F397747
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 304 | 211 | 304 | 313 |
Family's Representative Sequence
| Representative Sequence | 3300046517|Ga0495630_0244041|Ga0495630_0244041_165_1310 |
| Length | 376 |
| Sequence | MKLHANARTCPKSRKLLVKRIEEENWSLVAAAEAAGISERSAAKWREGERGLLDRSSAPRRRPTQLAADRLGAIEALRRLRMTAAEXXXXLEMALSTVSRWLKRIGLGKRSRLEPPEPPNRYERKRPGELIHVDVKKLGRILVPGHRVTGNRRQHARRTRVGNQGRYLGTAGWEFVHVCVDDATRLAYVEVLDDEKGATAAAFLRRAVRWFKGMGVTVERVLSDNGSCYRSGAHAEACRELDMRHLFTRPYRPRTNGKAERFIQTLTNRWAYGALYGNSAERTAALPGWLTHYNFTRRHGSLGHKAPAARLAELEQRGEELQLVGHPAQRSQCPRSTTSCSLTSKLIRPATLSIARSSERSSKGISRPQSRQIAWW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 31 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 33 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 34 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 35 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 37 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 38 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 39 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 40 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 41 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 42 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 43 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 44 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 45 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 46 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 47 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 49 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 52 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 53 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 54 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 55 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 75 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 76 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 77 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 78 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 118 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 119 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 120 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 121 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 122 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 123 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 124 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 125 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 126 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 127 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 128 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 129 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 130 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 131 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 132 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 133 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 134 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 135 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 136 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 137 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 138 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 139 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 140 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 141 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 165 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 166 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 167 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 168 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 169 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 170 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 171 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 172 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 173 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 174 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 175 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 176 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 177 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 187 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 192 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 194 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 196 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 201 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 202 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 203 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 204 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 208 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 210 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.01 |
| Metatranscriptomes | 0.99 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.66 |
| Nodule | 0 |
| Rhizoplane | 6.91 |
| Rhizosphere | 90.79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.64 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25407J50210_10042391 | 3300003373 | Bacteria | 1164 |
| 2 | Ga0070683_100029594 | 3300005329 | Bacteria | 4960 |
| 3 | Ga0070670_100336730 | 3300005331 | Bacteria | 1324 |
| 4 | Ga0068869_100121429 | 3300005334 | Bacteria | 1999 |
| 5 | Ga0070680_100157290 | 3300005336 | Bacteria | 1909 |
| 6 | Ga0070682_100045637 | 3300005337 | Bacteria | 2717 |
| 7 | Ga0070682_100293457 | 3300005337 | Bacteria | 1190 |
| 8 | Ga0070660_100115272 | 3300005339 | Bacteria | 2141 |
| 9 | Ga0070660_100310612 | 3300005339 | Bacteria | 1294 |
| 10 | Ga0070689_100150008 | 3300005340 | Bacteria | 1880 |
| 11 | Ga0070661_100263728 | 3300005344 | Bacteria | 1332 |
| 12 | Ga0070668_100231259 | 3300005347 | Bacteria | 1528 |
| 13 | Ga0070668_100359893 | 3300005347 | Bacteria | 1233 |
| 14 | Ga0070669_100217736 | 3300005353 | Bacteria | 1509 |
| 15 | Ga0070675_100124184 | 3300005354 | Bacteria | 2195 |
