F397747

General Info

Members Datasets Scaffolds Average Seq Length
304 211 304 313

Family's Representative Sequence

Representative Sequence 3300046517|Ga0495630_0244041|Ga0495630_0244041_165_1310
Length 376
Sequence MKLHANARTCPKSRKLLVKRIEEENWSLVAAAEAAGISERSAAKWREGERGLLDRSSAPRRRPTQLAADRLGAIEALRRLRMTAAEXXXXLEMALSTVSRWLKRIGLGKRSRLEPPEPPNRYERKRPGELIHVDVKKLGRILVPGHRVTGNRRQHARRTRVGNQGRYLGTAGWEFVHVCVDDATRLAYVEVLDDEKGATAAAFLRRAVRWFKGMGVTVERVLSDNGSCYRSGAHAEACRELDMRHLFTRPYRPRTNGKAERFIQTLTNRWAYGALYGNSAERTAALPGWLTHYNFTRRHGSLGHKAPAARLAELEQRGEELQLVGHPAQRSQCPRSTTSCSLTSKLIRPATLSIARSSERSSKGISRPQSRQIAWW

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
119 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
120 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
121 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
122 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
128 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
129 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
130 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
136 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
137 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
142 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
143 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
144 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
145 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
146 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
147 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
148 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
149 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
150 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
151 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
152 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
153 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
154 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
155 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
156 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
157 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
158 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
159 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
160 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
161 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
162 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
163 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
164 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
171 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
176 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
177 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
186 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
187 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
188 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
189 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
190 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
191 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
192 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
193 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
194 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
195 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
196 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
197 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
200 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
201 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
202 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
203 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
204 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
205 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
206 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
207 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
209 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
210 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
211 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.01
Metatranscriptomes 0.99
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.66
Nodule 0
Rhizoplane 6.91
Rhizosphere 90.79
Stem 0
Stem Tuber 0
Unclassified 1.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10042391 3300003373 Bacteria 1164
2 Ga0070683_100029594 3300005329 Bacteria 4960
3 Ga0070670_100336730 3300005331 Bacteria 1324
4 Ga0068869_100121429 3300005334 Bacteria 1999
5 Ga0070680_100157290 3300005336 Bacteria 1909
6 Ga0070682_100045637 3300005337 Bacteria 2717
7 Ga0070682_100293457 3300005337 Bacteria 1190
8 Ga0070660_100115272 3300005339 Bacteria 2141
9 Ga0070660_100310612 3300005339 Bacteria 1294
10 Ga0070689_100150008 3300005340 Bacteria 1880
11 Ga0070661_100263728 3300005344 Bacteria 1332
12 Ga0070668_100231259 3300005347 Bacteria 1528
13 Ga0070668_100359893 3300005347 Bacteria 1233
14 Ga0070669_100217736 3300005353 Bacteria 1509
15 Ga0070675_100124184 3300005354 Bacteria 2195
16 Ga0070671_100116687 3300005355 Bacteria 2244
17 Ga0070674_100130555 3300005356 Bacteria 1872
18 Ga0070659_100217343 3300005366 Bacteria 1577
19 Ga0070667_100001181 3300005367 Bacteria 23764
20 Ga0070713_100543197 3300005436 Bacteria 1100
21 Ga0070711_100129976 3300005439 Bacteria 1874
22 Ga0070711_100171278 3300005439 Bacteria 1655
23 Ga0070700_100267591 3300005441 Bacteria 1233
24 Ga0070663_100186379 3300005455 Bacteria 1612
25 Ga0070678_100135626 3300005456 Bacteria 1962
26 Ga0070681_10211904 3300005458 Bacteria 1853
27 Ga0068867_100314758 3300005459 Bacteria 1295
28 Ga0070685_10037243 3300005466 Bacteria 2754
29 Ga0070706_100205584 3300005467 Bacteria 1839
30 Ga0070684_100514982 3300005535 Bacteria 1109
31 Ga0070672_100427797 3300005543 Bacteria 1138
32 Ga0070693_100241604 3300005547 Bacteria 1193
33 Ga0070665_100344875 3300005548 Bacteria 1494
34 Ga0068855_100119334 3300005563 Bacteria 3020
35 Ga0070664_100354903 3300005564 Bacteria 1334
36 Ga0068857_100424061 3300005577 Bacteria 1241
37 Ga0068854_100103571 3300005578 Bacteria 2137
38 Ga0068856_100493659 3300005614 Bacteria 1245
39 Ga0070702_100296688 3300005615 Bacteria 1116
40 Ga0068852_100063418 3300005616 Bacteria 3217
41 Ga0068852_100163788 3300005616 Bacteria 2079
42 Ga0068864_100528951 3300005618 Bacteria 1137
