847 3300031727 Bacteria 9972
123 Ga0316578_10025320 3300031728 Bacteria 3335
124 Ga0307405_10030057 3300031731 Bacteria 3182
125 Ga0307405_10200240 3300031731 Bacteria 1450
126 Ga0307407_10184581 3300031903 Bacteria 1385
127 Ga0307412_10065067 3300031911 Bacteria 2466
128 Ga0307409_100025810 3300031995 Bacteria 4130
129 Ga0307416_100365149 3300032002 Bacteria 1467
130 Ga0307411_10124514 3300032005 Bacteria 1872
131 Ga0307415_100185666 3300032126 Bacteria 1636
132 Ga0316574_0047394 3300035398 Bacteria 2667
133 Ga0373931_0021587 3300035691 Bacteria 3231
134 Ga0395899_0016451 3300037312 Bacteria 5639
135 Ga0395899_0037638 3300037312 Bacteria 3627
136 Ga0395900_0003395 3300037418 Bacteria 17196
137 Ga0395900_0059293 3300037418 Bacteria 3940
138 Ga0395900_0073968 3300037418 Bacteria 3504
139 Ga0395898_0233460 3300037466 Bacteria 1754
140 Ga0395901_0090992 3300038443 Bacteria 3193
141 Ga0395901_0114129 3300038443 Bacteria 2837
142 Ga0451853_1736039 3300041512 Bacteria 1548
143 Ga0450907_003560 3300042146 Bacteria 2770
144 Ga0451577_0121415 3300042876 Bacteria 2341
145 Ga0466965_0001939 3300044683 Bacteria 8640
146 Ga0466965_0004870 3300044683 Bacteria 5995
147 Ga0466965_0020476 3300044683 Bacteria 3180
148 Ga0466965_0099518 3300044683 Bacteria 1486
149 Ga0466963_0011310 3300044694 Bacteria 5431
150 Ga0466963_0044204 3300044694 Bacteria 2932
151 Ga0466963_0051723 3300044694 Bacteria 2724
152 Ga0466964_0004033 3300044706 Bacteria 5398
153 Ga0466971_0012684 3300044719 Bacteria 3696
154 Ga0466971_0055719 3300044719 Bacteria 1782
155 Ga0466970_0001549 3300044765 Bacteria 11072
156 Ga0466970_0011340 3300044765 Bacteria 4543
157 Ga0466970_0015639 3300044765 Bacteria 3905
158 Ga0466970_0030794 3300044765 Bacteria 2831
159 Ga0466957_0017810 3300044842 Bacteria 4167
160 Ga0466957_0057838 3300044842 Bacteria 2374
161 Ga0466960_0002271 3300044901 Bacteria 7189
162 Ga0466960_0012672 3300044901 Bacteria 3565
163 Ga0466960_0017164 3300044901 Bacteria 3151
164 Ga0466960_0040381 3300044901 Bacteria 2206
165 Ga0466960_0150175 3300044901 Bacteria 1244
166 Ga0451576_0293737 3300045051 Bacteria 1699
167 Ga0466958_0100325 3300045836 Bacteria 1799
168 Ga0466967_0014503 3300045976 Bacteria 6141
169 Ga0466967_0029383 3300045976 Bacteria 4600
170 Ga0466967_0059889 3300045976 Bacteria 3372
171 Ga0466967_0072563 3300045976 Bacteria 3086
172 Ga0466967_0225706 3300045976 Bacteria 1782
173 Ga0495629_0057861 3300046459 Bacteria 2710
174 Ga0496101_0031923 3300048904 Bacteria 3705
175 Ga0496101_0057294 3300048904 Bacteria 2818
176 Ga0496102_0001789 3300048905 Bacteria 18636
177 Ga0496102_0004193 3300048905 Bacteria 12194
178 Ga0496102_0007250 3300048905 Bacteria 9463
179 Ga0496102_0282913 3300048905 Bacteria 1563
180 Ga0496103_0018847 3300048906 Bacteria 4143
181 Ga0496104_0006528 3300048907 Bacteria 10257
182 Ga0496105_0000345 3300048908 Bacteria 30539
183 Ga0496105_0029201 3300048908 Bacteria 4513
184 Ga0496105_0149673 3300048908 Bacteria 1919
185 Ga0496106_0005157 3300048909 Bacteria 9680
186 Ga0496106_0013882 3300048909 Bacteria 5953