| 16 | Ga0070671_100116687 | 3300005355 | Bacteria | 2244 |
| 17 | Ga0070674_100130555 | 3300005356 | Bacteria | 1872 |
| 18 | Ga0070659_100217343 | 3300005366 | Bacteria | 1577 |
| 19 | Ga0070667_100001181 | 3300005367 | Bacteria | 23764 |
| 20 | Ga0070713_100543197 | 3300005436 | Bacteria | 1100 |
| 21 | Ga0070711_100129976 | 3300005439 | Bacteria | 1874 |
| 22 | Ga0070711_100171278 | 3300005439 | Bacteria | 1655 |
| 23 | Ga0070700_100267591 | 3300005441 | Bacteria | 1233 |
| 24 | Ga0070663_100186379 | 3300005455 | Bacteria | 1612 |
| 25 | Ga0070678_100135626 | 3300005456 | Bacteria | 1962 |
| 26 | Ga0070681_10211904 | 3300005458 | Bacteria | 1853 |
| 27 | Ga0068867_100314758 | 3300005459 | Bacteria | 1295 |
| 28 | Ga0070685_10037243 | 3300005466 | Bacteria | 2754 |
| 29 | Ga0070706_100205584 | 3300005467 | Bacteria | 1839 |
| 30 | Ga0070684_100514982 | 3300005535 | Bacteria | 1109 |
| 31 | Ga0070672_100427797 | 3300005543 | Bacteria | 1138 |
| 32 | Ga0070693_100241604 | 3300005547 | Bacteria | 1193 |
| 33 | Ga0070665_100344875 | 3300005548 | Bacteria | 1494 |
| 34 | Ga0068855_100119334 | 3300005563 | Bacteria | 3020 |
| 35 | Ga0070664_100354903 | 3300005564 | Bacteria | 1334 |
| 36 | Ga0068857_100424061 | 3300005577 | Bacteria | 1241 |
| 37 | Ga0068854_100103571 | 3300005578 | Bacteria | 2137 |
| 38 | Ga0068856_100493659 | 3300005614 | Bacteria | 1245 |
| 39 | Ga0070702_100296688 | 3300005615 | Bacteria | 1116 |
| 40 | Ga0068852_100063418 | 3300005616 | Bacteria | 3217 |
| 41 | Ga0068852_100163788 | 3300005616 | Bacteria | 2079 |
| 42 | Ga0068864_100528951 | 3300005618 | Bacteria | 1137 |
| 43 | Ga0068866_10193218 | 3300005718 | Bacteria | 1211 |
| 44 | Ga0068861_100067170 | 3300005719 | Bacteria | 2766 |
| 45 | Ga0068863_100565253 | 3300005841 | Bacteria | 1124 |
| 46 | Ga0068860_100426913 | 3300005843 | Bacteria | 1315 |
| 47 | Ga0068862_100000943 | 3300005844 | Bacteria | 28026 |
| 48 | Ga0081455_10022074 | 3300005937 | Bacteria | 5958 |
| 49 | Ga0081455_10058763 | 3300005937 | Bacteria | 3251 |
| 50 | Ga0081538_10002259 | 3300005981 | Bacteria | 19075 |
| 51 | Ga0081538_10016683 | 3300005981 | Bacteria | 5617 |
| 52 | Ga0081538_10022916 | 3300005981 | Bacteria | 4506 |
| 53 | Ga0081538_10042285 | 3300005981 | Bacteria | 2879 |
| 54 | Ga0081538_10045799 | 3300005981 | Bacteria | 2707 |
| 55 | Ga0081538_10069006 | 3300005981 | Bacteria | 1962 |
| 56 | Ga0081538_10070452 | 3300005981 | Bacteria | 1930 |
| 57 | Ga0081540_1027034 | 3300005983 | Bacteria | 3260 |
| 58 | Ga0081539_10112413 | 3300005985 | Bacteria | 1368 |
| 59 | Ga0070717_10362495 | 3300006028 | Bacteria | 1297 |
| 60 | Ga0075365_10048684 | 3300006038 | Bacteria | 2790 |
| 61 | Ga0070712_100360554 | 3300006175 | Bacteria | 1192 |
| 62 | Ga0097621_100127114 | 3300006237 | Bacteria | 2166 |
| 63 | Ga0075433_10221518 | 3300006852 | Bacteria | 1680 |
| 64 | Ga0075434_100240649 | 3300006871 | Bacteria | 1830 |
| 65 | Ga0068865_100228206 | 3300006881 | Bacteria | 1459 |
| 66 | Ga0075435_100277313 | 3300007076 | Bacteria | 1431 |
| 67 | Ga0105240_10330747 | 3300009093 | Bacteria | 1734 |
| 68 | Ga0105240_10433445 | 3300009093 | Bacteria | 1474 |
| 69 | Ga0111539_10369307 | 3300009094 | Bacteria | 1670 |
| 70 | Ga0105245_10212299 | 3300009098 | Bacteria | 1863 |
| 71 | Ga0105245_10416804 | 3300009098 | Bacteria | 1345 |
| 72 | Ga0105245_10498426 | 3300009098 | Bacteria | 1234 |
| 73 | Ga0105241_10166819 | 3300009174 | Bacteria | 1815 |
| 74 | Ga0105242_10446230 | 3300009176 | Bacteria | 1218 |
| 75 | Ga0105237_10076429 | 3300009545 | Bacteria | 3339 |
| 76 | Ga0105249_10072904 | 3300009553 | Bacteria | 3175 |
| 77 | Ga0105249_10437497 | 3300009553 | Bacteria | 1344 |
| 78 | Ga0105239_10595418 | 3300010375 | Bacteria | 1261 |
| 79 | Ga0157370_10130019 | 3300013104 | Bacteria | 2349 |
| 80 | Ga0157374_10000242 | 3300013296 | Bacteria | 50857 |
| 81 | Ga0157374_10003614 | 3300013296 | Bacteria | 13023 |
| 82 | Ga0157374_10266013 | 3300013296 | Bacteria | 1690 |
| 83 | Ga0157378_10069605 | 3300013297 | Bacteria | 3157 |
| 84 | Ga0157378_10354123 | 3300013297 | Bacteria | 1435 |
| 85 | Ga0163162_10432998 | 3300013306 | Bacteria | 1447 |
| 86 | Ga0157372_10225743 | 3300013307 | Bacteria | 2171 |
| 87 | Ga0157375_10305237 | 3300013308 | Bacteria | 1755 |
| 88 | Ga0157375_10481163 | 3300013308 | Bacteria | 1406 |
| 89 | Ga0163163_10136594 | 3300014325 | Bacteria | 2493 |
| 90 | Ga0157377_10204152 | 3300014745 | Bacteria | 1256 |
| 91 | Ga0157379_10095203 | 3300014968 | Bacteria | 2672 |
| 92 | Ga0157376_10392057 | 3300014969 | Bacteria | 1340 |
| 93 | Ga0163161_10249442 | 3300017792 | Bacteria | 1383 |
| 94 | Ga0206356_11216255 | 3300020070 | Bacteria | 1977 |
| 95 | Ga0206354_10781290 | 3300020081 | Bacteria | 2060 |
| 96 | Ga0206353_11177129 | 3300020082 | Bacteria | 3938 |
| 97 | Ga0213876_10109300 | 3300021384 | Bacteria | 1467 |
| 98 | Ga0207642_10039529 | 3300025899 | Bacteria | 2051 |
| 99 | Ga0207688_10006090 | 3300025901 | Bacteria | 6560 |
| 100 | Ga0207705_10313469 | 3300025909 | Bacteria | 1204 |
| 101 | Ga0207695_10455911 | 3300025913 | Bacteria | 1162 |
| 102 | Ga0207671_10000835 | 3300025914 | Bacteria | 39117 |
| 103 | Ga0207663_10249591 | 3300025916 | Bacteria | 1305 |
| 104 | Ga0207663_10319775 | 3300025916 | Bacteria | 1166 |
| 105 | Ga0207660_10178671 | 3300025917 | Bacteria | 1647 |
| 106 | Ga0207657_10111895 | 3300025919 | Bacteria | 2254 |
| 107 | Ga0207657_10157543 | 3300025919 | Bacteria | 1846 |
| 108 | Ga0207652_10288702 | 3300025921 | Bacteria | 1480 |
| 109 | Ga0207681_10124353 | 3300025923 | Bacteria | 1897 |
| 110 | Ga0207650_10373814 | 3300025925 | Bacteria | 1176 |
| 111 | Ga0207659_10427741 | 3300025926 | Bacteria | 1111 |
| 112 | Ga0207687_10339136 | 3300025927 | Bacteria | 1222 |
| 113 | Ga0207687_10350284 | 3300025927 | Bacteria | 1203 |
| 114 | Ga0207664_10039010 | 3300025929 | Bacteria | 3685 |