43 Ga0068866_10193218 3300005718 Bacteria 1211
44 Ga0068861_100067170 3300005719 Bacteria 2766
45 Ga0068863_100565253 3300005841 Bacteria 1124
46 Ga0068860_100426913 3300005843 Bacteria 1315
47 Ga0068862_100000943 3300005844 Bacteria 28026
48 Ga0081455_10022074 3300005937 Bacteria 5958
49 Ga0081455_10058763 3300005937 Bacteria 3251
50 Ga0081538_10002259 3300005981 Bacteria 19075
51 Ga0081538_10016683 3300005981 Bacteria 5617
52 Ga0081538_10022916 3300005981 Bacteria 4506
53 Ga0081538_10042285 3300005981 Bacteria 2879
54 Ga0081538_10045799 3300005981 Bacteria 2707
55 Ga0081538_10069006 3300005981 Bacteria 1962
56 Ga0081538_10070452 3300005981 Bacteria 1930
57 Ga0081540_1027034 3300005983 Bacteria 3260
58 Ga0081539_10112413 3300005985 Bacteria 1368
59 Ga0070717_10362495 3300006028 Bacteria 1297
60 Ga0075365_10048684 3300006038 Bacteria 2790
61 Ga0070712_100360554 3300006175 Bacteria 1192
62 Ga0097621_100127114 3300006237 Bacteria 2166
63 Ga0075433_10221518 3300006852 Bacteria 1680
64 Ga0075434_100240649 3300006871 Bacteria 1830
65 Ga0068865_100228206 3300006881 Bacteria 1459
66 Ga0075435_100277313 3300007076 Bacteria 1431
67 Ga0105240_10330747 3300009093 Bacteria 1734
68 Ga0105240_10433445 3300009093 Bacteria 1474
69 Ga0111539_10369307 3300009094 Bacteria 1670
70 Ga0105245_10212299 3300009098 Bacteria 1863
71 Ga0105245_10416804 3300009098 Bacteria 1345
72 Ga0105245_10498426 3300009098 Bacteria 1234
73 Ga0105241_10166819 3300009174 Bacteria 1815
74 Ga0105242_10446230 3300009176 Bacteria 1218
75 Ga0105237_10076429 3300009545 Bacteria 3339
76 Ga0105249_10072904 3300009553 Bacteria 3175
77 Ga0105249_10437497 3300009553 Bacteria 1344
78 Ga0105239_10595418 3300010375 Bacteria 1261
79 Ga0157370_10130019 3300013104 Bacteria 2349
80 Ga0157374_10000242 3300013296 Bacteria 50857
81 Ga0157374_10003614 3300013296 Bacteria 13023
82 Ga0157374_10266013 3300013296 Bacteria 1690
83 Ga0157378_10069605 3300013297 Bacteria 3157
84 Ga0157378_10354123 3300013297 Bacteria 1435
85 Ga0163162_10432998 3300013306 Bacteria 1447
86 Ga0157372_10225743 3300013307 Bacteria 2171
87 Ga0157375_10305237 3300013308 Bacteria 1755
88 Ga0157375_10481163 3300013308 Bacteria 1406
89 Ga0163163_10136594 3300014325 Bacteria 2493
90 Ga0157377_10204152 3300014745 Bacteria 1256
91 Ga0157379_10095203 3300014968 Bacteria 2672
92 Ga0157376_10392057 3300014969 Bacteria 1340
93 Ga0163161_10249442 3300017792 Bacteria 1383
94 Ga0206356_11216255 3300020070 Bacteria 1977
95 Ga0206354_10781290 3300020081 Bacteria 2060
96 Ga0206353_11177129 3300020082 Bacteria 3938
97 Ga0213876_10109300 3300021384 Bacteria 1467
98 Ga0207642_10039529 3300025899 Bacteria 2051
99 Ga0207688_10006090 3300025901 Bacteria 6560
100 Ga0207705_10313469 3300025909 Bacteria 1204
101 Ga0207695_10455911 3300025913 Bacteria 1162
102 Ga0207671_10000835 3300025914 Bacteria 39117
103 Ga0207663_10249591 3300025916 Bacteria 1305
104 Ga0207663_10319775 3300025916 Bacteria 1166
105 Ga0207660_10178671 3300025917 Bacteria 1647
106 Ga0207657_10111895 3300025919 Bacteria 2254
107 Ga0207657_10157543 3300025919 Bacteria 1846
108 Ga0207652_10288702 3300025921 Bacteria 1480
109 Ga0207681_10124353 3300025923 Bacteria 1897
110 Ga0207650_10373814 3300025925 Bacteria 1176
111 Ga0207659_10427741 3300025926 Bacteria 1111
112 Ga0207687_10339136 3300025927 Bacteria 1222
113 Ga0207687_10350284 3300025927 Bacteria 1203
114 Ga0207664_10039010 3300025929 Bacteria 3685
115 Ga0207644_10105588 3300025931 Bacteria 2122
116 Ga0207690_10294278 3300025932 Bacteria 1268
117 Ga0207706_10038922 3300025933 Bacteria 4217
118 Ga0207670_10040808 3300025936 Bacteria 3048
119 Ga0207669_10098081 3300025937 Bacteria 1929
120 Ga0207689_10363929 3300025942 Bacteria 1203
121 Ga0207661_10440710 3300025944 Bacteria 1185
122 Ga0207667_10130013 3300025949 Bacteria 2593
123 Ga0207651_10368074 3300025960 Bacteria 1215
124 Ga0207712_10011490 3300025961 Bacteria 5642
125 Ga0207712_10360146 3300025961 Bacteria 1212
126 Ga0207668_10248070 3300025972 Bacteria 1444
127 Ga0207668_10311286 3300025972 Bacteria 1303
128 Ga0207640_10039248 3300025981 Bacteria 2995
129 Ga0207677_10451839 3300026023 Bacteria 1101
130 Ga0207639_10413588 3300026041 Bacteria 1218
131 Ga0207678_10271603 3300026067 Bacteria 1454
132 Ga0207708_10009456 3300026075 Bacteria 7218
133 Ga0207702_10422564 3300026078 Bacteria 1289
134 Ga0207702_10567545 3300026078 Bacteria 1111
135 Ga0207648_10385477 3300026089 Bacteria 1268
136 Ga0207674_10369812 3300026116 Bacteria 1386
137 Ga0207675_100109262 3300026118 Bacteria 2609
138 Ga0207683_10444895 3300026121 Bacteria 1194
139 Ga0207698_10582016 3300026142 Bacteria 1101
140 Ga0268266_10022572 3300028379 Bacteria 5360
141 Ga0268265_10001477 3300028380 Bacteria 19727
142 Ga0268265_10236104 3300028380 Bacteria 1610
143 Ga0268264_10002520 3300028381 Bacteria 16098
144 Ga0307408_100254666 3300031548 Bacteria 1450
145 Ga0307405_10384313 3300031731 Bacteria 1094
146 Ga0307413_10371744 3300031824 Bacteria 1110
147 Ga0307413_10388459 3300031824 Bacteria 1090
148 Ga0307413_10457308 3300031824 Bacteria 1015
149 Ga0307410_10291595 3300031852 Bacteria 1284
150 Ga0307410_10349855 3300031852 Bacteria 1180
151 Ga0307406_10062414 3300031901 Bacteria 2411
152 Ga0307406_10257631 3300031901 Bacteria 1318
153 Ga0307406_10263470 3300031901 Bacteria 1305
154 Ga0307407_10238843 3300031903 Bacteria 1238
155 Ga0307409_100333030 3300031995 Bacteria 1425
156 Ga0307409_100440230 3300031995 Bacteria 1255
157 Ga0307409_100551422 3300031995 Bacteria 1131
158 Ga0307409_100568814 3300031995 Bacteria 1115
159 Ga0307416_100220851 3300032002 Bacteria 1817
160 Ga0307416_100686961 3300032002 Bacteria 1111
161 Ga0307414_10360325 3300032004 Bacteria 1251
162 Ga0307415_100206828 3300032126 Bacteria 1562
163 Ga0307415_100365186 3300032126 Bacteria 1220
164 Ga0307415_100382048 3300032126 Bacteria 1196
165 Ga0373943_0155892 3300035170 Bacteria 1240
166 Ga0373935_0177000 3300035692 Bacteria 1463
167 Ga0373927_0288069 3300035695 Bacteria 1081
168 Ga0395899_0156653 3300037312 Bacteria 1611
169 Ga0395900_0283295 3300037418 Bacteria 1648
170 Ga0395898_0250146 3300037466 Bacteria 1690
171 Ga0395905_0460879 3300037471 Bacteria 1169
172 Ga0395901_0078351 3300038443 Bacteria 3450
173 Ga0395901_0363836 3300038443 Bacteria 1491