187 Ga0496107_0052965 3300048910 Bacteria 2927
188 Ga0496107_0122081 3300048910 Bacteria 1919
189 Ga0496107_0269528 3300048910 Bacteria 1267
190 Ga0496108_0036497 3300048911 Bacteria 4089
191 Ga0496108_0044064 3300048911 Bacteria 3726
192 Ga0496108_0139327 3300048911 Bacteria 2090
193 Ga0496109_0005719 3300048912 Bacteria 10407
194 Ga0496109_0009281 3300048912 Bacteria 8380
195 Ga0496109_0063396 3300048912 Bacteria 3381
196 Ga0496109_0074084 3300048912 Bacteria 3129
197 Ga0496109_0125878 3300048912 Bacteria 2389
198 Ga0496109_0276167 3300048912 Bacteria 1583
199 Ga0496110_0014442 3300048913 Bacteria 6559
200 Ga0496110_0305012 3300048913 Bacteria 1450
201 Ga0496111_0002891 3300048914 Bacteria 10485
202 Ga0496112_0383773 3300048915 Bacteria 1346
203 Ga0496113_0065541 3300048916 Bacteria 2749
204 Ga0496114_0009013 3300048917 Bacteria 7909
205 Ga0496114_0052279 3300048917 Bacteria 3403
206 Ga0496114_0073755 3300048917 Bacteria 2872
207 Ga0496115_0001682 3300048918 Bacteria 15899
208 Ga0496115_0012989 3300048918 Bacteria 6283
209 Ga0496118_0074775 3300048921 Bacteria 2420
210 Ga0496119_0000282 3300048922 Bacteria 71403
211 Ga0496120_0005229 3300048923 Bacteria 10437
212 Ga0496126_0000035 3300048929 Bacteria 361590
213 Ga0501031_0131897 3300049568 Bacteria 1632
214 Ga0501032_0028305 3300049569 Bacteria 3851
215 Ga0501032_0090954 3300049569 Bacteria 2025
216 Ga0501034_0005212 3300049571 Bacteria 14263
217 Ga0501034_0058249 3300049571 Bacteria 3882
218 Ga0501034_0158297 3300049571 Bacteria 2238
219 Ga0501034_0473924 3300049571 Bacteria 1168
220 Ga0501036_0003724 3300049572 Bacteria 12224
221 Ga0501037_0176532 3300049573 Bacteria 1517
222 Ga0501038_0009052 3300049574 Bacteria 9138
223 Ga0501038_0009638 3300049574 Bacteria 8859
224 Ga0501039_0022756 3300049575 Bacteria 4808
225 Ga0501039_0031621 3300049575 Bacteria 4081
226 Ga0501039_0058188 3300049575 Bacteria 2993
227 Ga0501039_0187558 3300049575 Bacteria 1626
228 Ga0501042_0097135 3300049578 Bacteria 2117
229 Ga0501042_0100796 3300049578 Bacteria 2076
230 Ga0501046_0008983 3300049580 Bacteria 8675
231 Ga0501047_0118784 3300049581 Bacteria 2526
232 Ga0501048_0140382 3300049582 Bacteria 1708
233 Ga0501067_0000288 3300049583 Bacteria 27513
234 Ga0501067_0005438 3300049583 Bacteria 7072
235 Ga0501067_0070771 3300049583 Bacteria 1931
236 Ga0501067_0107695 3300049583 Bacteria 1549
237 Ga0501068_0042383 3300049584 Bacteria 2737
238 Ga0501068_0092939 3300049584 Bacteria 1863
239 Ga0501069_0048925 3300049585 Bacteria 2349
240 Ga0501070_0000826 3300049586 Bacteria 28120
241 Ga0501070_0078600 3300049586 Bacteria 2730
242 Ga0501070_0127433 3300049586 Bacteria 2103
243 Ga0501070_0207581 3300049586 Bacteria 1608
244 Ga0501071_0006094 3300049587 Bacteria 7817
245 Ga0501071_0214862 3300049587 Bacteria 1447
246 Ga0501073_0022412 3300049589 Bacteria 4548
247 Ga0501073_0056773 3300049589 Bacteria 2738
248 Ga0501073_0076695 3300049589 Bacteria 2326
249 Ga0501074_0018526 3300049590 Bacteria 5058
250 Ga0501074_0024371 3300049590 Bacteria 4397
251 Ga0501075_0134324 3300049591 Bacteria 1885
252 Ga0501077_0009157 3300049593 Bacteria 6149
253 Ga0501079_0107289 3300049741 Bacteria 2168
254 Ga0501080_0005549 3300049742 Bacteria 11264
255 Ga0501080_0010859 3300049742 Bacteria 8334
256 Ga0501081_0178296 3300049743 Bacteria 1536
257 Ga0501083_0009218 3300049744 Bacteria 6970
258 Ga0501083_0122778 3300049744 Bacteria 1703
259 Ga0501035_0014584 3300049822 Bacteria 7253
260 Ga0501044_0006086 3300049823 Bacteria 13314
261 Ga0501044_0348074 3300049823 Bacteria 1402
262 Ga0501045_0123849 3300049824 Bacteria 1920
263 nmdc:mga00v17_16960_c1 3300050491 Bacteria 4113
264 nmdc:mga00v17_51704_c1 3300050491 Bacteria 2498
265 nmdc:mga0yw44_14753_c1 3300050492 Bacteria 4160
266 nmdc:mga07m45_30190_c1 3300050496 Bacteria 3001
267 nmdc:mga0a205_27627_c1 3300050515 Bacteria 5419
268 Ga0495595_0026265 3300053084 Bacteria 2587
269 Ga0500644_0000249 3300053088 Bacteria 30553
270 Ga0500573_0005347 3300053140 Bacteria 6872
271 Ga0501084_0045045 3300054114 Bacteria 3694
272 Ga0466962_0010555 3300061719 Bacteria 4443
273 Ga0530510_0087180 3300061734 Bacteria 2275
274 2643893315 2643221576 Bacteria 5214352
275 2643961626 2643221590 Bacteria 5214697
276 2644035231 2643221604 Bacteria 5014917
277 2644091638 2643221615 Bacteria 5487866
278 2644173550 2643221631 Bacteria 8168043
279 2644231094 2643221641 Bacteria 4490190
280 2644321441 2643221657 Bacteria 5490246
281 2644538326 2643221697 Bacteria 3575694
282 2738867652 2738541305 Bacteria 4910150
283 2740166445 2739367898 Bacteria 4367674
284 2799185489 2799112218 Bacteria 4315149
285 2812331905 2811994874 Bacteria 5367947
286 2855680195 2855676851 Bacteria 7063653
287 2857289226 2857288857 Bacteria 7189066
288 2857482721 2857481737 Bacteria 4761446
289 2858854750 2858848962 Bacteria 6963058
290 2858887301 2858882152 Bacteria 7230291
291 2858892996 2858888857 Bacteria 7060307
292 2858902164 2858895516 Bacteria 7378898
293 2867512174 2867507094 Bacteria 6506033
294 2869050632 2869048445 Bacteria 6875584
295 2869063933 2869061728 Bacteria 7112407
296 2869070491 2869068681 Bacteria 7205615
297 2880495465 2880489317 Bacteria 7096270
298 2880496891 2880495981 Bacteria 7340502
299 2887484738 2887478801 Bacteria 8972725
300 2895433976 2895427314 Bacteria 13147766
301 2929225510 2929219909 Bacteria 6984360
302 2929231511 2929226422 Bacteria 7248583
303 8001782315 8001781756 Bacteria 9586736
304 8054704423 8054704163 Bacteria 7247792
305 LJQas_1002852
306 JGI24735J21928_10038846
307 Ga0070658_10087607
308 Ga0070683_100000566
309 Ga0070666_10136476
310 Ga0070680_100127210
311 Ga0070682_100061158
312 Ga0070660_100003517
313 Ga0070660_100027131
314 Ga0070687_100085997
315 Ga0070668_100016248
316 Ga0070673_100104419
317 Ga0070659_100027577
318 Ga0070659_100144967
319 Ga0070667_100001309
320 Ga0070667_100091665
321 Ga0070714_100007169
322 Ga0070701_10033291
323 Ga0070663_100007824
324 Ga0070698_100003056
325 Ga0070684_100001014
326 Ga0070684_100093239
327 Ga0070684_100187205
328 Ga0070695_100057148
329 Ga0070665_100001318
330 Ga0070665_100009311
331 Ga0070665_100145547
332 Ga0070704_100015882
333 Ga0070664_100051540
334 Ga0068857_100012416
335 Ga0068856_100031077
336 Ga0070702_100015779
337 Ga0070702_100029423
338 Ga0070702_100111154
339 Ga0068852_100068923
340 Ga0068859_100148236
341 Ga0068870_10041815
342 Ga0068870_10150589
343 Ga0068863_100018933
344 Ga0068858_100016437
345 Ga0068858_100114301
346 Ga0068860_100000345
347 Ga0068860_100053734
348 Ga0068860_100086233
349 Ga0068862_100260400
350 Ga0081540_1003681
351 Ga0075365_10008217
352 Ga0075365_10215421
353 Ga0075363_100061545
354 Ga0075364_10037147
355 Ga0075364_10154569
356 Ga0070712_100108699
357 Ga0075362_10023228
358 Ga0097621_100356654
359 Ga0097620_100148237
360 Ga0105245_10060106
361 Ga0105245_10465494
362 Ga0105243_10031986
363 Ga0105241_10026313
364 Ga0105237_10224881
365 Ga0105249_10402987
366 Ga0105239_10001058
367 Ga0105246_10150976
368 Ga0157373_10045829
369 Ga0157370_10060912
370 Ga0157369_10047547
371 Ga0163162_10020330
372 Ga0163162_10203538
373 Ga0157372_10002293
374 Ga0157372_10269910
375 Ga0157372_10372082
376 Ga0157375_10054232
377 Ga0157375_10115648
378 Ga0163163_10129787
379 Ga0157380_10071601
380 Ga0157379_10026044
381 Ga0157379_10305258
382 Ga0163161_10041940
383 Ga0206353_11175304
384 Ga0207688_10003164
385 Ga0207680_10039159
386 Ga0207647_10135085
387 Ga0207705_10231779
388 Ga0207654_10006100
389 Ga0207707_10196579
390 Ga0207693_10009301
391 Ga0207663_10198745
392 Ga0207657_10010073
393 Ga0207657_10022465
394 Ga0207657_10104280
395 Ga0207657_10162258
396 Ga0207694_10181205
397 Ga0207664_10063383
398 Ga0207664_10090826
399 Ga0207690_10102948
400 Ga0207704_10021494
401 Ga0207691_10289268
402 Ga0207679_10055076
403 Ga0207668_10107385
404 Ga0207668_10131497
405 Ga0207658_10012115
406 Ga0207677_10123513
407 Ga0207677_10245351
408 Ga0207703_10045242
409 Ga0207678_10017500
410 Ga0207702_10121741
411 Ga0207702_10209633
412 Ga0207641_10000562
413 Ga0207641_10041488
414 Ga0207641_10042557
415 Ga0207676_10063826
416 Ga0207683_10015426
417 Ga0207683_10188317
418 Ga0207698_10089796
419 Ga0268266_10000794
420 Ga0268266_10001153
421 Ga0268265_10432558
422 Ga0268264_10000257
423 Ga0316181_1123477
424 Ga0307408_100078104
425 Ga0307508_10035486
426 Ga0316576_10002847
427 Ga0316578_10025320
428 Ga0307405_10030057
429 Ga0307405_10200240
430 Ga0307407_10184581
431 Ga0307412_10065067
432 Ga0307409_100025810
433 Ga0307416_100365149
434 Ga0307411_10124514
435 Ga0307415_100185666
436 Ga0316574_0047394
437 Ga0373931_0021587
438 Ga0395899_0016451
439 Ga0395899_0037638
440 Ga0395900_0003395
441 Ga0395900_0059293
442 Ga0395900_0073968
443 Ga0395898_0233460
444 Ga0395901_0090992
445 Ga0395901_0114129
446 Ga0451853_1736039
447 Ga0450907_003560
448 Ga0451577_0121415
449 Ga0466965_0001939
450 Ga0466965_0004870
451 Ga0466965_0020476
452 Ga0466965_0099518
453 Ga0466963_0011310
454 Ga0466963_0044204
455 Ga0466963_0051723
456 Ga0466964_0004033
457 Ga0466971_0012684
458 Ga0466971_0055719
459 Ga0466970_0001549
460 Ga0466970_0011340
461 Ga0466970_0015639
462 Ga0466970_0030794
463 Ga0466957_0017810
464 Ga0466957_0057838
465 Ga0466960_0002271
466 Ga0466960_0012672
467 Ga0466960_0017164
468 Ga0466960_0040381
469 Ga0466960_0150175
470 Ga0451576_0293737
471 Ga0466958_0100325
472 Ga0466967_0014503
473 Ga0466967_0029383
474 Ga0466967_0059889
475 Ga0466967_0072563
476 Ga0466967_0225706
477 Ga0495629_0057861
478 Ga0496101_0031923
479 Ga0496101_0057294
480 Ga0496102_0001789
481 Ga0496102_0004193
482 Ga0496102_0007250
483 Ga0496102_0282913
484 Ga0496103_0018847
485 Ga0496104_0006528
486 Ga0496105_0000345
487 Ga0496105_0029201
488 Ga0496105_0149673
489 Ga0496106_0005157
490 Ga0496106_0013882
491 Ga0496107_0052965
492 Ga0496107_0122081
493 Ga0496107_0269528
494 Ga0496108_0036497
495 Ga0496108_0044064
496 Ga0496108_0139327
497 Ga0496109_0005719
498 Ga0496109_0009281
499 Ga0496109_0063396
500 Ga0496109_0074084
501 Ga0496109_0125878
502 Ga0496109_0276167
503 Ga0496110_0014442
504 Ga0496110_0305012
505 Ga0496111_0002891
506 Ga0496112_0383773
507 Ga0496113_0065541
508 Ga0496114_0009013
509 Ga0496114_0052279
510 Ga0496114_0073755
511 Ga0496115_0001682
512 Ga0496115_0012989
513 Ga0496118_0074775
514 Ga0496119_0000282
515 Ga0496120_0005229
516 Ga0496126_0000035
517 Ga0501031_0131897
518 Ga0501032_0028305
519 Ga0501032_0090954
520 Ga0501034_0005212
521 Ga0501034_0058249
522 Ga0501034_0158297
523 Ga0501034_0473924
524 Ga0501036_0003724
525 Ga0501037_0176532
526 Ga0501038_0009052
527 Ga0501038_0009638
528 Ga0501039_0022756
529 Ga0501039_0031621
530 Ga0501039_0058188
531 Ga0501039_0187558
532 Ga0501042_0097135
533 Ga0501042_0100796
534 Ga0501046_0008983
535 Ga0501047_0118784
536 Ga0501048_0140382
537 Ga0501067_0000288
538 Ga0501067_0005438
539 Ga0501067_0070771
540 Ga0501067_0107695
541 Ga0501068_0042383
542 Ga0501068_0092939
543 Ga0501069_0048925
544 Ga0501070_0000826
545 Ga0501070_0078600
546 Ga0501070_0127433
547 Ga0501070_0207581
548 Ga0501071_0006094
549 Ga0501071_0214862
550 Ga0501073_0022412
551 Ga0501073_0056773
552 Ga0501073_0076695
553 Ga0501074_0018526
554 Ga0501074_0024371
555 Ga0501075_0134324
556 Ga0501077_0009157
557 Ga0501079_0107289
558 Ga0501080_0005549
559 Ga0501080_0010859
560 Ga0501081_0178296
561 Ga0501083_0009218
562 Ga0501083_0122778
563 Ga0501035_0014584
564 Ga0501044_0006086
565 Ga0501044_0348074
566 Ga0501045_0123849
567 nmdc:mga00v17_16960_c1
568 nmdc:mga00v17_51704_c1
569 nmdc:mga0yw44_14753_c1
570 nmdc:mga07m45_30190_c1
571 nmdc:mga0a205_27627_c1
572 Ga0495595_0026265
573 Ga0500644_0000249
574 Ga0500573_0005347
575 Ga0501084_0045045
576 Ga0466962_0010555
577 Ga0530510_0087180
578 2643893315
579 2643961626
580 2644035231
581 2644091638
582 2644173550
583 2644231094
584 2644321441
585 2644538326
586 2738867652
587 2740166445
588 2799185489
589 2812331905
590 2855680195
591 2857289226
592 2857482721
593 2858854750
594 2858887301
595 2858892996
596 2858902164
597 2867512174
598 2869050632
599 2869063933
600 2869070491
601 2880495465
602 2880496891
603 2887484738
604 2895433976
605 2929225510
606 2929231511
607 8001782315
608 8054704423

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07687

M20_dimer

Peptidase dimerisation domain

176

280

0.92

PF01546

Peptidase_M20

Peptidase family M20/M25/M40

78

365

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tx8-assembly1.cif.gz_A-2 crystal structure of a succinyl-diaminopimelate desuccinylase (arge) from corynebacterium glutamicum atcc 13032 at 2.97 a resolution 0.9342 5 351
3tx8-assembly1.cif.gz_A-2 crystal structure of a succinyl-diaminopimelate desuccinylase (arge) from corynebacterium glutamicum atcc 13032 at 2.97 a resolution 0.9117 5 351
3ct9-assembly1.cif.gz_B crystal structure of a putative zinc peptidase (np_812461.1) from bacteroides thetaiotaomicron vpi-5482 at 2.31 a resolution 0.8812 6 355
3ct9-assembly1.cif.gz_B crystal structure of a putative zinc peptidase (np_812461.1) from bacteroides thetaiotaomicron vpi-5482 at 2.31 a resolution 0.8646 6 355
7lgp-assembly1.cif.gz_A dape enzyme from shigella flexneri 0.8447 10 351
ID Description Score Start End Superfamily
af_P9WHS9_166_276_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9707 168 275 3.40.630.10
3tx8A01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9399 5 351 3.40.630.10
af_P9WHS9_166_276_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9368 168 275 3.40.630.10
3tx8A01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9285 5 351 3.40.630.10
af_Q2FWN8_3_180_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.85 10 159 3.40.630.10
ID Description Score Start End GO Terms
AF-A0A7G7MK06-F1-model_v4 Succinyl-diaminopimelate desuccinylase (EC 3.5.1.18) 0.9892 2 352 GO:0006526
GO:0008777
GO:0009014
GO:0009089
GO:0046872
AF-A0A7I7JJV7-F1-model_v4 Succinyl-diaminopimelate desuccinylase (EC 3.5.1.18) 0.9803 1 351 GO:0006526
GO:0008777
GO:0009014
GO:0009089
GO:0046872
AF-A0A6G9ZAZ3-F1-model_v4 Succinyl-diaminopimelate desuccinylase (EC 3.5.1.18) 0.98 2 354 GO:0006526
GO:0008777
GO:0009014
GO:0009089
GO:0046872
AF-A0A370H8M9-F1-model_v4 Succinyl-diaminopimelate desuccinylase (EC 3.5.1.18) 0.9795 2 355 GO:0006526
GO:0008777
GO:0009014
GO:0009089
GO:0046872
AF-A0A7Y3LFU2-F1-model_v4 Succinyl-diaminopimelate desuccinylase (EC 3.5.1.18) 0.9766 8 351 GO:0006526
GO:0008777
GO:0009014
GO:0009089
GO:0046872

Map