| 115 | Ga0207644_10105588 | 3300025931 | Bacteria | 2122 |
| 116 | Ga0207690_10294278 | 3300025932 | Bacteria | 1268 |
| 117 | Ga0207706_10038922 | 3300025933 | Bacteria | 4217 |
| 118 | Ga0207670_10040808 | 3300025936 | Bacteria | 3048 |
| 119 | Ga0207669_10098081 | 3300025937 | Bacteria | 1929 |
| 120 | Ga0207689_10363929 | 3300025942 | Bacteria | 1203 |
| 121 | Ga0207661_10440710 | 3300025944 | Bacteria | 1185 |
| 122 | Ga0207667_10130013 | 3300025949 | Bacteria | 2593 |
| 123 | Ga0207651_10368074 | 3300025960 | Bacteria | 1215 |
| 124 | Ga0207712_10011490 | 3300025961 | Bacteria | 5642 |
| 125 | Ga0207712_10360146 | 3300025961 | Bacteria | 1212 |
| 126 | Ga0207668_10248070 | 3300025972 | Bacteria | 1444 |
| 127 | Ga0207668_10311286 | 3300025972 | Bacteria | 1303 |
| 128 | Ga0207640_10039248 | 3300025981 | Bacteria | 2995 |
| 129 | Ga0207677_10451839 | 3300026023 | Bacteria | 1101 |
| 130 | Ga0207639_10413588 | 3300026041 | Bacteria | 1218 |
| 131 | Ga0207678_10271603 | 3300026067 | Bacteria | 1454 |
| 132 | Ga0207708_10009456 | 3300026075 | Bacteria | 7218 |
| 133 | Ga0207702_10422564 | 3300026078 | Bacteria | 1289 |
| 134 | Ga0207702_10567545 | 3300026078 | Bacteria | 1111 |
| 135 | Ga0207648_10385477 | 3300026089 | Bacteria | 1268 |
| 136 | Ga0207674_10369812 | 3300026116 | Bacteria | 1386 |
| 137 | Ga0207675_100109262 | 3300026118 | Bacteria | 2609 |
| 138 | Ga0207683_10444895 | 3300026121 | Bacteria | 1194 |
| 139 | Ga0207698_10582016 | 3300026142 | Bacteria | 1101 |
| 140 | Ga0268266_10022572 | 3300028379 | Bacteria | 5360 |
| 141 | Ga0268265_10001477 | 3300028380 | Bacteria | 19727 |
| 142 | Ga0268265_10236104 | 3300028380 | Bacteria | 1610 |
| 143 | Ga0268264_10002520 | 3300028381 | Bacteria | 16098 |
| 144 | Ga0307408_100254666 | 3300031548 | Bacteria | 1450 |
| 145 | Ga0307405_10384313 | 3300031731 | Bacteria | 1094 |
| 146 | Ga0307413_10371744 | 3300031824 | Bacteria | 1110 |
| 147 | Ga0307413_10388459 | 3300031824 | Bacteria | 1090 |
| 148 | Ga0307413_10457308 | 3300031824 | Bacteria | 1015 |
| 149 | Ga0307410_10291595 | 3300031852 | Bacteria | 1284 |
| 150 | Ga0307410_10349855 | 3300031852 | Bacteria | 1180 |
| 151 | Ga0307406_10062414 | 3300031901 | Bacteria | 2411 |
| 152 | Ga0307406_10257631 | 3300031901 | Bacteria | 1318 |
| 153 | Ga0307406_10263470 | 3300031901 | Bacteria | 1305 |
| 154 | Ga0307407_10238843 | 3300031903 | Bacteria | 1238 |
| 155 | Ga0307409_100333030 | 3300031995 | Bacteria | 1425 |
| 156 | Ga0307409_100440230 | 3300031995 | Bacteria | 1255 |
| 157 | Ga0307409_100551422 | 3300031995 | Bacteria | 1131 |
| 158 | Ga0307409_100568814 | 3300031995 | Bacteria | 1115 |
| 159 | Ga0307416_100220851 | 3300032002 | Bacteria | 1817 |
| 160 | Ga0307416_100686961 | 3300032002 | Bacteria | 1111 |
| 161 | Ga0307414_10360325 | 3300032004 | Bacteria | 1251 |
| 162 | Ga0307415_100206828 | 3300032126 | Bacteria | 1562 |
| 163 | Ga0307415_100365186 | 3300032126 | Bacteria | 1220 |
| 164 | Ga0307415_100382048 | 3300032126 | Bacteria | 1196 |
| 165 | Ga0373943_0155892 | 3300035170 | Bacteria | 1240 |
| 166 | Ga0373935_0177000 | 3300035692 | Bacteria | 1463 |
| 167 | Ga0373927_0288069 | 3300035695 | Bacteria | 1081 |
| 168 | Ga0395899_0156653 | 3300037312 | Bacteria | 1611 |
| 169 | Ga0395900_0283295 | 3300037418 | Bacteria | 1648 |
| 170 | Ga0395898_0250146 | 3300037466 | Bacteria | 1690 |
| 171 | Ga0395905_0460879 | 3300037471 | Bacteria | 1169 |
| 172 | Ga0395901_0078351 | 3300038443 | Bacteria | 3450 |
| 173 | Ga0395901_0363836 | 3300038443 | Bacteria | 1491 |
| 174 | Ga0395901_0582425 | 3300038443 | Bacteria | 1130 |
| 175 | Ga0436365_0208480 | 3300039437 | Bacteria | 1728 |
| 176 | Ga0436365_1505429 | 3300039437 | Unclassified | 1166 |
| 177 | Ga0451807_0176455 | 3300041486 | Bacteria | 1960 |
| 178 | Ga0451853_2236129 | 3300041512 | Bacteria | 1050 |
| 179 | Ga0466963_0237247 | 3300044694 | Bacteria | 1278 |
| 180 | Ga0466963_0245726 | 3300044694 | Bacteria | 1255 |
| 181 | Ga0466964_0015079 | 3300044706 | Bacteria | 2943 |
| 182 | Ga0466964_0073709 | 3300044706 | Bacteria | 1450 |
| 183 | Ga0466967_0233908 | 3300045976 | Bacteria | 1750 |
| 184 | Ga0466967_0403518 | 3300045976 | Bacteria | 1330 |
| 185 | Ga0466967_0452064 | 3300045976 | Bacteria | 1255 |
| 186 | Ga0466967_0488513 | 3300045976 | Bacteria | 1207 |
| 187 | Ga0466967_0625365 | 3300045976 | Bacteria | 1063 |
| 188 | Ga0495592_0063349 | 3300046454 | Bacteria | 2712 |
| 189 | Ga0495603_0044801 | 3300046455 | Bacteria | 2639 |
| 190 | Ga0495603_0276062 | 3300046455 | Bacteria | 966 |
| 191 | Ga0495641_0000001 | 3300046461 | Bacteria | 485224 |
| 192 | Ga0495641_0000050 | 3300046461 | Bacteria | 73259 |
| 193 | Ga0495582_0082903 | 3300046473 | Bacteria | 1782 |
| 194 | Ga0495582_0256180 | 3300046473 | Bacteria | 1004 |
| 195 | Ga0495582_0276756 | 3300046473 | Bacteria | 963 |
| 196 | Ga0495585_0195381 | 3300046492 | Bacteria | 1033 |
| 197 | Ga0495594_0000010 | 3300046499 | Bacteria | 118481 |
| 198 | Ga0495608_0000023 | 3300046511 | Bacteria | 160090 |
| 199 | Ga0495630_0131536 | 3300046517 | Bacteria | 1900 |
| 200 | Ga0495630_0244041 | 3300046517 | Bacteria | 1372 |
| 201 | Ga0495630_0252850 | 3300046517 | Bacteria | 1346 |
| 202 | Ga0495652_0004565 | 3300046529 | Bacteria | 13204 |
| 203 | Ga0495588_0179915 | 3300046674 | Bacteria | 1117 |
| 204 | Ga0495657_0000020 | 3300046675 | Bacteria | 160089 |
| 205 | Ga0495657_0072212 | 3300046675 | Bacteria | 2251 |
| 206 | Ga0495657_0130506 | 3300046675 | Bacteria | 1574 |
| 207 | Ga0495599_0204954 | 3300046678 | Bacteria | 1211 |
| 208 | Ga0495623_0102024 | 3300046679 | Bacteria | 1747 |
| 209 | Ga0495646_0126981 | 3300046680 | Bacteria | 1438 |
| 210 | Ga0495647_0156797 | 3300046681 | Bacteria | 979 |
| 211 | Ga0495669_0092372 | 3300046684 | Bacteria | 1398 |
| 212 | Ga0495613_0000041 | 3300046689 | Bacteria | 130784 |
| 213 | Ga0495613_0009309 | 3300046689 | Bacteria | 7288 |