174 Ga0395901_0582425 3300038443 Bacteria 1130
175 Ga0436365_0208480 3300039437 Bacteria 1728
176 Ga0436365_1505429 3300039437 Unclassified 1166
177 Ga0451807_0176455 3300041486 Bacteria 1960
178 Ga0451853_2236129 3300041512 Bacteria 1050
179 Ga0466963_0237247 3300044694 Bacteria 1278
180 Ga0466963_0245726 3300044694 Bacteria 1255
181 Ga0466964_0015079 3300044706 Bacteria 2943
182 Ga0466964_0073709 3300044706 Bacteria 1450
183 Ga0466967_0233908 3300045976 Bacteria 1750
184 Ga0466967_0403518 3300045976 Bacteria 1330
185 Ga0466967_0452064 3300045976 Bacteria 1255
186 Ga0466967_0488513 3300045976 Bacteria 1207
187 Ga0466967_0625365 3300045976 Bacteria 1063
188 Ga0495592_0063349 3300046454 Bacteria 2712
189 Ga0495603_0044801 3300046455 Bacteria 2639
190 Ga0495603_0276062 3300046455 Bacteria 966
191 Ga0495641_0000001 3300046461 Bacteria 485224
192 Ga0495641_0000050 3300046461 Bacteria 73259
193 Ga0495582_0082903 3300046473 Bacteria 1782
194 Ga0495582_0256180 3300046473 Bacteria 1004
195 Ga0495582_0276756 3300046473 Bacteria 963
196 Ga0495585_0195381 3300046492 Bacteria 1033
197 Ga0495594_0000010 3300046499 Bacteria 118481
198 Ga0495608_0000023 3300046511 Bacteria 160090
199 Ga0495630_0131536 3300046517 Bacteria 1900
200 Ga0495630_0244041 3300046517 Bacteria 1372
201 Ga0495630_0252850 3300046517 Bacteria 1346
202 Ga0495652_0004565 3300046529 Bacteria 13204
203 Ga0495588_0179915 3300046674 Bacteria 1117
204 Ga0495657_0000020 3300046675 Bacteria 160089
205 Ga0495657_0072212 3300046675 Bacteria 2251
206 Ga0495657_0130506 3300046675 Bacteria 1574
207 Ga0495599_0204954 3300046678 Bacteria 1211
208 Ga0495623_0102024 3300046679 Bacteria 1747
209 Ga0495646_0126981 3300046680 Bacteria 1438
210 Ga0495647_0156797 3300046681 Bacteria 979
211 Ga0495669_0092372 3300046684 Bacteria 1398
212 Ga0495613_0000041 3300046689 Bacteria 130784
213 Ga0495613_0009309 3300046689 Bacteria 7288
214 Ga0495613_0100454 3300046689 Bacteria 2090
215 Ga0495670_0018484 3300046691 Bacteria 3431
216 Ga0495649_0001868 3300046694 Bacteria 15419
217 Ga0495581_0247005 3300047315 Bacteria 1043
218 Ga0495676_0000405 3300047321 Bacteria 34992
219 Ga0495676_0010974 3300047321 Bacteria 8192
220 Ga0495676_0379903 3300047321 Bacteria 940
221 Ga0495675_0000103 3300047444 Bacteria 61353
222 Ga0495593_0005560 3300047673 Bacteria 7446
223 Ga0496100_0025323 3300048903 Bacteria 3628
224 Ga0496102_0397205 3300048905 Bacteria 1296
225 Ga0496103_0046629 3300048906 Bacteria 2676
226 Ga0496103_0211421 3300048906 Bacteria 1247
227 Ga0496104_0058958 3300048907 Bacteria 3634
228 Ga0496105_0221192 3300048908 Bacteria 1541
229 Ga0496105_0332918 3300048908 Bacteria 1215
230 Ga0496105_0370807 3300048908 Bacteria 1140
231 Ga0496106_0000081 3300048909 Bacteria 76468
232 Ga0496106_0000096 3300048909 Bacteria 67122
233 Ga0496107_0015317 3300048910 Bacteria 5373
234 Ga0496107_0022053 3300048910 Bacteria 4499
235 Ga0496107_0289329 3300048910 Bacteria 1219
236 Ga0496108_0000006 3300048911 Bacteria 469473
237 Ga0496108_0460801 3300048911 Bacteria 1110
238 Ga0496109_0000009 3300048912 Bacteria 236561
239 Ga0496109_0440458 3300048912 Bacteria 1231
240 Ga0496110_0226886 3300048913 Bacteria 1698
241 Ga0496112_0411967 3300048915 Bacteria 1290
242 Ga0496115_0389896 3300048918 Bacteria 1131
243 Ga0496125_0066890 3300048928 Bacteria 2836
244 Ga0501033_0188547 3300049570 Bacteria 1476
245 Ga0501036_0322978 3300049572 Bacteria 1289
246 Ga0501038_0199520 3300049574 Bacteria 1606
247 Ga0501039_0011025 3300049575 Bacteria 6886
248 Ga0501039_0061135 3300049575 Bacteria 2917
249 Ga0501040_0153860 3300049576 Bacteria 1623
250 Ga0501040_0360087 3300049576 Unclassified 1042
251 Ga0501041_0218375 3300049577 Bacteria 1196
252 Ga0501042_0346297 3300049578 Bacteria 1074
253 Ga0501042_0379385 3300049578 Bacteria 1023
254 Ga0501046_0295938 3300049580 Unclassified 1183
255 Ga0501046_0310808 3300049580 Bacteria 1149
256 Ga0501068_0045368 3300049584 Unclassified 2648
257 Ga0501068_0242833 3300049584 Bacteria 1146
258 Ga0501068_0282183 3300049584 Bacteria 1061
259 Ga0501069_0140524 3300049585 Bacteria 1385
260 Ga0501069_0221170 3300049585 Bacteria 1100
261 Ga0501069_0271039 3300049585 Unclassified 992
262 Ga0501071_0044094 3300049587 Bacteria 3199
263 Ga0501071_0141527 3300049587 Bacteria 1791
264 Ga0501072_0201815 3300049588 Unclassified 1585
265 Ga0501072_0248830 3300049588 Bacteria 1415
266 Ga0501074_0148326 3300049590 Bacteria 1677
267 Ga0501075_0084251 3300049591 Bacteria 2407
268 Ga0501075_0226292 3300049591 Unclassified 1426
269 Ga0501076_0049199 3300049592 Bacteria 3333
270 Ga0501076_0094548 3300049592 Bacteria 2406
271 Ga0501077_0116350 3300049593 Bacteria 1694
272 Ga0501079_0060630 3300049741 Bacteria 2918
273 Ga0501079_0232369 3300049741 Bacteria 1440
274 Ga0501080_0285212 3300049742 Unclassified 1500
275 Ga0501080_0435632 3300049742 Bacteria 1176
276 Ga0501081_0157933 3300049743 Bacteria 1632
277 Ga0501081_0337605 3300049743 Bacteria 1109
278 Ga0501081_0350743 3300049743 Unclassified 1087
279 Ga0501083_0078443 3300049744 Bacteria 2191
280 Ga0501083_0255733 3300049744 Unclassified 1140
281 Ga0501035_0286141 3300049822 Unclassified 1392
282 Ga0501035_0341096 3300049822 Bacteria 1255
283 Ga0501035_0433775 3300049822 Bacteria 1089
284 Ga0501044_0395462 3300049823 Bacteria 1295
285 Ga0501045_0159191 3300049824 Bacteria 1680
286 nmdc:mga08y16_60545_c1 3300050511 Bacteria 3954
287 nmdc:mga0n895_476086_c1 3300050512 Bacteria 1260
288 nmdc:mga0rr50_177814_c1 3300050513 Bacteria 1738
289 nmdc:mga0a205_253187_c1 3300050515 Bacteria 1640
290 Ga0495612_0089916 3300053078 Bacteria 1298
291 Ga0495612_0109785 3300053078 Bacteria 1179
292 Ga0495595_0000022 3300053084 Bacteria 110598
293 Ga0495619_0000070 3300053085 Bacteria 80588
294 Ga0495619_0000152 3300053085 Bacteria 51090
295 Ga0495619_0092426 3300053085 Bacteria 2049
296 Ga0495619_0161742 3300053085 Bacteria 1546
297 Ga0500595_015177 3300053119 Bacteria 2895
298 Ga0501084_0134875 3300054114 Unclassified 2078
299 Ga0501084_0172863 3300054114 Bacteria 1823
300 Ga0590075_027413 3300059424 Bacteria 1437
301 Ga0501082_0116551 3300060353 Bacteria 2313
302 Ga0501082_0240534 3300060353 Unclassified 1575
303 Ga0530510_0174087 3300061734 Bacteria 1594
304 Ga0530510_0307159 3300061734 Unclassified 1187