| 214 | Ga0495613_0100454 | 3300046689 | Bacteria | 2090 |
| 215 | Ga0495670_0018484 | 3300046691 | Bacteria | 3431 |
| 216 | Ga0495649_0001868 | 3300046694 | Bacteria | 15419 |
| 217 | Ga0495581_0247005 | 3300047315 | Bacteria | 1043 |
| 218 | Ga0495676_0000405 | 3300047321 | Bacteria | 34992 |
| 219 | Ga0495676_0010974 | 3300047321 | Bacteria | 8192 |
| 220 | Ga0495676_0379903 | 3300047321 | Bacteria | 940 |
| 221 | Ga0495675_0000103 | 3300047444 | Bacteria | 61353 |
| 222 | Ga0495593_0005560 | 3300047673 | Bacteria | 7446 |
| 223 | Ga0496100_0025323 | 3300048903 | Bacteria | 3628 |
| 224 | Ga0496102_0397205 | 3300048905 | Bacteria | 1296 |
| 225 | Ga0496103_0046629 | 3300048906 | Bacteria | 2676 |
| 226 | Ga0496103_0211421 | 3300048906 | Bacteria | 1247 |
| 227 | Ga0496104_0058958 | 3300048907 | Bacteria | 3634 |
| 228 | Ga0496105_0221192 | 3300048908 | Bacteria | 1541 |
| 229 | Ga0496105_0332918 | 3300048908 | Bacteria | 1215 |
| 230 | Ga0496105_0370807 | 3300048908 | Bacteria | 1140 |
| 231 | Ga0496106_0000081 | 3300048909 | Bacteria | 76468 |
| 232 | Ga0496106_0000096 | 3300048909 | Bacteria | 67122 |
| 233 | Ga0496107_0015317 | 3300048910 | Bacteria | 5373 |
| 234 | Ga0496107_0022053 | 3300048910 | Bacteria | 4499 |
| 235 | Ga0496107_0289329 | 3300048910 | Bacteria | 1219 |
| 236 | Ga0496108_0000006 | 3300048911 | Bacteria | 469473 |
| 237 | Ga0496108_0460801 | 3300048911 | Bacteria | 1110 |
| 238 | Ga0496109_0000009 | 3300048912 | Bacteria | 236561 |
| 239 | Ga0496109_0440458 | 3300048912 | Bacteria | 1231 |
| 240 | Ga0496110_0226886 | 3300048913 | Bacteria | 1698 |
| 241 | Ga0496112_0411967 | 3300048915 | Bacteria | 1290 |
| 242 | Ga0496115_0389896 | 3300048918 | Bacteria | 1131 |
| 243 | Ga0496125_0066890 | 3300048928 | Bacteria | 2836 |
| 244 | Ga0501033_0188547 | 3300049570 | Bacteria | 1476 |
| 245 | Ga0501036_0322978 | 3300049572 | Bacteria | 1289 |
| 246 | Ga0501038_0199520 | 3300049574 | Bacteria | 1606 |
| 247 | Ga0501039_0011025 | 3300049575 | Bacteria | 6886 |
| 248 | Ga0501039_0061135 | 3300049575 | Bacteria | 2917 |
| 249 | Ga0501040_0153860 | 3300049576 | Bacteria | 1623 |
| 250 | Ga0501040_0360087 | 3300049576 | Unclassified | 1042 |
| 251 | Ga0501041_0218375 | 3300049577 | Bacteria | 1196 |
| 252 | Ga0501042_0346297 | 3300049578 | Bacteria | 1074 |
| 253 | Ga0501042_0379385 | 3300049578 | Bacteria | 1023 |
| 254 | Ga0501046_0295938 | 3300049580 | Unclassified | 1183 |
| 255 | Ga0501046_0310808 | 3300049580 | Bacteria | 1149 |
| 256 | Ga0501068_0045368 | 3300049584 | Unclassified | 2648 |
| 257 | Ga0501068_0242833 | 3300049584 | Bacteria | 1146 |
| 258 | Ga0501068_0282183 | 3300049584 | Bacteria | 1061 |
| 259 | Ga0501069_0140524 | 3300049585 | Bacteria | 1385 |
| 260 | Ga0501069_0221170 | 3300049585 | Bacteria | 1100 |
| 261 | Ga0501069_0271039 | 3300049585 | Unclassified | 992 |
| 262 | Ga0501071_0044094 | 3300049587 | Bacteria | 3199 |
| 263 | Ga0501071_0141527 | 3300049587 | Bacteria | 1791 |
| 264 | Ga0501072_0201815 | 3300049588 | Unclassified | 1585 |
| 265 | Ga0501072_0248830 | 3300049588 | Bacteria | 1415 |
| 266 | Ga0501074_0148326 | 3300049590 | Bacteria | 1677 |
| 267 | Ga0501075_0084251 | 3300049591 | Bacteria | 2407 |
| 268 | Ga0501075_0226292 | 3300049591 | Unclassified | 1426 |
| 269 | Ga0501076_0049199 | 3300049592 | Bacteria | 3333 |
| 270 | Ga0501076_0094548 | 3300049592 | Bacteria | 2406 |
| 271 | Ga0501077_0116350 | 3300049593 | Bacteria | 1694 |
| 272 | Ga0501079_0060630 | 3300049741 | Bacteria | 2918 |
| 273 | Ga0501079_0232369 | 3300049741 | Bacteria | 1440 |
| 274 | Ga0501080_0285212 | 3300049742 | Unclassified | 1500 |
| 275 | Ga0501080_0435632 | 3300049742 | Bacteria | 1176 |
| 276 | Ga0501081_0157933 | 3300049743 | Bacteria | 1632 |
| 277 | Ga0501081_0337605 | 3300049743 | Bacteria | 1109 |
| 278 | Ga0501081_0350743 | 3300049743 | Unclassified | 1087 |
| 279 | Ga0501083_0078443 | 3300049744 | Bacteria | 2191 |
| 280 | Ga0501083_0255733 | 3300049744 | Unclassified | 1140 |
| 281 | Ga0501035_0286141 | 3300049822 | Unclassified | 1392 |
| 282 | Ga0501035_0341096 | 3300049822 | Bacteria | 1255 |
| 283 | Ga0501035_0433775 | 3300049822 | Bacteria | 1089 |
| 284 | Ga0501044_0395462 | 3300049823 | Bacteria | 1295 |
| 285 | Ga0501045_0159191 | 3300049824 | Bacteria | 1680 |
| 286 | nmdc:mga08y16_60545_c1 | 3300050511 | Bacteria | 3954 |
| 287 | nmdc:mga0n895_476086_c1 | 3300050512 | Bacteria | 1260 |
| 288 | nmdc:mga0rr50_177814_c1 | 3300050513 | Bacteria | 1738 |
| 289 | nmdc:mga0a205_253187_c1 | 3300050515 | Bacteria | 1640 |
| 290 | Ga0495612_0089916 | 3300053078 | Bacteria | 1298 |
| 291 | Ga0495612_0109785 | 3300053078 | Bacteria | 1179 |
| 292 | Ga0495595_0000022 | 3300053084 | Bacteria | 110598 |
| 293 | Ga0495619_0000070 | 3300053085 | Bacteria | 80588 |
| 294 | Ga0495619_0000152 | 3300053085 | Bacteria | 51090 |
| 295 | Ga0495619_0092426 | 3300053085 | Bacteria | 2049 |
| 296 | Ga0495619_0161742 | 3300053085 | Bacteria | 1546 |
| 297 | Ga0500595_015177 | 3300053119 | Bacteria | 2895 |
| 298 | Ga0501084_0134875 | 3300054114 | Unclassified | 2078 |
| 299 | Ga0501084_0172863 | 3300054114 | Bacteria | 1823 |
| 300 | Ga0590075_027413 | 3300059424 | Bacteria | 1437 |
| 301 | Ga0501082_0116551 | 3300060353 | Bacteria | 2313 |
| 302 | Ga0501082_0240534 | 3300060353 | Unclassified | 1575 |
| 303 | Ga0530510_0174087 | 3300061734 | Bacteria | 1594 |
| 304 | Ga0530510_0307159 | 3300061734 | Unclassified | 1187 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047321 | Ga0495676_0379903 | Ga0495676_0379903_95_895 | 257 |
| 2 | 3300044694 | Ga0466963_0237247 | Ga0466963_0237247_263_1171 | 258 |
| 3 | 3300045976 | Ga0466967_0233908 | Ga0466967_0233908_616_1524 | 258 |
| 4 | 3300005983 | Ga0081540_1027034 | Ga0081540_10270342 | 261 |
| 5 | 3300005618 | Ga0068864_100528951 | Ga0068864_1005289512 | 265 |
| 6 | 3300005981 | Ga0081538_10069006 | Ga0081538_100690061 | 266 |
| 7 | 3300046473 | Ga0495582_0256180 | Ga0495582_0256180_89_922 | 266 |
| 8 | 3300047321 | Ga0495676_0010974 | Ga0495676_0010974_921_1754 | 275 |
| 9 | 3300046473 | Ga0495582_0276756 | Ga0495582_0276756_81_947 | 279 |
| 10 | 3300049575 | Ga0501039_0011025 | Ga0501039_0011025_150_1058 | 283 |
| 11 | 3300049576 | Ga0501040_0360087 | Ga0501040_0360087_53_961 | 283 |
| 12 | 3300049580 | Ga0501046_0295938 | Ga0501046_0295938_60_968 | 283 |
| 13 | 3300049584 | Ga0501068_0045368 | Ga0501068_0045368_217_1125 | 283 |
| 14 | 3300049585 | Ga0501069_0271039 | Ga0501069_0271039_35_943 | 283 |
| 15 | 3300049587 | Ga0501071_0044094 | Ga0501071_0044094_1898_2806 | 283 |
| 16 | 3300049588 | Ga0501072_0201815 | Ga0501072_0201815_480_1388 | 283 |
| 17 | 3300049591 | Ga0501075_0226292 | Ga0501075_0226292_502_1410 | 283 |
| 18 | 3300049592 | Ga0501076_0049199 | Ga0501076_0049199_213_1121 | 283 |
| 19 | 3300049741 | Ga0501079_0060630 | Ga0501079_0060630_1049_1957 | 283 |
| 20 | 3300049742 | Ga0501080_0285212 | Ga0501080_0285212_408_1316 | 283 |
| 21 | 3300049743 | Ga0501081_0350743 | Ga0501081_0350743_166_1074 | 283 |
| 22 | 3300049744 | Ga0501083_0255733 | Ga0501083_0255733_188_1096 | 283 |
| 23 | 3300049822 | Ga0501035_0286141 | Ga0501035_0286141_350_1258 | 283 |
| 24 | 3300054114 | Ga0501084_0134875 | Ga0501084_0134875_878_1786 | 283 |
| 25 | 3300060353 | Ga0501082_0240534 | Ga0501082_0240534_639_1547 | 283 |
| 26 | 3300061734 | Ga0530510_0307159 | Ga0530510_0307159_71_979 | 283 |
| 27 | 3300045976 | Ga0466967_0403518 | Ga0466967_0403518_385_1269 | 285 |
| 28 | 3300035170 | Ga0373943_0155892 | Ga0373943_0155892_100_987 | 286 |
| 29 | 3300035692 | Ga0373935_0177000 | Ga0373935_0177000_75_962 | 286 |
| 30 | 3300035695 | Ga0373927_0288069 | Ga0373927_0288069_124_1011 | 286 |
| 31 | 3300046681 | Ga0495647_0156797 | Ga0495647_0156797_63_950 | 286 |
| 32 | 3300046689 | Ga0495613_0100454 | Ga0495613_0100454_1101_1988 | 286 |
| 33 | 3300047315 | Ga0495581_0247005 | Ga0495581_0247005_123_1010 | 286 |
| 34 | 3300005466 | Ga0070685_10037243 | Ga0070685_100372432 | 288 |
| 35 | 3300005535 | Ga0070684_100514982 | Ga0070684_1005149821 | 288 |
| 36 | 3300005577 | Ga0068857_100424061 | Ga0068857_1004240612 | 288 |
| 37 | 3300005981 | Ga0081538_10070452 | Ga0081538_100704521 | 288 |
| 38 | 3300006881 | Ga0068865_100228206 | Ga0068865_1002282062 | 288 |
| 39 | 3300013296 | Ga0157374_10266013 | Ga0157374_102660132 | 288 |
| 40 | 3300026116 | Ga0207674_10369812 | Ga0207674_103698122 | 288 |
| 41 | 3300049585 | Ga0501069_0140524 | Ga0501069_0140524_243_1148 | 290 |
| 42 | 3300046517 | Ga0495630_0252850 | Ga0495630_0252850_270_1238 | 291 |
| 43 | 3300049585 | Ga0501069_0221170 | Ga0501069_0221170_108_1076 | 291 |
| 44 | 3300026041 | Ga0207639_10413588 | Ga0207639_104135881 | 292 |
| 45 | 3300046473 | Ga0495582_0082903 | Ga0495582_0082903_701_1669 | 292 |
| 46 | 3300005336 | Ga0070680_100157290 | Ga0070680_1001572902 | 294 |
| 47 | 3300005339 | Ga0070660_100115272 | Ga0070660_1001152723 | 294 |
| 48 | 3300005344 | Ga0070661_100263728 | Ga0070661_1002637282 | 294 |
| 49 | 3300005458 | Ga0070681_10211904 | Ga0070681_102119042 | 294 |
| 50 | 3300005563 | Ga0068855_100119334 | Ga0068855_1001193343 | 294 |
| 51 | 3300005616 | Ga0068852_100063418 | Ga0068852_1000634182 | 294 |
| 52 | 3300013104 | Ga0157370_10130019 | Ga0157370_101300193 | 294 |
| 53 | 3300020081 | Ga0206354_10781290 | Ga0206354_107812902 | 294 |
| 54 | 3300020082 | Ga0206353_11177129 | Ga0206353_111771291 | 294 |
| 55 | 3300025917 | Ga0207660_10178671 | Ga0207660_101786711 | 294 |
| 56 | 3300025919 | Ga0207657_10157543 | Ga0207657_101575432 | 294 |
| 57 | 3300025921 | Ga0207652_10288702 | Ga0207652_102887022 | 294 |
| 58 | 3300025932 | Ga0207690_10294278 | Ga0207690_102942781 | 294 |
| 59 | 3300025949 | Ga0207667_10130013 | Ga0207667_101300132 | 294 |
| 60 | 3300037312 | Ga0395899_0156653 | Ga0395899_0156653_198_1133 | 295 |
| 61 | 3300037418 | Ga0395900_0283295 | Ga0395900_0283295_489_1424 | 295 |
| 62 | 3300037466 | Ga0395898_0250146 | Ga0395898_0250146_108_1043 | 295 |
| 63 | 3300037471 | Ga0395905_0460879 | Ga0395905_0460879_145_1080 | 295 |
| 64 | 3300038443 | Ga0395901_0078351 | Ga0395901_0078351_18_953 | 295 |
| 65 | 3300009093 | Ga0105240_10433445 | Ga0105240_104334452 | 296 |
| 66 | 3300014969 | Ga0157376_10392057 | Ga0157376_103920571 | 296 |
| 67 | 3300046492 | Ga0495585_0195381 | Ga0495585_0195381_43_1008 | 296 |
| 68 | 3300005981 | Ga0081538_10045799 | Ga0081538_100457991 | 297 |
| 69 | 3300047321 | Ga0495676_0000405 | Ga0495676_0000405_2557_3489 | 299 |
| 70 | 3300013296 | Ga0157374_10000242 | Ga0157374_100002428 | 300 |
| 71 | 3300046455 | Ga0495603_0276062 | Ga0495603_0276062_14_952 | 300 |
| 72 | 3300046529 | Ga0495652_0004565 | Ga0495652_0004565_4181_5155 | 300 |
| 73 | 3300046675 | Ga0495657_0130506 | Ga0495657_0130506_461_1426 | 300 |
| 74 | 3300046678 | Ga0495599_0204954 | Ga0495599_0204954_132_1106 | 300 |
| 75 | 3300046680 | Ga0495646_0126981 | Ga0495646_0126981_187_1161 | 300 |
| 76 | 3300048906 | Ga0496103_0211421 | Ga0496103_0211421_209_1177 | 300 |
| 77 | 3300005937 | Ga0081455_10022074 | Ga0081455_100220745 | 301 |
| 78 | 3300021384 | Ga0213876_10109300 | Ga0213876_101093002 | 301 |
| 79 | 3300039437 | Ga0436365_0208480 | Ga0436365_0208480_401_1375 | 301 |
| 80 | 3300048911 | Ga0496108_0000006 | Ga0496108_0000006_339075_339992 | 301 |
| 81 | 3300048912 | Ga0496109_0000009 | Ga0496109_0000009_106163_107080 | 301 |
| 82 | 3300048928 | Ga0496125_0066890 | Ga0496125_0066890_38_955 | 301 |
| 83 | 3300049584 | Ga0501068_0242833 | Ga0501068_0242833_31_996 | 301 |
| 84 | 3300049822 | Ga0501035_0341096 | Ga0501035_0341096_154_1119 | 301 |
| 85 | 3300053119 | Ga0500595_015177 | Ga0500595_015177_855_1826 | 301 |
| 86 | 3300031995 | Ga0307409_100568814 | Ga0307409_1005688141 | 302 |
| 87 | 3300049578 | Ga0501042_0379385 | Ga0501042_0379385_44_1012 | 303 |