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047321 Ga0495676_0379903 Ga0495676_0379903_95_895 257
2 3300044694 Ga0466963_0237247 Ga0466963_0237247_263_1171 258
3 3300045976 Ga0466967_0233908 Ga0466967_0233908_616_1524 258
4 3300005983 Ga0081540_1027034 Ga0081540_10270342 261
5 3300005618 Ga0068864_100528951 Ga0068864_1005289512 265
6 3300005981 Ga0081538_10069006 Ga0081538_100690061 266
7 3300046473 Ga0495582_0256180 Ga0495582_0256180_89_922 266
8 3300047321 Ga0495676_0010974 Ga0495676_0010974_921_1754 275
9 3300046473 Ga0495582_0276756 Ga0495582_0276756_81_947 279
10 3300049575 Ga0501039_0011025 Ga0501039_0011025_150_1058 283
11 3300049576 Ga0501040_0360087 Ga0501040_0360087_53_961 283
12 3300049580 Ga0501046_0295938 Ga0501046_0295938_60_968 283
13 3300049584 Ga0501068_0045368 Ga0501068_0045368_217_1125 283
14 3300049585 Ga0501069_0271039 Ga0501069_0271039_35_943 283
15 3300049587 Ga0501071_0044094 Ga0501071_0044094_1898_2806 283
16 3300049588 Ga0501072_0201815 Ga0501072_0201815_480_1388 283
17 3300049591 Ga0501075_0226292 Ga0501075_0226292_502_1410 283
18 3300049592 Ga0501076_0049199 Ga0501076_0049199_213_1121 283
19 3300049741 Ga0501079_0060630 Ga0501079_0060630_1049_1957 283
20 3300049742 Ga0501080_0285212 Ga0501080_0285212_408_1316 283
21 3300049743 Ga0501081_0350743 Ga0501081_0350743_166_1074 283
22 3300049744 Ga0501083_0255733 Ga0501083_0255733_188_1096 283
23 3300049822 Ga0501035_0286141 Ga0501035_0286141_350_1258 283
24 3300054114 Ga0501084_0134875 Ga0501084_0134875_878_1786 283
25 3300060353 Ga0501082_0240534 Ga0501082_0240534_639_1547 283
26 3300061734 Ga0530510_0307159 Ga0530510_0307159_71_979 283
27 3300045976 Ga0466967_0403518 Ga0466967_0403518_385_1269 285
28 3300035170 Ga0373943_0155892 Ga0373943_0155892_100_987 286
29 3300035692 Ga0373935_0177000 Ga0373935_0177000_75_962 286
30 3300035695 Ga0373927_0288069 Ga0373927_0288069_124_1011 286
31 3300046681 Ga0495647_0156797 Ga0495647_0156797_63_950 286
32 3300046689 Ga0495613_0100454 Ga0495613_0100454_1101_1988 286
33 3300047315 Ga0495581_0247005 Ga0495581_0247005_123_1010 286
34 3300005466 Ga0070685_10037243 Ga0070685_100372432 288
35 3300005535 Ga0070684_100514982 Ga0070684_1005149821 288
36 3300005577 Ga0068857_100424061 Ga0068857_1004240612 288
37 3300005981 Ga0081538_10070452 Ga0081538_100704521 288
38 3300006881 Ga0068865_100228206 Ga0068865_1002282062 288
39 3300013296 Ga0157374_10266013 Ga0157374_102660132 288
40 3300026116 Ga0207674_10369812 Ga0207674_103698122 288
41 3300049585 Ga0501069_0140524 Ga0501069_0140524_243_1148 290
42 3300046517 Ga0495630_0252850 Ga0495630_0252850_270_1238 291
43 3300049585 Ga0501069_0221170 Ga0501069_0221170_108_1076 291
44 3300026041 Ga0207639_10413588 Ga0207639_104135881 292
45 3300046473 Ga0495582_0082903 Ga0495582_0082903_701_1669 292
46 3300005336 Ga0070680_100157290 Ga0070680_1001572902 294
47 3300005339 Ga0070660_100115272 Ga0070660_1001152723 294
48 3300005344 Ga0070661_100263728 Ga0070661_1002637282 294
49 3300005458 Ga0070681_10211904 Ga0070681_102119042 294
50 3300005563 Ga0068855_100119334 Ga0068855_1001193343 294
51 3300005616 Ga0068852_100063418 Ga0068852_1000634182 294
52 3300013104 Ga0157370_10130019 Ga0157370_101300193 294
53 3300020081 Ga0206354_10781290 Ga0206354_107812902 294
54 3300020082 Ga0206353_11177129 Ga0206353_111771291 294
55 3300025917 Ga0207660_10178671 Ga0207660_101786711 294
56 3300025919 Ga0207657_10157543 Ga0207657_101575432 294
57 3300025921 Ga0207652_10288702 Ga0207652_102887022 294
58 3300025932 Ga0207690_10294278 Ga0207690_102942781 294
59 3300025949 Ga0207667_10130013 Ga0207667_101300132 294
60 3300037312 Ga0395899_0156653 Ga0395899_0156653_198_1133 295
61 3300037418 Ga0395900_0283295 Ga0395900_0283295_489_1424 295
62 3300037466 Ga0395898_0250146 Ga0395898_0250146_108_1043 295
63 3300037471 Ga0395905_0460879 Ga0395905_0460879_145_1080 295
64 3300038443 Ga0395901_0078351 Ga0395901_0078351_18_953 295
65 3300009093 Ga0105240_10433445 Ga0105240_104334452 296
66 3300014969 Ga0157376_10392057 Ga0157376_103920571 296
67 3300046492 Ga0495585_0195381 Ga0495585_0195381_43_1008 296
68 3300005981 Ga0081538_10045799 Ga0081538_100457991 297
69 3300047321 Ga0495676_0000405 Ga0495676_0000405_2557_3489 299
70 3300013296 Ga0157374_10000242 Ga0157374_100002428 300
71 3300046455 Ga0495603_0276062 Ga0495603_0276062_14_952 300
72 3300046529 Ga0495652_0004565 Ga0495652_0004565_4181_5155 300
73 3300046675 Ga0495657_0130506 Ga0495657_0130506_461_1426 300
74 3300046678 Ga0495599_0204954 Ga0495599_0204954_132_1106 300
75 3300046680 Ga0495646_0126981 Ga0495646_0126981_187_1161 300
76 3300048906 Ga0496103_0211421 Ga0496103_0211421_209_1177 300
77 3300005937 Ga0081455_10022074 Ga0081455_100220745 301
78 3300021384 Ga0213876_10109300 Ga0213876_101093002 301
79 3300039437 Ga0436365_0208480 Ga0436365_0208480_401_1375 301
80 3300048911 Ga0496108_0000006 Ga0496108_0000006_339075_339992 301
81 3300048912 Ga0496109_0000009 Ga0496109_0000009_106163_107080 301
82 3300048928 Ga0496125_0066890 Ga0496125_0066890_38_955 301
83 3300049584 Ga0501068_0242833 Ga0501068_0242833_31_996 301
84 3300049822 Ga0501035_0341096 Ga0501035_0341096_154_1119 301
85 3300053119 Ga0500595_015177 Ga0500595_015177_855_1826 301
86 3300031995 Ga0307409_100568814 Ga0307409_1005688141 302
87 3300049578 Ga0501042_0379385 Ga0501042_0379385_44_1012 303
88 3300005981 Ga0081538_10022916 Ga0081538_100229162 305
89 3300013308 Ga0157375_10305237 Ga0157375_103052372 305
90 3300049743 Ga0501081_0337605 Ga0501081_0337605_134_1090 305
91 3300005981 Ga0081538_10002259 Ga0081538_100022592 306
92 3300005337 Ga0070682_100045637 Ga0070682_1000456372 307
93 3300005981 Ga0081538_10016683 Ga0081538_100166836 307
94 3300006028 Ga0070717_10362495 Ga0070717_103624952 307
95 3300006237 Ga0097621_100127114 Ga0097621_1001271142 307
96 3300025936 Ga0207670_10040808 Ga0207670_100408083 307
97 3300041486 Ga0451807_0176455 Ga0451807_0176455_72_1022 307
98 3300046461 Ga0495641_0000001 Ga0495641_0000001_232057_233007 307
99 3300046499 Ga0495594_0000010 Ga0495594_0000010_97_1047 307
100 3300046511 Ga0495608_0000023 Ga0495608_0000023_77905_78855 307
101 3300046675 Ga0495657_0000020 Ga0495657_0000020_77905_78855 307
102 3300046679 Ga0495623_0102024 Ga0495623_0102024_308_1258 307
103 3300046689 Ga0495613_0000041 Ga0495613_0000041_51149_52099 307
104 3300047444 Ga0495675_0000103 Ga0495675_0000103_31731_32681 307
105 3300047673 Ga0495593_0005560 Ga0495593_0005560_5103_6053 307
106 3300053084 Ga0495595_0000022 Ga0495595_0000022_31744_32694 307
107 3300053085 Ga0495619_0000070 Ga0495619_0000070_31683_32633 307
108 3300053085 Ga0495619_0000152 Ga0495619_0000152_29928_30878 307
109 3300005329 Ga0070683_100029594 Ga0070683_1000295945 308
110 3300005334 Ga0068869_100121429 Ga0068869_1001214292 308
111 3300005337 Ga0070682_100293457 Ga0070682_1002934571 308
112 3300005339 Ga0070660_100310612 Ga0070660_1003106122 308
113 3300005340 Ga0070689_100150008 Ga0070689_1001500082 308
114 3300005347 Ga0070668_100231259 Ga0070668_1002312592 308
115 3300005354 Ga0070675_100124184 Ga0070675_1001241842 308
116 3300005355 Ga0070671_100116687 Ga0070671_1001166871 308
117 3300005356 Ga0070674_100130555 Ga0070674_1001305551 308
118 3300005366 Ga0070659_100217343 Ga0070659_1002173431 308
119 3300005439 Ga0070711_100129976 Ga0070711_1001299762 308
120 3300005441 Ga0070700_100267591 Ga0070700_1002675911 308
121 3300005455 Ga0070663_100186379 Ga0070663_1001863792 308
122 3300005456 Ga0070678_100135626 Ga0070678_1001356261 308
123 3300005459 Ga0068867_100314758 Ga0068867_1003147582 308
124 3300005543 Ga0070672_100427797 Ga0070672_1004277971 308
125 3300005547 Ga0070693_100241604 Ga0070693_1002416041 308
126 3300005564 Ga0070664_100354903 Ga0070664_1003549032 308
127 3300005578 Ga0068854_100103571 Ga0068854_1001035711 308
128 3300005615 Ga0070702_100296688 Ga0070702_1002966881 308
129 3300005616 Ga0068852_100163788 Ga0068852_1001637881 308
130 3300005718 Ga0068866_10193218 Ga0068866_101932182 308
131 3300005719 Ga0068861_100067170 Ga0068861_1000671703 308
132 3300005841 Ga0068863_100565253 Ga0068863_1005652531 308
133 3300006852 Ga0075433_10221518 Ga0075433_102215181 308
134 3300006871 Ga0075434_100240649 Ga0075434_1002406492 308
135 3300007076 Ga0075435_100277313 Ga0075435_1002773132 308
136 3300009093 Ga0105240_10330747 Ga0105240_103307472 308
137 3300009094 Ga0111539_10369307 Ga0111539_103693072 308
138 3300009098 Ga0105245_10416804 Ga0105245_104168041 308
139 3300009174 Ga0105241_10166819 Ga0105241_101668192 308
140 3300009176 Ga0105242_10446230 Ga0105242_104462301 308
141 3300009545 Ga0105237_10076429 Ga0105237_100764292 308
142 3300009553 Ga0105249_10437497 Ga0105249_104374972 308
143 3300010375 Ga0105239_10595418 Ga0105239_105954181 308
144 3300013297 Ga0157378_10354123 Ga0157378_103541232 308
145 3300013306 Ga0163162_10432998 Ga0163162_104329982 308
146 3300013307 Ga0157372_10225743 Ga0157372_102257431 308
147 3300013308 Ga0157375_10481163 Ga0157375_104811632 308
148 3300014325 Ga0163163_10136594 Ga0163163_101365942 308
149 3300014745 Ga0157377_10204152 Ga0157377_102041521 308
150 3300014968 Ga0157379_10095203 Ga0157379_100952033 308
151 3300017792 Ga0163161_10249442 Ga0163161_102494421 308
152 3300025899 Ga0207642_10039529 Ga0207642_100395292 308
153 3300025901 Ga0207688_10006090 Ga0207688_100060908 308
154 3300025916 Ga0207663_10249591 Ga0207663_102495912 308
155 3300025919 Ga0207657_10111895 Ga0207657_101118952 308
156 3300025926 Ga0207659_10427741 Ga0207659_104277411 308
157 3300025927 Ga0207687_10339136 Ga0207687_103391361 308
158 3300025931 Ga0207644_10105588 Ga0207644_101055883 308
159 3300025933 Ga0207706_10038922 Ga0207706_100389225 308
160 3300025937 Ga0207669_10098081 Ga0207669_100980813 308
161 3300025942 Ga0207689_10363929 Ga0207689_103639292 308
162 3300025944 Ga0207661_10440710 Ga0207661_104407102 308
163 3300025960 Ga0207651_10368074 Ga0207651_103680741 308
164 3300025961 Ga0207712_10360146 Ga0207712_103601461 308
165 3300025972 Ga0207668_10248070 Ga0207668_102480702 308
166 3300025981 Ga0207640_10039248 Ga0207640_100392481 308
167 3300026023 Ga0207677_10451839 Ga0207677_104518391 308
168 3300026067 Ga0207678_10271603 Ga0207678_102716032 308
169 3300026075 Ga0207708_10009456 Ga0207708_100094568 308
170 3300026078 Ga0207702_10567545 Ga0207702_105675451 308
171 3300026089 Ga0207648_10385477 Ga0207648_103854772 308
172 3300026118 Ga0207675_100109262 Ga0207675_1001092622 308
173 3300026121 Ga0207683_10444895 Ga0207683_104448951 308
174 3300026142 Ga0207698_10582016 Ga0207698_105820161 308
175 3300028380 Ga0268265_10236104 Ga0268265_102361041 308
176 3300031548 Ga0307408_100254666 Ga0307408_1002546661 308
177 3300048903 Ga0496100_0025323 Ga0496100_0025323_114_1082 308
178 3300048905 Ga0496102_0397205 Ga0496102_0397205_160_1128 308
179 3300048906 Ga0496103_0046629 Ga0496103_0046629_373_1341 308
180 3300048907 Ga0496104_0058958 Ga0496104_0058958_2482_3450 308
181 3300048908 Ga0496105_0370807 Ga0496105_0370807_61_1029 308
182 3300048910 Ga0496107_0289329 Ga0496107_0289329_168_1136 308
183 3300048911 Ga0496108_0460801 Ga0496108_0460801_30_998 308
184 3300048913 Ga0496110_0226886 Ga0496110_0226886_25_993 308
185 3300048915 Ga0496112_0411967 Ga0496112_0411967_122_1090 308
186 3300048918 Ga0496115_0389896 Ga0496115_0389896_89_1057 308
187 3300050511 nmdc:mga08y16_60545_c1 nmdc:mga08y16_60545_c1_2859_3827 308
188 3300050512 nmdc:mga0n895_476086_c1 nmdc:mga0n895_476086_c1_171_1139 308
189 3300050513 nmdc:mga0rr50_177814_c1 nmdc:mga0rr50_177814_c1_242_1210 308
190 3300050515 nmdc:mga0a205_253187_c1 nmdc:mga0a205_253187_c1_547_1515 308
191 3300031995 Ga0307409_100333030 Ga0307409_1003330302 310
192 3300045976 Ga0466967_0488513 Ga0466967_0488513_79_1035 310
193 3300046455 Ga0495603_0044801 Ga0495603_0044801_1611_2552 310
194 3300046517 Ga0495630_0131536 Ga0495630_0131536_171_1112 310
195 3300009098 Ga0105245_10212299 Ga0105245_102122992 311
196 3300025909 Ga0207705_10313469 Ga0207705_103134691 311
197 3300025927 Ga0207687_10350284 Ga0207687_103502841 311
198 3300038443 Ga0395901_0582425 Ga0395901_0582425_20_985 311
199 3300044706 Ga0466964_0015079 Ga0466964_0015079_53_1021 311
200 3300044706 Ga0466964_0073709 Ga0466964_0073709_251_1219 311
201 3300045976 Ga0466967_0452064 Ga0466967_0452064_106_1074 311
202 3300059424 Ga0590075_027413 Ga0590075_027413_111_1079 311
203 3300032126 Ga0307415_100382048 Ga0307415_1003820482 312
204 3300046517 Ga0495630_0244041 Ga0495630_0244041_165_1310 312
205 3300046675 Ga0495657_0072212 Ga0495657_0072212_100_1074 312
206 3300053078 Ga0495612_0089916 Ga0495612_0089916_272_1246 312
207 3300053085 Ga0495619_0092426 Ga0495619_0092426_325_1299 312
208 3300005614 Ga0068856_100493659 Ga0068856_1004936591 313
209 3300026078 Ga0207702_10422564 Ga0207702_104225641 313
210 3300046674 Ga0495588_0179915 Ga0495588_0179915_18_986 313
211 3300005467 Ga0070706_100205584 Ga0070706_1002055842 314
212 3300031824 Ga0307413_10388459 Ga0307413_103884591 314
213 3300044694 Ga0466963_0245726 Ga0466963_0245726_206_1180 314
214 3300006175 Ga0070712_100360554 Ga0070712_1003605541 315
215 3300046689 Ga0495613_0009309 Ga0495613_0009309_1079_2032 315
216 3300049823 Ga0501044_0395462 Ga0501044_0395462_280_1233 315
217 3300005331 Ga0070670_100336730 Ga0070670_1003367301 316
218 3300005347 Ga0070668_100359893 Ga0070668_1003598931 316
219 3300005353 Ga0070669_100217736 Ga0070669_1002177361 316
220 3300005367 Ga0070667_100001181 Ga0070667_10000118116 316
221 3300005548 Ga0070665_100344875 Ga0070665_1003448751 316
222 3300005843 Ga0068860_100426913 Ga0068860_1004269132 316
223 3300005844 Ga0068862_100000943 Ga0068862_10000094321 316
224 3300009553 Ga0105249_10072904 Ga0105249_100729044 316
225 3300013296 Ga0157374_10003614 Ga0157374_100036145 316
226 3300013297 Ga0157378_10069605 Ga0157378_100696051 316
227 3300020070 Ga0206356_11216255 Ga0206356_112162552 316
228 3300025923 Ga0207681_10124353 Ga0207681_101243532 316
229 3300025929 Ga0207664_10039010 Ga0207664_100390102 316
230 3300025961 Ga0207712_10011490 Ga0207712_100114902 316
231 3300025972 Ga0207668_10311286 Ga0207668_103112861 316
232 3300028379 Ga0268266_10022572 Ga0268266_100225722 316
233 3300028380 Ga0268265_10001477 Ga0268265_100014776 316
234 3300041512 Ga0451853_2236129 Ga0451853_2236129_11_967 316
235 3300046461 Ga0495641_0000050 Ga0495641_0000050_2633_3604 316
236 3300046684 Ga0495669_0092372 Ga0495669_0092372_409_1380 316
237 3300046691 Ga0495670_0018484 Ga0495670_0018484_1008_1979 316
238 3300046694 Ga0495649_0001868 Ga0495649_0001868_5094_6065 316
239 3300048909 Ga0496106_0000081 Ga0496106_0000081_32900_33862 316
240 3300048909 Ga0496106_0000096 Ga0496106_0000096_66090_67058 316
241 3300048910 Ga0496107_0015317 Ga0496107_0015317_3326_4294 316
242 3300048910 Ga0496107_0022053 Ga0496107_0022053_1452_2414 316
243 3300005439 Ga0070711_100171278 Ga0070711_1001712782 317
244 3300005937 Ga0081455_10058763 Ga0081455_100587632 317
245 3300006038 Ga0075365_10048684 Ga0075365_100486843 317
246 3300009098 Ga0105245_10498426 Ga0105245_104984261 317
247 3300025913 Ga0207695_10455911 Ga0207695_104559111 317
248 3300025914 Ga0207671_10000835 Ga0207671_1000083535 317
249 3300025916 Ga0207663_10319775 Ga0207663_103197752 317
250 3300025925 Ga0207650_10373814 Ga0207650_103738142 317
251 3300028381 Ga0268264_10002520 Ga0268264_100025206 317
252 3300031824 Ga0307413_10371744 Ga0307413_103717441 317
253 3300031852 Ga0307410_10349855 Ga0307410_103498551 317
254 3300031901 Ga0307406_10263470 Ga0307406_102634701 317
255 3300031903 Ga0307407_10238843 Ga0307407_102388431 317
256 3300031995 Ga0307409_100551422 Ga0307409_1005514221 317
257 3300032002 Ga0307416_100686961 Ga0307416_1006869611 317
258 3300032126 Ga0307415_100365186 Ga0307415_1003651861 317
259 3300038443 Ga0395901_0363836 Ga0395901_0363836_154_1137 317
260 3300039437 Ga0436365_1505429 Ga0436365_1505429_89_1069 317
261 3300045976 Ga0466967_0625365 Ga0466967_0625365_11_982 317
262 3300046454 Ga0495592_0063349 Ga0495592_0063349_985_1950 317
263 3300048908 Ga0496105_0221192 Ga0496105_0221192_486_1454 317
264 3300048908 Ga0496105_0332918 Ga0496105_0332918_141_1121 317
265 3300048912 Ga0496109_0440458 Ga0496109_0440458_212_1192 317
266 3300049570 Ga0501033_0188547 Ga0501033_0188547_423_1388 317
267 3300049572 Ga0501036_0322978 Ga0501036_0322978_126_1091 317
268 3300049574 Ga0501038_0199520 Ga0501038_0199520_322_1287 317
269 3300049575 Ga0501039_0061135 Ga0501039_0061135_207_1172 317
270 3300049576 Ga0501040_0153860 Ga0501040_0153860_627_1592 317
271 3300049577 Ga0501041_0218375 Ga0501041_0218375_92_1057 317
272 3300049578 Ga0501042_0346297 Ga0501042_0346297_30_995 317
273 3300049580 Ga0501046_0310808 Ga0501046_0310808_167_1132 317
274 3300049584 Ga0501068_0282183 Ga0501068_0282183_68_1033 317
275 3300049587 Ga0501071_0141527 Ga0501071_0141527_437_1402 317
276 3300049588 Ga0501072_0248830 Ga0501072_0248830_136_1101 317
277 3300049590 Ga0501074_0148326 Ga0501074_0148326_38_1003 317
278 3300049591 Ga0501075_0084251 Ga0501075_0084251_734_1699 317
279 3300049592 Ga0501076_0094548 Ga0501076_0094548_979_1944 317
280 3300049593 Ga0501077_0116350 Ga0501077_0116350_600_1565 317
281 3300049741 Ga0501079_0232369 Ga0501079_0232369_262_1227 317
282 3300049742 Ga0501080_0435632 Ga0501080_0435632_80_1045 317
283 3300049743 Ga0501081_0157933 Ga0501081_0157933_581_1546 317
284 3300049744 Ga0501083_0078443 Ga0501083_0078443_972_1937 317
285 3300049822 Ga0501035_0433775 Ga0501035_0433775_68_1033 317
286 3300049824 Ga0501045_0159191 Ga0501045_0159191_125_1090 317
287 3300053078 Ga0495612_0109785 Ga0495612_0109785_11_976 317
288 3300053085 Ga0495619_0161742 Ga0495619_0161742_220_1185 317
289 3300054114 Ga0501084_0172863 Ga0501084_0172863_761_1726 317
290 3300060353 Ga0501082_0116551 Ga0501082_0116551_308_1273 317
291 3300061734 Ga0530510_0174087 Ga0530510_0174087_125_1090 317
292 3300005985 Ga0081539_10112413 Ga0081539_101124132 319
293 3300031852 Ga0307410_10291595 Ga0307410_102915951 319
294 3300031901 Ga0307406_10257631 Ga0307406_102576312 319
295 3300031995 Ga0307409_100440230 Ga0307409_1004402302 319
296 3300032002 Ga0307416_100220851 Ga0307416_1002208512 319
297 3300032004 Ga0307414_10360325 Ga0307414_103603251 319
298 3300032126 Ga0307415_100206828 Ga0307415_1002068282 319
299 3300005436 Ga0070713_100543197 Ga0070713_1005431971 320
300 3300003373 JGI25407J50210_10042391 JGI25407J50210_100423911 321
301 3300005981 Ga0081538_10042285 Ga0081538_100422852 321
302 3300031731 Ga0307405_10384313 Ga0307405_103843131 321
303 3300031824 Ga0307413_10457308 Ga0307413_104573081 321
304 3300031901 Ga0307406_10062414 Ga0307406_100624142 321

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13683

rve_3

Integrase core domain

241

307

0.97

PF13011

LZ_Tnp_IS481

leucine-zipper of insertion element IS481

1

80

0.9

PF00665

rve

Integrase core domain

124

253

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ywy-assembly1.cif.gz_66 the structure of the mitoribosome from neurospora crassa with bound trna at the p-site 0.9146 9 52
3clo-assembly1.cif.gz_B crystal structure of putative transcriptional regulator containing a luxr dna binding domain (np_811094.1) from bacteroides thetaiotaomicron vpi-5482 at 2.04 a resolution 0.9034 72 110
1tc3-assembly1.cif.gz_C transposase tc3a1-65 from caenorhabditis elegans 0.8992 70 111
7bhy-assembly2.cif.gz_C-2 dna-binding domain of deor in complex with the dna operator 0.8822 12 53
7bhy-assembly1.cif.gz_A dna-binding domain of deor in complex with the dna operator 0.8723 11 54
ID Description Score Start End Superfamily
1u78A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9326 71 108 1.10.10.60
af_Q21972_79_144_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9072 11 53 1.10.10.10
af_P23758_5_73_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9019 11 53 1.10.10.10
2r0qF02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9006 12 45 1.10.10.60
1tc3C00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8992 70 111 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A1I7DD94-F1-model_v4 Integrase core domain-containing protein 0.9607 173 257 GO:0003676
GO:0015074
AF-A0A2N2UMM1-F1-model_v4 Integrase catalytic domain-containing protein 0.9525 196 314 GO:0003676
GO:0015074
AF-A0A7X3I4W4-F1-model_v4 Transposase family protein 0.9478 198 315 GO:0003676
GO:0015074
AF-A0A171JVH4-F1-model_v4 deleted 0.9457 204 316
AF-A0A171JW63-F1-model_v4 deleted 0.9449 204 316

Feature Viewer

pLDDT pTM Quality
82.35 0.58 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map