| 88 | 3300005981 | Ga0081538_10022916 | Ga0081538_100229162 | 305 |
| 89 | 3300013308 | Ga0157375_10305237 | Ga0157375_103052372 | 305 |
| 90 | 3300049743 | Ga0501081_0337605 | Ga0501081_0337605_134_1090 | 305 |
| 91 | 3300005981 | Ga0081538_10002259 | Ga0081538_100022592 | 306 |
| 92 | 3300005337 | Ga0070682_100045637 | Ga0070682_1000456372 | 307 |
| 93 | 3300005981 | Ga0081538_10016683 | Ga0081538_100166836 | 307 |
| 94 | 3300006028 | Ga0070717_10362495 | Ga0070717_103624952 | 307 |
| 95 | 3300006237 | Ga0097621_100127114 | Ga0097621_1001271142 | 307 |
| 96 | 3300025936 | Ga0207670_10040808 | Ga0207670_100408083 | 307 |
| 97 | 3300041486 | Ga0451807_0176455 | Ga0451807_0176455_72_1022 | 307 |
| 98 | 3300046461 | Ga0495641_0000001 | Ga0495641_0000001_232057_233007 | 307 |
| 99 | 3300046499 | Ga0495594_0000010 | Ga0495594_0000010_97_1047 | 307 |
| 100 | 3300046511 | Ga0495608_0000023 | Ga0495608_0000023_77905_78855 | 307 |
| 101 | 3300046675 | Ga0495657_0000020 | Ga0495657_0000020_77905_78855 | 307 |
| 102 | 3300046679 | Ga0495623_0102024 | Ga0495623_0102024_308_1258 | 307 |
| 103 | 3300046689 | Ga0495613_0000041 | Ga0495613_0000041_51149_52099 | 307 |
| 104 | 3300047444 | Ga0495675_0000103 | Ga0495675_0000103_31731_32681 | 307 |
| 105 | 3300047673 | Ga0495593_0005560 | Ga0495593_0005560_5103_6053 | 307 |
| 106 | 3300053084 | Ga0495595_0000022 | Ga0495595_0000022_31744_32694 | 307 |
| 107 | 3300053085 | Ga0495619_0000070 | Ga0495619_0000070_31683_32633 | 307 |
| 108 | 3300053085 | Ga0495619_0000152 | Ga0495619_0000152_29928_30878 | 307 |
| 109 | 3300005329 | Ga0070683_100029594 | Ga0070683_1000295945 | 308 |
| 110 | 3300005334 | Ga0068869_100121429 | Ga0068869_1001214292 | 308 |
| 111 | 3300005337 | Ga0070682_100293457 | Ga0070682_1002934571 | 308 |
| 112 | 3300005339 | Ga0070660_100310612 | Ga0070660_1003106122 | 308 |
| 113 | 3300005340 | Ga0070689_100150008 | Ga0070689_1001500082 | 308 |
| 114 | 3300005347 | Ga0070668_100231259 | Ga0070668_1002312592 | 308 |
| 115 | 3300005354 | Ga0070675_100124184 | Ga0070675_1001241842 | 308 |
| 116 | 3300005355 | Ga0070671_100116687 | Ga0070671_1001166871 | 308 |
| 117 | 3300005356 | Ga0070674_100130555 | Ga0070674_1001305551 | 308 |
| 118 | 3300005366 | Ga0070659_100217343 | Ga0070659_1002173431 | 308 |
| 119 | 3300005439 | Ga0070711_100129976 | Ga0070711_1001299762 | 308 |
| 120 | 3300005441 | Ga0070700_100267591 | Ga0070700_1002675911 | 308 |
| 121 | 3300005455 | Ga0070663_100186379 | Ga0070663_1001863792 | 308 |
| 122 | 3300005456 | Ga0070678_100135626 | Ga0070678_1001356261 | 308 |
| 123 | 3300005459 | Ga0068867_100314758 | Ga0068867_1003147582 | 308 |
| 124 | 3300005543 | Ga0070672_100427797 | Ga0070672_1004277971 | 308 |
| 125 | 3300005547 | Ga0070693_100241604 | Ga0070693_1002416041 | 308 |
| 126 | 3300005564 | Ga0070664_100354903 | Ga0070664_1003549032 | 308 |
| 127 | 3300005578 | Ga0068854_100103571 | Ga0068854_1001035711 | 308 |
| 128 | 3300005615 | Ga0070702_100296688 | Ga0070702_1002966881 | 308 |
| 129 | 3300005616 | Ga0068852_100163788 | Ga0068852_1001637881 | 308 |
| 130 | 3300005718 | Ga0068866_10193218 | Ga0068866_101932182 | 308 |
| 131 | 3300005719 | Ga0068861_100067170 | Ga0068861_1000671703 | 308 |
| 132 | 3300005841 | Ga0068863_100565253 | Ga0068863_1005652531 | 308 |
| 133 | 3300006852 | Ga0075433_10221518 | Ga0075433_102215181 | 308 |
| 134 | 3300006871 | Ga0075434_100240649 | Ga0075434_1002406492 | 308 |
| 135 | 3300007076 | Ga0075435_100277313 | Ga0075435_1002773132 | 308 |
| 136 | 3300009093 | Ga0105240_10330747 | Ga0105240_103307472 | 308 |
| 137 | 3300009094 | Ga0111539_10369307 | Ga0111539_103693072 | 308 |
| 138 | 3300009098 | Ga0105245_10416804 | Ga0105245_104168041 | 308 |
| 139 | 3300009174 | Ga0105241_10166819 | Ga0105241_101668192 | 308 |
| 140 | 3300009176 | Ga0105242_10446230 | Ga0105242_104462301 | 308 |
| 141 | 3300009545 | Ga0105237_10076429 | Ga0105237_100764292 | 308 |
| 142 | 3300009553 | Ga0105249_10437497 | Ga0105249_104374972 | 308 |
| 143 | 3300010375 | Ga0105239_10595418 | Ga0105239_105954181 | 308 |
| 144 | 3300013297 | Ga0157378_10354123 | Ga0157378_103541232 | 308 |
| 145 | 3300013306 | Ga0163162_10432998 | Ga0163162_104329982 | 308 |
| 146 | 3300013307 | Ga0157372_10225743 | Ga0157372_102257431 | 308 |
| 147 | 3300013308 | Ga0157375_10481163 | Ga0157375_104811632 | 308 |
| 148 | 3300014325 | Ga0163163_10136594 | Ga0163163_101365942 | 308 |
| 149 | 3300014745 | Ga0157377_10204152 | Ga0157377_102041521 | 308 |
| 150 | 3300014968 | Ga0157379_10095203 | Ga0157379_100952033 | 308 |
| 151 | 3300017792 | Ga0163161_10249442 | Ga0163161_102494421 | 308 |
| 152 | 3300025899 | Ga0207642_10039529 | Ga0207642_100395292 | 308 |
| 153 | 3300025901 | Ga0207688_10006090 | Ga0207688_100060908 | 308 |
| 154 | 3300025916 | Ga0207663_10249591 | Ga0207663_102495912 | 308 |
| 155 | 3300025919 | Ga0207657_10111895 | Ga0207657_101118952 | 308 |
| 156 | 3300025926 | Ga0207659_10427741 | Ga0207659_104277411 | 308 |
| 157 | 3300025927 | Ga0207687_10339136 | Ga0207687_103391361 | 308 |
| 158 | 3300025931 | Ga0207644_10105588 | Ga0207644_101055883 | 308 |
| 159 | 3300025933 | Ga0207706_10038922 | Ga0207706_100389225 | 308 |
| 160 | 3300025937 | Ga0207669_10098081 | Ga0207669_100980813 | 308 |
| 161 | 3300025942 | Ga0207689_10363929 | Ga0207689_103639292 | 308 |
| 162 | 3300025944 | Ga0207661_10440710 | Ga0207661_104407102 | 308 |
| 163 | 3300025960 | Ga0207651_10368074 | Ga0207651_103680741 | 308 |
| 164 | 3300025961 | Ga0207712_10360146 | Ga0207712_103601461 | 308 |
| 165 | 3300025972 | Ga0207668_10248070 | Ga0207668_102480702 | 308 |
| 166 | 3300025981 | Ga0207640_10039248 | Ga0207640_100392481 | 308 |
| 167 | 3300026023 | Ga0207677_10451839 | Ga0207677_104518391 | 308 |
| 168 | 3300026067 | Ga0207678_10271603 | Ga0207678_102716032 | 308 |
| 169 | 3300026075 | Ga0207708_10009456 | Ga0207708_100094568 | 308 |
| 170 | 3300026078 | Ga0207702_10567545 | Ga0207702_105675451 | 308 |
| 171 | 3300026089 | Ga0207648_10385477 | Ga0207648_103854772 | 308 |
| 172 | 3300026118 | Ga0207675_100109262 | Ga0207675_1001092622 | 308 |
| 173 | 3300026121 | Ga0207683_10444895 | Ga0207683_104448951 | 308 |
| 174 | 3300026142 | Ga0207698_10582016 | Ga0207698_105820161 | 308 |
| 175 | 3300028380 | Ga0268265_10236104 | Ga0268265_102361041 | 308 |
| 176 | 3300031548 | Ga0307408_100254666 | Ga0307408_1002546661 | 308 |
| 177 | 3300048903 | Ga0496100_0025323 | Ga0496100_0025323_114_1082 | 308 |
| 178 | 3300048905 | Ga0496102_0397205 | Ga0496102_0397205_160_1128 | 308 |
| 179 | 3300048906 | Ga0496103_0046629 | Ga0496103_0046629_373_1341 | 308 |
| 180 | 3300048907 | Ga0496104_0058958 | Ga0496104_0058958_2482_3450 | 308 |
| 181 | 3300048908 | Ga0496105_0370807 | Ga0496105_0370807_61_1029 | 308 |
| 182 | 3300048910 | Ga0496107_0289329 | Ga0496107_0289329_168_1136 | 308 |
| 183 | 3300048911 | Ga0496108_0460801 | Ga0496108_0460801_30_998 | 308 |
| 184 | 3300048913 | Ga0496110_0226886 | Ga0496110_0226886_25_993 | 308 |
| 185 | 3300048915 | Ga0496112_0411967 | Ga0496112_0411967_122_1090 | 308 |
| 186 | 3300048918 | Ga0496115_0389896 | Ga0496115_0389896_89_1057 | 308 |
| 187 | 3300050511 | nmdc:mga08y16_60545_c1 | nmdc:mga08y16_60545_c1_2859_3827 | 308 |
| 188 | 3300050512 | nmdc:mga0n895_476086_c1 | nmdc:mga0n895_476086_c1_171_1139 | 308 |
| 189 | 3300050513 | nmdc:mga0rr50_177814_c1 | nmdc:mga0rr50_177814_c1_242_1210 | 308 |
| 190 | 3300050515 | nmdc:mga0a205_253187_c1 | nmdc:mga0a205_253187_c1_547_1515 | 308 |
| 191 | 3300031995 | Ga0307409_100333030 | Ga0307409_1003330302 | 310 |
| 192 | 3300045976 | Ga0466967_0488513 | Ga0466967_0488513_79_1035 | 310 |
| 193 | 3300046455 | Ga0495603_0044801 | Ga0495603_0044801_1611_2552 | 310 |
| 194 | 3300046517 | Ga0495630_0131536 | Ga0495630_0131536_171_1112 | 310 |
| 195 | 3300009098 | Ga0105245_10212299 | Ga0105245_102122992 | 311 |
| 196 | 3300025909 | Ga0207705_10313469 | Ga0207705_103134691 | 311 |
| 197 | 3300025927 | Ga0207687_10350284 | Ga0207687_103502841 | 311 |
| 198 | 3300038443 | Ga0395901_0582425 | Ga0395901_0582425_20_985 | 311 |
| 199 | 3300044706 | Ga0466964_0015079 | Ga0466964_0015079_53_1021 | 311 |
| 200 | 3300044706 | Ga0466964_0073709 | Ga0466964_0073709_251_1219 | 311 |
| 201 | 3300045976 | Ga0466967_0452064 | Ga0466967_0452064_106_1074 | 311 |
| 202 | 3300059424 | Ga0590075_027413 | Ga0590075_027413_111_1079 | 311 |
| 203 | 3300032126 | Ga0307415_100382048 | Ga0307415_1003820482 | 312 |
| 204 | 3300046517 | Ga0495630_0244041 | Ga0495630_0244041_165_1310 | 312 |
| 205 | 3300046675 | Ga0495657_0072212 | Ga0495657_0072212_100_1074 | 312 |
| 206 | 3300053078 | Ga0495612_0089916 | Ga0495612_0089916_272_1246 | 312 |
| 207 | 3300053085 | Ga0495619_0092426 | Ga0495619_0092426_325_1299 | 312 |
| 208 | 3300005614 | Ga0068856_100493659 | Ga0068856_1004936591 | 313 |
| 209 | 3300026078 | Ga0207702_10422564 | Ga0207702_104225641 | 313 |
| 210 | 3300046674 | Ga0495588_0179915 | Ga0495588_0179915_18_986 | 313 |
| 211 | 3300005467 | Ga0070706_100205584 | Ga0070706_1002055842 | 314 |
| 212 | 3300031824 | Ga0307413_10388459 | Ga0307413_103884591 | 314 |
| 213 | 3300044694 | Ga0466963_0245726 | Ga0466963_0245726_206_1180 | 314 |
| 214 | 3300006175 | Ga0070712_100360554 | Ga0070712_1003605541 | 315 |
| 215 | 3300046689 | Ga0495613_0009309 | Ga0495613_0009309_1079_2032 | 315 |
| 216 | 3300049823 | Ga0501044_0395462 | Ga0501044_0395462_280_1233 | 315 |
| 217 | 3300005331 | Ga0070670_100336730 | Ga0070670_1003367301 | 316 |
| 218 | 3300005347 | Ga0070668_100359893 | Ga0070668_1003598931 | 316 |
| 219 | 3300005353 | Ga0070669_100217736 | Ga0070669_1002177361 | 316 |
| 220 | 3300005367 | Ga0070667_100001181 | Ga0070667_10000118116 | 316 |
| 221 | 3300005548 | Ga0070665_100344875 | Ga0070665_1003448751 | 316 |
| 222 | 3300005843 | Ga0068860_100426913 | Ga0068860_1004269132 | 316 |
| 223 | 3300005844 | Ga0068862_100000943 | Ga0068862_10000094321 | 316 |
| 224 | 3300009553 | Ga0105249_10072904 | Ga0105249_100729044 | 316 |
| 225 | 3300013296 | Ga0157374_10003614 | Ga0157374_100036145 | 316 |
| 226 | 3300013297 | Ga0157378_10069605 | Ga0157378_100696051 | 316 |
| 227 | 3300020070 | Ga0206356_11216255 | Ga0206356_112162552 | 316 |
| 228 | 3300025923 | Ga0207681_10124353 | Ga0207681_101243532 | 316 |
| 229 | 3300025929 | Ga0207664_10039010 | Ga0207664_100390102 | 316 |
| 230 | 3300025961 | Ga0207712_10011490 | Ga0207712_100114902 | 316 |
| 231 | 3300025972 | Ga0207668_10311286 | Ga0207668_103112861 | 316 |
| 232 | 3300028379 | Ga0268266_10022572 | Ga0268266_100225722 | 316 |
| 233 | 3300028380 | Ga0268265_10001477 | Ga0268265_100014776 | 316 |
| 234 | 3300041512 | Ga0451853_2236129 | Ga0451853_2236129_11_967 | 316 |
| 235 | 3300046461 | Ga0495641_0000050 | Ga0495641_0000050_2633_3604 | 316 |
| 236 | 3300046684 | Ga0495669_0092372 | Ga0495669_0092372_409_1380 | 316 |
| 237 | 3300046691 | Ga0495670_0018484 | Ga0495670_0018484_1008_1979 | 316 |
| 238 | 3300046694 | Ga0495649_0001868 | Ga0495649_0001868_5094_6065 | 316 |
| 239 | 3300048909 | Ga0496106_0000081 | Ga0496106_0000081_32900_33862 | 316 |
| 240 | 3300048909 | Ga0496106_0000096 | Ga0496106_0000096_66090_67058 | 316 |
| 241 | 3300048910 | Ga0496107_0015317 | Ga0496107_0015317_3326_4294 | 316 |
| 242 | 3300048910 | Ga0496107_0022053 | Ga0496107_0022053_1452_2414 | 316 |
| 243 | 3300005439 | Ga0070711_100171278 | Ga0070711_1001712782 | 317 |
| 244 | 3300005937 | Ga0081455_10058763 | Ga0081455_100587632 | 317 |
| 245 | 3300006038 | Ga0075365_10048684 | Ga0075365_100486843 | 317 |
| 246 | 3300009098 | Ga0105245_10498426 | Ga0105245_104984261 | 317 |
| 247 | 3300025913 | Ga0207695_10455911 | Ga0207695_104559111 | 317 |
| 248 | 3300025914 | Ga0207671_10000835 | Ga0207671_1000083535 | 317 |
| 249 | 3300025916 | Ga0207663_10319775 | Ga0207663_103197752 | 317 |
| 250 | 3300025925 | Ga0207650_10373814 | Ga0207650_103738142 | 317 |
| 251 | 3300028381 | Ga0268264_10002520 | Ga0268264_100025206 | 317 |
| 252 | 3300031824 | Ga0307413_10371744 | Ga0307413_103717441 | 317 |
| 253 | 3300031852 | Ga0307410_10349855 | Ga0307410_103498551 | 317 |
| 254 | 3300031901 | Ga0307406_10263470 | Ga0307406_102634701 | 317 |
| 255 | 3300031903 | Ga0307407_10238843 | Ga0307407_102388431 | 317 |
| 256 | 3300031995 | Ga0307409_100551422 | Ga0307409_1005514221 | 317 |
| 257 | 3300032002 | Ga0307416_100686961 | Ga0307416_1006869611 | 317 |
| 258 | 3300032126 | Ga0307415_100365186 | Ga0307415_1003651861 | 317 |
| 259 | 3300038443 | Ga0395901_0363836 | Ga0395901_0363836_154_1137 | 317 |
| 260 | 3300039437 | Ga0436365_1505429 | Ga0436365_1505429_89_1069 | 317 |
| 261 | 3300045976 | Ga0466967_0625365 | Ga0466967_0625365_11_982 | 317 |
| 262 | 3300046454 | Ga0495592_0063349 | Ga0495592_0063349_985_1950 | 317 |
| 263 | 3300048908 | Ga0496105_0221192 | Ga0496105_0221192_486_1454 | 317 |
| 264 | 3300048908 | Ga0496105_0332918 | Ga0496105_0332918_141_1121 | 317 |
| 265 | 3300048912 | Ga0496109_0440458 | Ga0496109_0440458_212_1192 | 317 |
| 266 | 3300049570 | Ga0501033_0188547 | Ga0501033_0188547_423_1388 | 317 |
| 267 | 3300049572 | Ga0501036_0322978 | Ga0501036_0322978_126_1091 | 317 |
| 268 | 3300049574 | Ga0501038_0199520 | Ga0501038_0199520_322_1287 | 317 |
| 269 | 3300049575 | Ga0501039_0061135 | Ga0501039_0061135_207_1172 | 317 |
| 270 | 3300049576 | Ga0501040_0153860 | Ga0501040_0153860_627_1592 | 317 |
| 271 | 3300049577 | Ga0501041_0218375 | Ga0501041_0218375_92_1057 | 317 |
| 272 | 3300049578 | Ga0501042_0346297 | Ga0501042_0346297_30_995 | 317 |
| 273 | 3300049580 | Ga0501046_0310808 | Ga0501046_0310808_167_1132 | 317 |
| 274 | 3300049584 | Ga0501068_0282183 | Ga0501068_0282183_68_1033 | 317 |
| 275 | 3300049587 | Ga0501071_0141527 | Ga0501071_0141527_437_1402 | 317 |
| 276 | 3300049588 | Ga0501072_0248830 | Ga0501072_0248830_136_1101 | 317 |
| 277 | 3300049590 | Ga0501074_0148326 | Ga0501074_0148326_38_1003 | 317 |
| 278 | 3300049591 | Ga0501075_0084251 | Ga0501075_0084251_734_1699 | 317 |
| 279 | 3300049592 | Ga0501076_0094548 | Ga0501076_0094548_979_1944 | 317 |
| 280 | 3300049593 | Ga0501077_0116350 | Ga0501077_0116350_600_1565 | 317 |
| 281 | 3300049741 | Ga0501079_0232369 | Ga0501079_0232369_262_1227 | 317 |
| 282 | 3300049742 | Ga0501080_0435632 | Ga0501080_0435632_80_1045 | 317 |
| 283 | 3300049743 | Ga0501081_0157933 | Ga0501081_0157933_581_1546 | 317 |
| 284 | 3300049744 | Ga0501083_0078443 | Ga0501083_0078443_972_1937 | 317 |
| 285 | 3300049822 | Ga0501035_0433775 | Ga0501035_0433775_68_1033 | 317 |
| 286 | 3300049824 | Ga0501045_0159191 | Ga0501045_0159191_125_1090 | 317 |
| 287 | 3300053078 | Ga0495612_0109785 | Ga0495612_0109785_11_976 | 317 |
| 288 | 3300053085 | Ga0495619_0161742 | Ga0495619_0161742_220_1185 | 317 |
| 289 | 3300054114 | Ga0501084_0172863 | Ga0501084_0172863_761_1726 | 317 |
| 290 | 3300060353 | Ga0501082_0116551 | Ga0501082_0116551_308_1273 | 317 |
| 291 | 3300061734 | Ga0530510_0174087 | Ga0530510_0174087_125_1090 | 317 |
| 292 | 3300005985 | Ga0081539_10112413 | Ga0081539_101124132 | 319 |
| 293 | 3300031852 | Ga0307410_10291595 | Ga0307410_102915951 | 319 |
| 294 | 3300031901 | Ga0307406_10257631 | Ga0307406_102576312 | 319 |
| 295 | 3300031995 | Ga0307409_100440230 | Ga0307409_1004402302 | 319 |
| 296 | 3300032002 | Ga0307416_100220851 | Ga0307416_1002208512 | 319 |
| 297 | 3300032004 | Ga0307414_10360325 | Ga0307414_103603251 | 319 |
| 298 | 3300032126 | Ga0307415_100206828 | Ga0307415_1002068282 | 319 |
| 299 | 3300005436 | Ga0070713_100543197 | Ga0070713_1005431971 | 320 |
| 300 | 3300003373 | JGI25407J50210_10042391 | JGI25407J50210_100423911 | 321 |
| 301 | 3300005981 | Ga0081538_10042285 | Ga0081538_100422852 | 321 |
| 302 | 3300031731 | Ga0307405_10384313 | Ga0307405_103843131 | 321 |
| 303 | 3300031824 | Ga0307413_10457308 | Ga0307413_104573081 | 321 |
| 304 | 3300031901 | Ga0307406_10062414 | Ga0307406_100624142 | 321 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ywy-assembly1.cif.gz_66 | the structure of the mitoribosome from neurospora crassa with bound trna at the p-site | 0.9146 | 9 | 52 |
| 3clo-assembly1.cif.gz_B | crystal structure of putative transcriptional regulator containing a luxr dna binding domain (np_811094.1) from bacteroides thetaiotaomicron vpi-5482 at 2.04 a resolution | 0.9034 | 72 | 110 |
| 1tc3-assembly1.cif.gz_C | transposase tc3a1-65 from caenorhabditis elegans | 0.8992 | 70 | 111 |
| 7bhy-assembly2.cif.gz_C-2 | dna-binding domain of deor in complex with the dna operator | 0.8822 | 12 | 53 |
| 7bhy-assembly1.cif.gz_A | dna-binding domain of deor in complex with the dna operator | 0.8723 | 11 | 54 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1u78A01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9326 | 71 | 108 | 1.10.10.60 |
| af_Q21972_79_144_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9072 | 11 | 53 | 1.10.10.10 |
| af_P23758_5_73_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9019 | 11 | 53 | 1.10.10.10 |
| 2r0qF02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9006 | 12 | 45 | 1.10.10.60 |
| 1tc3C00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.8992 | 70 | 111 | 1.10.10.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1I7DD94-F1-model_v4 | Integrase core domain-containing protein | 0.9607 | 173 | 257 |
GO:0003676
GO:0015074 |
| AF-A0A2N2UMM1-F1-model_v4 | Integrase catalytic domain-containing protein | 0.9525 | 196 | 314 |
GO:0003676
GO:0015074 |
| AF-A0A7X3I4W4-F1-model_v4 | Transposase family protein | 0.9478 | 198 | 315 |
GO:0003676
GO:0015074 |
| AF-A0A171JVH4-F1-model_v4 | deleted | 0.9457 | 204 | 316 |
|
| AF-A0A171JW63-F1-model_v4 | deleted | 0.9449 | 204 | 316 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar