F397739

General Info

Members Datasets Scaffolds Average Seq Length
304 187 288 316

Family's Representative Sequence

Representative Sequence 3300046462|Ga0495651_0240573|Ga0495651_0240573_129_1193
Length 354
Sequence MGHHKPVVQFEKSNLNSPIKNSFVKKNLIYFFAVSIMVALVMSCGTKDSSKQSGEQPAAETKKPDSVIAAANPPSGFQHSFATVNGVKIHYVTGGNGEPLVLLHGFGQNWFMWNRLLPELAKHFTVVAPDLRGMGESDKPDSGYDKKTMAVDIHELVKKLGYKSINLAGHDIGLMVAYAYAAQFGSEVKKLALMDALLPGVEPVWSDFSGRAWWFGFFARPVSGYLVQGKEGAFLTDFWPVVGHVNDAFTKEESNEFIRAFSVPGSTTACFHWFGNFPQDALDNHVFEKNKLQMPVLAMGAEYGSGSFLANHSRVVATHVTEVVIKGAGHWIVQEKTDQVQKGLLDFFLDKQVK

Samples

Sample ID Description Type Environment
1 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
2 2738541278 Niastella sp. CF465 Isolate Unclassified
3 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
4 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
5 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
6 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
7 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
8 2818991444 Filimonas endophytica 3197 Isolate Unclassified
9 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
10 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
11 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
12 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
13 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
14 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
15 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
16 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
17 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
18 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
19 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
20 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
21 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
22 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
23 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
24 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
25 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
26 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
27 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
28 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
29 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
30 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
31 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
32 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
33 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
34 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
35 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
36 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
37 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
80 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
82 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
84 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
85 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
87 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
90 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
92 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
117 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
118 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
119 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
120 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
121 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
122 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
127 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
128 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
129 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
130 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
131 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
132 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
133 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
134 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
135 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
136 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
137 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
138 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
139 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
140 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
141 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
142 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
143 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
144 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
145 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
146 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
147 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
148 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
149 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
150 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
151 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
152 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
153 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
154 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
155 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
157 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
158 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
159 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
160 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
161 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
162 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
163 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
164 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
165 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
166 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
167 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
168 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
169 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
170 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
171 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
172 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
173 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
174 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
175 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
176 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
177 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
178 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
179 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
180 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
181 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
182 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
183 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
184 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
185 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
186 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
187 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.74
Metatranscriptomes 0
Isolates 5.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.36
Nodule 0
Rhizoplane 0.33
Rhizosphere 58.88
Stem 0
Stem Tuber 0
Unclassified 17.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001028 3300001979 Bacteria 12514
2 JGI24739J22299_10000953 3300001989 Bacteria 10771
3 JGI25162J39368_1000929 3300002737 Bacteria 18819
4 JGI25154J39366_1000065 3300002738 Bacteria 104126
5 JGI25157J39369_1003668 3300002741 Bacteria 3041
6 JGI25164J39214_1002109 3300002772 Bacteria 3376
7 JGI25165J46597_1003458 3300003214 Bacteria 3927
8 JGI25153J46596_10000355 3300003215 Bacteria 31671
9 rootH2_10078366 3300003320 Bacteria 1266
10 rootH2_10152486 3300003320 Bacteria 1400
11 rootL2_10018760 3300003322 Bacteria 6876
12 rootL2_10107380 3300003322 Bacteria 6791
13 rootL2_10133601 3300003322 Bacteria 2503
14 rootL2_10145093 3300003322 Bacteria 2870
15 rootL2_10165254 3300003322 Bacteria 4001
16 rootL2_10292965 3300003322 Unclassified 2118
17 rootH1_10004815 3300003323 Bacteria 22825
18 rootH1_10006200 3300003323 Bacteria 42710
19 rootH1_10035571 3300003323 Bacteria 5023
20 rootH1_10044429 3300003323 Bacteria 4057
21 rootH1_10148868 3300003323 Bacteria 7220
22 rootH1_10330645 3300003323 Unclassified 2804
23 JGI25160J50197_1000859 3300003354 Bacteria 16138
24 JGI25160J50197_1002676 3300003354 Bacteria 8200
25 JGI25160J50197_1004097 3300003354 Bacteria 6350
26 Ga0055526_1008426 3300003771 Bacteria 5148
27 Ga0055528_1000435 3300003790 Bacteria 33496
28 Ga0055530_10000650 3300003791 Bacteria 29824
29 Ga0055531_10000063 3300003794 Bacteria 119938
30 Ga0055531_10034575 3300003794 Unclassified 1601
31 Ga0055543_1015647 3300004625 Unclassified 1457
32 Ga0065165_1000358 3300005262 Bacteria 75013
33 Ga0065714_10002676 3300005288 Bacteria 13457
34 Ga0065714_10069721 3300005288 Bacteria 4111
35 Ga0065715_10133316 3300005293 Bacteria 1974
36 Ga0070683_100025175 3300005329 Bacteria 5341
37 Ga0068869_100006380 3300005334 Bacteria 7475
38 Ga0070666_10000065 3300005335 Bacteria 79454
39 Ga0068868_100158040 3300005338 Bacteria 1870
40 Ga0070668_100094369 3300005347 Bacteria 2362
41 Ga0070669_100274352 3300005353 Bacteria 1349
42 Ga0070673_100045626 3300005364 Bacteria 3399
43 Ga0070659_100395293 3300005366 Bacteria 1166
44 Ga0070667_100029722 3300005367 Bacteria 4555
45 Ga0070698_100109648 3300005471 Bacteria 2727
46 Ga0070698_100112766 3300005471 Unclassified 2684
47 Ga0070679_100084010 3300005530 Bacteria 3172
48 Ga0068853_100151017 3300005539 Bacteria 2091
49 Ga0068855_100028195 3300005563 Bacteria 6716
50 Ga0068855_100131982 3300005563 Bacteria 2852
51 Ga0068857_100419741 3300005577 Bacteria 1247
52 Ga0068854_100092555 3300005578 Bacteria 2252
53 Ga0068852_100024346 3300005616 Bacteria 4891
54 Ga0068859_100000006 3300005617 Bacteria 421509
55 Ga0068864_100082295 3300005618 Bacteria 2824
56 Ga0068863_100001205 3300005841 Bacteria 25844
57 Ga0068863_100059210 3300005841 Bacteria 3624
58 Ga0068858_100012081 3300005842 Bacteria 8138
59 Ga0068860_100000034 3300005843 Bacteria 243128
60 Ga0068860_100126071 3300005843 Bacteria 2454
61 Ga0081539_10112800 3300005985 Bacteria 1364
62 Ga0097621_100154655 3300006237 Bacteria 1968
63 Ga0068871_100202533 3300006358 Bacteria 1714
64 Ga0097620_100000006 3300006931 Bacteria 421509
65 Ga0105240_10000200 3300009093 Bacteria 121941
66 Ga0105240_10009778 3300009093 Bacteria 13539
67 Ga0105240_10012738 3300009093 Bacteria 11590
68 Ga0105240_10138284 3300009093 Bacteria 2915
69 Ga0105245_10103928 3300009098 Bacteria 2633
70 Ga0105247_10001377 3300009101 Bacteria 17641
71 Ga0105241_10000243 3300009174 Bacteria 41390
72 Ga0105241_10313428 3300009174 Unclassified 1350
73 Ga0105237_10000697 3300009545 Bacteria 46499
74 Ga0105237_10003110 3300009545 Bacteria 19993
75 Ga0105237_10013640 3300009545 Bacteria 8510
76 Ga0105237_10015034 3300009545 Bacteria 8065
77 Ga0105237_10021772 3300009545 Bacteria 6586
78 Ga0105237_10057831 3300009545 Bacteria 3880
79 Ga0105238_10020429 3300009551 Bacteria 6742
80 Ga0105238_10020454 3300009551 Bacteria 6738
81 Ga0105238_10105857 3300009551 Bacteria 2795
82 Ga0105238_10226523 3300009551 Bacteria 1846
83 Ga0105249_10006464 3300009553 Bacteria 10193
84 Ga0105249_10011736 3300009553 Bacteria 7703
85 Ga0105249_10013166 3300009553 Bacteria 7298
86 Ga0105239_10000146 3300010375 Bacteria 101177
87 Ga0105239_10002939 3300010375 Bacteria 21260
88 Ga0105239_10002974 3300010375 Bacteria 21140
89 Ga0105239_10015104 3300010375 Bacteria 8561
90 Ga0105239_10017415 3300010375 Bacteria 7946
91 Ga0105239_10027441 3300010375 Bacteria 6269
92 Ga0105239_10182695 3300010375 Bacteria 2346
93 Ga0105239_10291851 3300010375 Bacteria 1836
94 Ga0157371_10002120 3300013102 Bacteria 19316
95 Ga0157371_10035601 3300013102 Bacteria 3568
96 Ga0157371_10111689 3300013102 Bacteria 1940
97 Ga0157370_10000135 3300013104 Bacteria 88550
98 Ga0157370_10000357 3300013104 Bacteria 58140
99 Ga0157370_10088138 3300013104 Bacteria 2914
100 Ga0157370_10212189 3300013104 Bacteria 1794
101 Ga0157369_10000548 3300013105 Bacteria 49410
102 Ga0157369_10015970 3300013105 Bacteria 8448
103 Ga0157374_10000015 3300013296 Bacteria 296773
104 Ga0157374_10050831 3300013296 Bacteria 3854
105 Ga0163162_10000996 3300013306 Bacteria 26324
106 Ga0163162_10001020 3300013306 Bacteria 26011
107 Ga0163162_10061318 3300013306 Bacteria 3798
108 Ga0157372_10018137 3300013307 Bacteria 7566
109 Ga0157372_10254873 3300013307 Bacteria 2037
110 Ga0157375_10000204 3300013308 Bacteria 55063
111 Ga0157375_10026516 3300013308 Bacteria 5402
112 Ga0163163_10019821 3300014325 Bacteria 6325
113 Ga0163163_10045225 3300014325 Bacteria 4321
114 Ga0157376_10018223 3300014969 Bacteria 5376
115 Ga0157376_10186466 3300014969 Bacteria 1899
116 Ga0182005_1000280 3300015265 Bacteria 32088
117 Ga0163161_10000097 3300017792 Bacteria 84842
118 Ga0163161_10001157 3300017792 Bacteria 19859
119 Ga0209436_101063 3300025208 Bacteria 10401
120 Ga0207427_100043 3300025231 Bacteria 249595
121 Ga0209437_100170 3300025233 Bacteria 142489
122 Ga0209258_100156 3300025242 Bacteria 156926
123 Ga0209646_1000002 3300025246 Bacteria 1425781
124 Ga0209646_1000792 3300025246 Bacteria 10783
125 Ga0209026_1000216 3300025250 Bacteria 79756
126 Ga0209148_1000427 3300025254 Bacteria 46722
127 Ga0209233_1000507 3300025261 Bacteria 23118
128 Ga0209673_1000042 3300025273 Bacteria 300704
129 Ga0209564_1001060 3300025295 Bacteria 33431
130 Ga0209564_1010657 3300025295 Bacteria 4205
131 Ga0209758_1000776 3300025297 Bacteria 45865
132 Ga0209758_1001582 3300025297 Bacteria 26029
133 Ga0209758_1001657 3300025297 Bacteria 25246
134 Ga0209050_1000295 3300025298 Bacteria 104889
135 Ga0209050_1001552 3300025298 Bacteria 23993
136 Ga0209050_1006294 3300025298 Bacteria 7091
137 Ga0207426_1000002 3300025302 Bacteria 1249660
138 Ga0207426_1000236 3300025302 Bacteria 125348
139 Ga0207426_1000442 3300025302 Bacteria 66642
140 Ga0207426_1003634 3300025302 Bacteria 8161
141 Ga0207426_1004147 3300025302 Bacteria 7262
142 Ga0207426_1059582 3300025302 Bacteria 1103
143 Ga0209257_1000008 3300025304 Bacteria 1294570
144 Ga0209257_1001427 3300025304 Bacteria 28371
145 Ga0207655_1000381 3300025728 Bacteria 61849
146 Ga0207710_10006746 3300025900 Unclassified 4892
147 Ga0207680_10000028 3300025903 Bacteria 78965
148 Ga0207680_10005996 3300025903 Bacteria 5844
149 Ga0207654_10003321 3300025911 Bacteria 8142
150 Ga0207695_10000055 3300025913 Bacteria 382776
151 Ga0207695_10000394 3300025913 Bacteria 98403
152 Ga0207695_10011798 3300025913 Bacteria 10543
153 Ga0207695_10025316 3300025913 Bacteria 6647
154 Ga0207695_10100646 3300025913 Bacteria 2886
155 Ga0207695_10183823 3300025913 Bacteria 2010
156 Ga0207671_10002255 3300025914 Bacteria 20880
157 Ga0207671_10003215 3300025914 Bacteria 16442
158 Ga0207671_10004960 3300025914 Bacteria 12476
159 Ga0207671_10005309 3300025914 Bacteria 11938
160 Ga0207671_10005898 3300025914 Bacteria 11113
161 Ga0207671_10099735 3300025914 Bacteria 2198
162 Ga0207694_10073379 3300025924 Bacteria 2677
163 Ga0207689_10002127 3300025942 Bacteria 18634
164 Ga0207661_10074670 3300025944 Bacteria 2780
165 Ga0207667_10023941 3300025949 Bacteria 6717
166 Ga0207712_10007390 3300025961 Bacteria 6936
167 Ga0207712_10245782 3300025961 Bacteria 1444
168 Ga0207668_10210377 3300025972 Bacteria 1555
169 Ga0207640_10077169 3300025981 Bacteria 2264
170 Ga0207658_10058979 3300025986 Bacteria 2858
171 Ga0207703_10017544 3300026035 Bacteria 5588
172 Ga0207639_10517579 3300026041 Bacteria 1092
173 Ga0207641_10000122 3300026088 Bacteria 113915
174 Ga0207641_10034794 3300026088 Bacteria 4193
175 Ga0207676_10052533 3300026095 Bacteria 3186
176 Ga0207674_10367865 3300026116 Bacteria 1390
177 Ga0207698_10004856 3300026142 Bacteria 8237
178 Ga0268266_10000057 3300028379 Bacteria 284777
179 Ga0268265_10476767 3300028380 Bacteria 1171
180 Ga0268264_10000052 3300028381 Bacteria 321218
181 Ga0268264_10078741 3300028381 Bacteria 2811
182 Ga0307517_10006725 3300028786 Bacteria 16924
183 Ga0307515_10000001 3300028794 Bacteria 4259510
184 Ga0307515_10000349 3300028794 Bacteria 114163
185 Ga0307511_10000420 3300030521 Bacteria 45290
186 Ga0307511_10027075 3300030521 Bacteria 5242
187 Ga0307513_10362820 3300031456 Bacteria 1193
188 Ga0307509_10022093 3300031507 Bacteria 7183
189 Ga0307509_10050095 3300031507 Bacteria 4473
190 Ga0307509_10063263 3300031507 Bacteria 3896
191 Ga0307509_10161970 3300031507 Bacteria 2132
192 Ga0307508_10002261 3300031616 Bacteria 20539
193 Ga0307516_10000111 3300031730 Bacteria 94707
194 Ga0307516_10006146 3300031730 Bacteria 14149
195 Ga0307412_10215643 3300031911 Bacteria 1468
196 Ga0307414_10003164 3300032004 Bacteria 8750
197 Ga0307414_10004519 3300032004 Bacteria 7566
198 Ga0307411_10000001 3300032005 Bacteria 931810
199 Ga0307510_10000732 3300033180 Bacteria 33696
200 Ga0307510_10101067 3300033180 Bacteria 2674
201 Ga0373941_0023699 3300035115 Bacteria 1755
202 Ga0436361_1130390 3300039447 Bacteria 6681
203 Ga0439466_0064912 3300041411 Bacteria 1170
204 Ga0451800_1427131 3300041459 Bacteria 1215
205 Ga0466972_0030626 3300044658 Bacteria 2648
206 Ga0466957_0003101 3300044842 Bacteria 9044
207 Ga0495627_003189 3300046453 Bacteria 7380
208 Ga0495638_0000001 3300046460 Bacteria 1114121
209 Ga0495638_0000006 3300046460 Bacteria 668846
210 Ga0495638_0037372 3300046460 Bacteria 3089
211 Ga0495638_0119828 3300046460 Bacteria 1556
212 Ga0495638_0158859 3300046460 Bacteria 1306
213 Ga0495651_0240573 3300046462 Bacteria 1242
214 Ga0495606_0015028 3300046507 Bacteria 5996
215 Ga0495606_0047468 3300046507 Bacteria 2830
216 Ga0495606_0089864 3300046507 Unclassified 1891
217 Ga0495606_0093996 3300046507 Bacteria 1838
218 Ga0495606_0121745 3300046507 Bacteria 1561
219 Ga0495631_0008936 3300046518 Bacteria 5025
220 Ga0495643_0017309 3300046522 Bacteria 4215
221 Ga0495648_0092794 3300046524 Bacteria 1685
222 Ga0495587_0134518 3300046536 Bacteria 1413
223 Ga0495633_0000125 3300046558 Bacteria 104459
224 Ga0495668_0000134 3300046616 Bacteria 112135
225 Ga0495634_0261290 3300046642 Bacteria 1056
226 Ga0495658_0028457 3300046683 Unclassified 3017
227 Ga0495660_0024378 3300046810 Bacteria 3447
228 Ga0495636_0000008 3300047318 Bacteria 102958
229 Ga0495674_0167703 3300047319 Bacteria 1834
230 Ga0495672_0005880 3300047320 Bacteria 9618
231 Ga0495686_0000207 3300047472 Bacteria 109571
232 Ga0495686_0000524 3300047472 Bacteria 55256
233 Ga0495686_0001573 3300047472 Bacteria 24190
234 Ga0495686_0012328 3300047472 Bacteria 5984
235 Ga0495686_0024999 3300047472 Bacteria 3917
236 Ga0495686_0046953 3300047472 Bacteria 2728
237 Ga0495686_0123368 3300047472 Bacteria 1542
238 Ga0496118_0017262 3300048921 Bacteria 6581
239 Ga0496121_0000007 3300048924 Bacteria 942516
240 Ga0496124_0001953 3300048927 Bacteria 28156
241 Ga0496125_0067411 3300048928 Bacteria 2820
242 Ga0496126_0009572 3300048929 Bacteria 10277
243 Ga0496126_0242270 3300048929 Bacteria 1506
244 Ga0501047_0044700 3300049581 Unclassified 4281
245 Ga0501067_0040475 3300049583 Unclassified 2588
246 Ga0501069_0070933 3300049585 Unclassified 1952
247 Ga0501073_0016202 3300049589 Bacteria 5401
248 Ga0501074_0050900 3300049590 Bacteria 2990
249 Ga0501249_000184 3300049679 Bacteria 19067
250 Ga0501079_0054279 3300049741 Unclassified 3091
251 Ga0501266_000014 3300049763 Bacteria 181600
252 Ga0501044_0041334 3300049823 Unclassified 4799
253 Ga0500578_0000032 3300053086 Bacteria 138166
254 Ga0500578_0013116 3300053086 Bacteria 5343
255 Ga0500578_0035986 3300053086 Bacteria 3181
256 Ga0500644_0000017 3300053088 Bacteria 106518
257 Ga0500646_0004272 3300053090 Bacteria 3621
258 Ga0500646_0018971 3300053090 Bacteria 1816
259 Ga0500583_0000033 3300053092 Bacteria 99894
260 Ga0500583_0000046 3300053092 Bacteria 79163
261 Ga0500583_0005132 3300053092 Bacteria 4355
262 Ga0500641_0000020 3300053096 Bacteria 119591
263 Ga0500562_025804 3300053108 Unclassified 1539
264 Ga0500618_000006 3300053125 Bacteria 239188
265 Ga0500618_010903 3300053125 Bacteria 2425
266 Ga0500652_009357 3300053131 Bacteria 3312
267 Ga0500658_0000003 3300053134 Bacteria 512506
268 Ga0500658_0007785 3300053134 Bacteria 3958
269 Ga0500559_0004943 3300053136 Bacteria 6199
270 Ga0500559_0066192 3300053136 Bacteria 1620
271 Ga0500579_110605 3300053143 Bacteria 1384
272 Ga0500589_073234 3300053147 Bacteria 1545
273 Ga0500590_060727 3300053148 Bacteria 1900
274 Ga0500604_0000892 3300053151 Bacteria 8249
275 Ga0500616_0000044 3300053153 Bacteria 339611
276 Ga0500616_0002040 3300053153 Bacteria 17788
277 Ga0500616_0009468 3300053153 Bacteria 5926
278 Ga0500616_0015470 3300053153 Bacteria 4361
279 Ga0500622_0000009 3300053156 Bacteria 419980
280 Ga0500622_0000016 3300053156 Bacteria 337983
281 Ga0500622_0001601 3300053156 Bacteria 17779
282 Ga0500633_0001237 3300053160 Bacteria 4692
283 Ga0500634_0050630 3300053161 Unclassified 2237
284 Ga0500584_103144 3300053726 Bacteria 1170
285 Ga0500611_000035 3300053727 Bacteria 77351
286 Ga0500645_033302 3300053730 Bacteria 1543
287 Ga0501084_0007849 3300054114 Bacteria 8781
288 Ga0501082_0050541 3300060353 Bacteria 3584

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003323 rootH1_10044429 rootH1_100444293 266
2 3300049581 Ga0501047_0044700 Ga0501047_0044700_1617_2543 274
3 3300049583 Ga0501067_0040475 Ga0501067_0040475_43_969 274
4 3300049585 Ga0501069_0070933 Ga0501069_0070933_744_1688 274
5 3300049589 Ga0501073_0016202 Ga0501073_0016202_4119_5045 274
6 3300049590 Ga0501074_0050900 Ga0501074_0050900_607_1551 274
7 3300049741 Ga0501079_0054279 Ga0501079_0054279_1066_1992 274
8 3300049823 Ga0501044_0041334 Ga0501044_0041334_1649_2575 274
9 3300054114 Ga0501084_0007849 Ga0501084_0007849_681_1607 274
10 3300060353 Ga0501082_0050541 Ga0501082_0050541_102_1028 274
11 3300013296 Ga0157374_10050831 Ga0157374_100508314 277
12 3300053086 Ga0500578_0000032 Ga0500578_0000032_99123_100100 278
13 3300053108 Ga0500562_025804 Ga0500562_025804_333_1313 278
14 3300006237 Ga0097621_100154655 Ga0097621_1001546553 279
15 3300006358 Ga0068871_100202533 Ga0068871_1002025333 279
16 3300009551 Ga0105238_10020454 Ga0105238_100204546 279
17 3300010375 Ga0105239_10027441 Ga0105239_100274412 279
18 3300009551 Ga0105238_10226523 Ga0105238_102265233 281
19 3300025298 Ga0209050_1006294 Ga0209050_10062945 282
20 3300025913 Ga0207695_10100646 Ga0207695_101006461 282
21 3300005985 Ga0081539_10112800 Ga0081539_101128001 283
22 3300025298 Ga0209050_1001552 Ga0209050_100155213 285
23 3300025302 Ga0207426_1059582 Ga0207426_10595821 285
24 3300025913 Ga0207695_10011798 Ga0207695_100117983 285
25 3300046460 Ga0495638_0000006 Ga0495638_0000006_324957_325838 285
26 3300053153 Ga0500616_0000044 Ga0500616_0000044_100121_101002 285
27 3300053092 Ga0500583_0000046 Ga0500583_0000046_45319_46305 286
28 3300010375 Ga0105239_10017415 Ga0105239_1001741510 287
29 3300031730 Ga0307516_10006146 Ga0307516_100061464 288
30 3300053134 Ga0500658_0000003 Ga0500658_0000003_8734_9753 289
31 3300013307 Ga0157372_10018137 Ga0157372_100181371 291
32 3300025913 Ga0207695_10025316 Ga0207695_100253163 291
33 3300048929 Ga0496126_0009572 Ga0496126_0009572_8411_9430 291
34 3300053136 Ga0500559_0066192 Ga0500559_0066192_159_1178 291
35 iso_pu_bacteria 2818991442 2819576022 291
36 3300013296 Ga0157374_10000015 Ga0157374_1000001521 292
37 3300014969 Ga0157376_10018223 Ga0157376_100182233 292
38 3300009545 Ga0105237_10000697 Ga0105237_1000069735 293
39 3300025914 Ga0207671_10002255 Ga0207671_1000225514 293
40 3300046524 Ga0495648_0092794 Ga0495648_0092794_281_1210 293
41 3300046616 Ga0495668_0000134 Ga0495668_0000134_87455_88384 293
42 3300047320 Ga0495672_0005880 Ga0495672_0005880_4425_5420 293
43 3300053730 Ga0500645_033302 Ga0500645_033302_39_929 293
44 3300005471 Ga0070698_100109648 Ga0070698_1001096483 294
45 3300048924 Ga0496121_0000007 Ga0496121_0000007_726493_727401 294
46 3300005530 Ga0070679_100084010 Ga0070679_1000840102 295
47 3300053090 Ga0500646_0018971 Ga0500646_0018971_49_966 296
48 3300015265 Ga0182005_1000280 Ga0182005_100028011 297
49 3300025208 Ga0209436_101063 Ga0209436_1010632 297
50 3300025302 Ga0207426_1004147 Ga0207426_10041474 297
51 iso_pu_bacteria 2821136567 2821138560 297
52 iso_pu_bacteria 2904467357 2904469353 297
53 3300009174 Ga0105241_10313428 Ga0105241_103134281 298
54 3300047472 Ga0495686_0000524 Ga0495686_0000524_36501_37433 298
55 3300047472 Ga0495686_0024999 Ga0495686_0024999_594_1526 298
56 3300048921 Ga0496118_0017262 Ga0496118_0017262_1310_2329 298
57 3300053088 Ga0500644_0000017 Ga0500644_0000017_74990_75919 298
58 3300053148 Ga0500590_060727 Ga0500590_060727_620_1549 298
59 3300053160 Ga0500633_0001237 Ga0500633_0001237_1325_2254 298
60 3300053161 Ga0500634_0050630 Ga0500634_0050630_656_1585 298
61 3300003794 Ga0055531_10000063 Ga0055531_1000006312 299
62 3300014325 Ga0163163_10045225 Ga0163163_100452254 299
63 3300025304 Ga0209257_1000008 Ga0209257_1000008822 299
64 3300041411 Ga0439466_0064912 Ga0439466_0064912_128_1147 299
65 3300053086 Ga0500578_0013116 Ga0500578_0013116_3621_4598 299
66 3300053125 Ga0500618_010903 Ga0500618_010903_900_1841 299
67 3300010375 Ga0105239_10002974 Ga0105239_100029749 300
68 3300025242 Ga0209258_100156 Ga0209258_10015633 300
69 3300025254 Ga0209148_1000427 Ga0209148_100042720 300
70 3300030521 Ga0307511_10027075 Ga0307511_100270755 300
71 3300048929 Ga0496126_0242270 Ga0496126_0242270_317_1246 300
72 3300009093 Ga0105240_10000200 Ga0105240_1000020087 301
73 3300009545 Ga0105237_10003110 Ga0105237_100031108 301
74 3300009551 Ga0105238_10105857 Ga0105238_101058573 301
75 3300010375 Ga0105239_10002939 Ga0105239_100029399 301
76 3300013102 Ga0157371_10035601 Ga0157371_100356013 301
77 3300013105 Ga0157369_10000548 Ga0157369_1000054818 301
78 3300017792 Ga0163161_10000097 Ga0163161_1000009773 301
79 3300025913 Ga0207695_10000055 Ga0207695_1000005588 301
80 3300025914 Ga0207671_10003215 Ga0207671_100032156 301
81 3300025924 Ga0207694_10073379 Ga0207694_100733792 301
82 3300044658 Ga0466972_0030626 Ga0466972_0030626_976_1902 301
83 3300048927 Ga0496124_0001953 Ga0496124_0001953_25194_26213 301
84 3300053136 Ga0500559_0004943 Ga0500559_0004943_976_2001 301
85 3300053156 Ga0500622_0001601 Ga0500622_0001601_6563_7495 301
86 3300002737 JGI25162J39368_1000929 JGI25162J39368_100092914 302
87 3300002772 JGI25164J39214_1002109 JGI25164J39214_10021096 302
88 3300003214 JGI25165J46597_1003458 JGI25165J46597_10034582 302
89 3300003322 rootL2_10165254 rootL2_101652543 302
90 3300005347 Ga0070668_100094369 Ga0070668_1000943692 302
91 3300005539 Ga0068853_100151017 Ga0068853_1001510172 302
92 3300009093 Ga0105240_10138284 Ga0105240_101382842 302
93 3300013102 Ga0157371_10002120 Ga0157371_1000212019 302
94 3300013104 Ga0157370_10088138 Ga0157370_100881383 302
95 3300013105 Ga0157369_10015970 Ga0157369_100159703 302
96 3300025231 Ga0207427_100043 Ga0207427_100043103 302
97 3300025233 Ga0209437_100170 Ga0209437_10017017 302
98 3300025261 Ga0209233_1000507 Ga0209233_100050716 302
99 3300025913 Ga0207695_10183823 Ga0207695_101838232 302
100 3300028794 Ga0307515_10000349 Ga0307515_1000034955 302
101 3300031507 Ga0307509_10050095 Ga0307509_100500954 302
102 3300031911 Ga0307412_10215643 Ga0307412_102156432 302
103 3300032004 Ga0307414_10003164 Ga0307414_100031643 302
104 3300032004 Ga0307414_10004519 Ga0307414_100045193 302
105 3300046507 Ga0495606_0093996 Ga0495606_0093996_525_1454 302
106 3300047472 Ga0495686_0001573 Ga0495686_0001573_21379_22308 302
107 3300047472 Ga0495686_0046953 Ga0495686_0046953_134_1063 302
108 3300047472 Ga0495686_0123368 Ga0495686_0123368_490_1419 302
109 iso_pu_bacteria 2977232053 2977232084 302
110 3300003323 rootH1_10035571 rootH1_100355713 303
111 3300003354 JGI25160J50197_1004097 JGI25160J50197_10040973 303
112 3300005366 Ga0070659_100395293 Ga0070659_1003952931 303
113 3300009545 Ga0105237_10057831 Ga0105237_100578314 303
114 3300010375 Ga0105239_10000146 Ga0105239_1000014667 303
115 3300010375 Ga0105239_10291851 Ga0105239_102918512 303
116 3300013104 Ga0157370_10000135 Ga0157370_100001352 303
117 3300013306 Ga0163162_10061318 Ga0163162_100613182 303
118 3300025302 Ga0207426_1000002 Ga0207426_1000002428 303
119 3300025914 Ga0207671_10004960 Ga0207671_100049605 303
120 3300028380 Ga0268265_10476767 Ga0268265_104767671 303
121 3300035115 Ga0373941_0023699 Ga0373941_0023699_479_1411 303
122 3300046507 Ga0495606_0089864 Ga0495606_0089864_45_1040 303
123 3300046507 Ga0495606_0121745 Ga0495606_0121745_270_1202 303
124 3300046810 Ga0495660_0024378 Ga0495660_0024378_2268_3200 303
125 3300053125 Ga0500618_000006 Ga0500618_000006_35122_36054 303
126 3300005329 Ga0070683_100025175 Ga0070683_1000251758 304
127 3300009093 Ga0105240_10009778 Ga0105240_100097782 304
128 3300013307 Ga0157372_10254873 Ga0157372_102548732 304
129 3300025913 Ga0207695_10000394 Ga0207695_1000039412 304
130 3300025944 Ga0207661_10074670 Ga0207661_100746704 304
131 3300039447 Ga0436361_1130390 Ga0436361_1130390_1791_2735 304
132 3300009545 Ga0105237_10013640 Ga0105237_100136402 305
133 3300025914 Ga0207671_10005309 Ga0207671_1000530910 305
134 3300003322 rootL2_10107380 rootL2_101073803 306
135 3300005578 Ga0068854_100092555 Ga0068854_1000925552 306
136 3300025981 Ga0207640_10077169 Ga0207640_100771692 306
137 3300030521 Ga0307511_10000420 Ga0307511_1000042042 306
138 3300031507 Ga0307509_10161970 Ga0307509_101619702 306
139 3300003320 rootH2_10078366 rootH2_100783662 307
140 3300003323 rootH1_10330645 rootH1_103306452 307
141 3300005334 Ga0068869_100006380 Ga0068869_1000063805 307
142 3300005335 Ga0070666_10000065 Ga0070666_1000006520 307
143 3300005338 Ga0068868_100158040 Ga0068868_1001580402 307
144 3300005353 Ga0070669_100274352 Ga0070669_1002743521 307
145 3300005364 Ga0070673_100045626 Ga0070673_1000456264 307
146 3300005367 Ga0070667_100029722 Ga0070667_1000297222 307
147 3300005616 Ga0068852_100024346 Ga0068852_1000243464 307
148 3300005617 Ga0068859_100000006 Ga0068859_100000006309 307
149 3300005618 Ga0068864_100082295 Ga0068864_1000822952 307
150 3300005841 Ga0068863_100001205 Ga0068863_1000012055 307
151 3300005842 Ga0068858_100012081 Ga0068858_1000120816 307
152 3300006931 Ga0097620_100000006 Ga0097620_100000006309 307
153 3300009098 Ga0105245_10103928 Ga0105245_101039283 307
154 3300009101 Ga0105247_10001377 Ga0105247_100013775 307
155 3300009174 Ga0105241_10000243 Ga0105241_1000024337 307
156 3300009545 Ga0105237_10015034 Ga0105237_100150344 307
157 3300009553 Ga0105249_10013166 Ga0105249_100131662 307
158 3300010375 Ga0105239_10182695 Ga0105239_101826951 307
159 3300013306 Ga0163162_10000996 Ga0163162_100009967 307
160 3300013308 Ga0157375_10026516 Ga0157375_100265165 307
161 3300014325 Ga0163163_10019821 Ga0163163_100198216 307
162 3300025900 Ga0207710_10006746 Ga0207710_100067464 307
163 3300025903 Ga0207680_10000028 Ga0207680_1000002814 307
164 3300025911 Ga0207654_10003321 Ga0207654_100033214 307
165 3300025914 Ga0207671_10005898 Ga0207671_100058984 307
166 3300025942 Ga0207689_10002127 Ga0207689_1000212716 307
167 3300025961 Ga0207712_10245782 Ga0207712_102457821 307
168 3300025972 Ga0207668_10210377 Ga0207668_102103772 307
169 3300025986 Ga0207658_10058979 Ga0207658_100589792 307
170 3300026035 Ga0207703_10017544 Ga0207703_100175443 307
171 3300026088 Ga0207641_10000122 Ga0207641_1000012230 307
172 3300026095 Ga0207676_10052533 Ga0207676_100525332 307
173 3300026142 Ga0207698_10004856 Ga0207698_100048565 307
174 3300028786 Ga0307517_10006725 Ga0307517_100067255 307
175 3300032005 Ga0307411_10000001 Ga0307411_1000000197 307
176 3300046460 Ga0495638_0000001 Ga0495638_0000001_746525_747478 307
177 3300046518 Ga0495631_0008936 Ga0495631_0008936_4021_4983 307
178 3300047318 Ga0495636_0000008 Ga0495636_0000008_79658_80605 307
179 3300049679 Ga0501249_000184 Ga0501249_000184_7699_8718 307
180 3300049763 Ga0501266_000014 Ga0501266_000014_73891_74910 307
181 3300053153 Ga0500616_0002040 Ga0500616_0002040_6003_7001 307
182 3300003322 rootL2_10145093 rootL2_101450934 308
183 3300003323 rootH1_10148868 rootH1_101488682 308
184 3300005563 Ga0068855_100131982 Ga0068855_1001319823 308
185 3300005577 Ga0068857_100419741 Ga0068857_1004197412 308
186 3300005843 Ga0068860_100126071 Ga0068860_1001260712 308
187 3300026116 Ga0207674_10367865 Ga0207674_103678652 308
188 3300028381 Ga0268264_10078741 Ga0268264_100787413 308
189 3300033180 Ga0307510_10101067 Ga0307510_101010674 308
190 3300053153 Ga0500616_0009468 Ga0500616_0009468_308_1264 308
191 3300046558 Ga0495633_0000125 Ga0495633_0000125_53403_54338 309
192 3300053092 Ga0500583_0000033 Ga0500583_0000033_55736_56692 309
193 3300053134 Ga0500658_0007785 Ga0500658_0007785_187_1203 309
194 3300053143 Ga0500579_110605 Ga0500579_110605_36_992 309
195 3300053153 Ga0500616_0015470 Ga0500616_0015470_1902_2918 309
196 3300028794 Ga0307515_10000001 Ga0307515_10000001796 310
197 3300033180 Ga0307510_10000732 Ga0307510_100007328 310
198 3300046462 Ga0495651_0240573 Ga0495651_0240573_129_1193 310
199 3300046536 Ga0495587_0134518 Ga0495587_0134518_133_1170 310
200 3300046642 Ga0495634_0261290 Ga0495634_0261290_50_1045 310
201 3300046683 Ga0495658_0028457 Ga0495658_0028457_1941_3005 310
202 3300005288 Ga0065714_10069721 Ga0065714_100697212 311
203 3300005841 Ga0068863_100059210 Ga0068863_1000592102 311
204 3300014969 Ga0157376_10186466 Ga0157376_101864663 311
205 3300026088 Ga0207641_10034794 Ga0207641_100347944 311
206 3300031456 Ga0307513_10362820 Ga0307513_103628202 311
207 3300047319 Ga0495674_0167703 Ga0495674_0167703_152_1123 311
208 3300003323 rootH1_10004815 rootH1_100048155 312
209 3300009551 Ga0105238_10020429 Ga0105238_100204295 312
210 3300013104 Ga0157370_10000357 Ga0157370_1000035718 312
211 3300009553 Ga0105249_10011736 Ga0105249_100117363 313
212 3300025961 Ga0207712_10007390 Ga0207712_100073904 313
213 iso_pu_bacteria 2919191525 2919193901 313
214 3300003322 rootL2_10133601 rootL2_101336011 314
215 3300003322 rootL2_10292965 rootL2_102929651 314
216 3300005288 Ga0065714_10002676 Ga0065714_1000267611 314
217 3300005471 Ga0070698_100112766 Ga0070698_1001127662 314
218 3300009553 Ga0105249_10006464 Ga0105249_1000646410 314
219 3300025246 Ga0209646_1000792 Ga0209646_10007922 314
220 3300046460 Ga0495638_0119828 Ga0495638_0119828_180_1202 314
221 3300053096 Ga0500641_0000020 Ga0500641_0000020_93893_94900 314
222 3300053727 Ga0500611_000035 Ga0500611_000035_2728_3750 314
223 iso_pu_bacteria 2929239360 2929240115 314
224 3300013308 Ga0157375_10000204 Ga0157375_1000020444 315
225 3300031730 Ga0307516_10000111 Ga0307516_1000011172 315
226 3300048928 Ga0496125_0067411 Ga0496125_0067411_794_1798 315
227 3300053086 Ga0500578_0035986 Ga0500578_0035986_726_1718 315
228 3300053131 Ga0500652_009357 Ga0500652_009357_399_1382 315
229 3300003323 rootH1_10006200 rootH1_1000620010 316
230 3300005293 Ga0065715_10133316 Ga0065715_101333161 316
231 3300005563 Ga0068855_100028195 Ga0068855_1000281952 316
232 3300005843 Ga0068860_100000034 Ga0068860_10000003473 316
233 3300009545 Ga0105237_10021772 Ga0105237_100217725 316
234 3300010375 Ga0105239_10015104 Ga0105239_100151044 316
235 3300013306 Ga0163162_10001020 Ga0163162_1000102015 316
236 3300017792 Ga0163161_10001157 Ga0163161_1000115711 316
237 3300025728 Ga0207655_1000381 Ga0207655_100038140 316
238 3300025914 Ga0207671_10099735 Ga0207671_100997352 316
239 3300025949 Ga0207667_10023941 Ga0207667_100239416 316
240 3300026041 Ga0207639_10517579 Ga0207639_105175791 316
241 3300028381 Ga0268264_10000052 Ga0268264_10000052235 316
242 3300031616 Ga0307508_10002261 Ga0307508_1000226112 316
243 3300044842 Ga0466957_0003101 Ga0466957_0003101_6200_7186 316
244 3300046453 Ga0495627_003189 Ga0495627_003189_1069_2079 316
245 3300046460 Ga0495638_0037372 Ga0495638_0037372_2018_3028 316
246 3300046507 Ga0495606_0015028 Ga0495606_0015028_2200_3201 316
247 3300046507 Ga0495606_0047468 Ga0495606_0047468_923_1933 316
248 3300046522 Ga0495643_0017309 Ga0495643_0017309_1168_2196 316
249 3300047472 Ga0495686_0000207 Ga0495686_0000207_19482_20492 316
250 3300053726 Ga0500584_103144 Ga0500584_103144_111_1124 316
251 iso_pu_bacteria 2643221716 2644640301 316
252 iso_pu_bacteria 2738541278 2738729253 316
253 iso_pu_bacteria 2738541279 2738736527 316
254 iso_pu_bacteria 2738541285 2738766834 316
255 iso_pu_bacteria 2738543007 2739218109 316
256 iso_pu_bacteria 2739367858 2740005989 316
257 iso_pu_bacteria 2818991444 2819587505 316
258 iso_pu_bacteria 2904555929 2904560045 316
259 iso_pu_bacteria 2919191525 2919196206 316
260 iso_pu_bacteria 8003151029 8003153575 316
261 3300001989 JGI24739J22299_10000953 JGI24739J22299_100009536 317
262 3300003354 JGI25160J50197_1000859 JGI25160J50197_100085910 317
263 3300003771 Ga0055526_1008426 Ga0055526_10084263 317
264 3300003790 Ga0055528_1000435 Ga0055528_100043522 317
265 3300003791 Ga0055530_10000650 Ga0055530_1000065014 317
266 3300003794 Ga0055531_10034575 Ga0055531_100345752 317
267 3300004625 Ga0055543_1015647 Ga0055543_10156472 317
268 3300005262 Ga0065165_1000358 Ga0065165_100035863 317
269 3300009093 Ga0105240_10012738 Ga0105240_100127387 317
270 3300013102 Ga0157371_10111689 Ga0157371_101116892 317
271 3300025273 Ga0209673_1000042 Ga0209673_1000042136 317
272 3300025295 Ga0209564_1001060 Ga0209564_100106012 317
273 3300025295 Ga0209564_1010657 Ga0209564_10106572 317
274 3300025297 Ga0209758_1001582 Ga0209758_100158218 317
275 3300025297 Ga0209758_1001657 Ga0209758_100165717 317
276 3300025298 Ga0209050_1000295 Ga0209050_100029580 317
277 3300025302 Ga0207426_1000442 Ga0207426_100044241 317
278 3300025302 Ga0207426_1003634 Ga0207426_10036342 317
279 3300025304 Ga0209257_1001427 Ga0209257_100142728 317
280 3300025903 Ga0207680_10005996 Ga0207680_100059964 317
281 3300028379 Ga0268266_10000057 Ga0268266_1000005781 317
282 3300041459 Ga0451800_1427131 Ga0451800_1427131_193_1188 317
283 3300046460 Ga0495638_0158859 Ga0495638_0158859_178_1173 317
284 3300047472 Ga0495686_0012328 Ga0495686_0012328_3676_4683 317
285 3300053090 Ga0500646_0004272 Ga0500646_0004272_946_1941 317
286 3300053092 Ga0500583_0005132 Ga0500583_0005132_540_1535 317
287 3300053147 Ga0500589_073234 Ga0500589_073234_372_1367 317
288 3300031507 Ga0307509_10022093 Ga0307509_100220935 318
289 3300031507 Ga0307509_10063263 Ga0307509_100632632 318
290 3300003322 rootL2_10018760 rootL2_100187603 319
291 3300053151 Ga0500604_0000892 Ga0500604_0000892_429_1433 319
292 3300053156 Ga0500622_0000009 Ga0500622_0000009_17239_18252 319
293 3300053156 Ga0500622_0000016 Ga0500622_0000016_36107_37141 319
294 3300001979 JGI24740J21852_10001028 JGI24740J21852_100010282 320
295 3300002738 JGI25154J39366_1000065 JGI25154J39366_100006581 320
296 3300002741 JGI25157J39369_1003668 JGI25157J39369_10036682 320
297 3300003215 JGI25153J46596_10000355 JGI25153J46596_1000035516 320
298 3300003320 rootH2_10152486 rootH2_101524862 320
299 3300003354 JGI25160J50197_1002676 JGI25160J50197_10026762 320
300 3300013104 Ga0157370_10212189 Ga0157370_102121891 320
301 3300025246 Ga0209646_1000002 Ga0209646_10000021207 320
302 3300025250 Ga0209026_1000216 Ga0209026_100021616 320
303 3300025297 Ga0209758_1000776 Ga0209758_100077627 320
304 3300025302 Ga0207426_1000236 Ga0207426_100023658 320

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

98

238

0.92

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

100

341

0.62

Structural Annotation

Top 5 Hits

ID Description Score Start End
7jqy-assembly1.cif.gz_B crystal structure of cfl1-d123s from burkholderia cenocepacia 0.941 38 318
7jqx-assembly1.cif.gz_A crystal structure of cfl1 wild-type from burkholderia cenocepacia 0.9409 38 318
4dmf-assembly1.cif.gz_B crystal structure of the cftr inhibitory factor cif with the h177a mutation 0.9365 40 318
3kd2-assembly2.cif.gz_C crystal structure of the cftr inhibitory factor cif 0.9363 40 318
4dmk-assembly1.cif.gz_A crystal structure of the cftr inhibitory factor cif with the y239f mutation 0.9362 40 317
ID Description Score Start End Superfamily
af_A0A0R0KMM0_1_93_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9435 45 130 3.40.50.12270
3kd2B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9266 46 316 3.40.50.1820
4mebB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9227 41 316 3.40.50.1820
af_Q9NQF3_11_190_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9125 47 157 3.40.50.1820
3b12A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9119 44 317 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A7W0ZFJ5-F1-model_v4 Alpha/beta fold hydrolase 0.9759 44 166 GO:0016020
GO:0016787
AF-A0A7W3NIE9-F1-model_v4 Pimeloyl-ACP methyl ester carboxylesterase 0.971 47 160
AF-A0A424MLM0-F1-model_v4 Alpha/beta fold hydrolase 0.9677 40 150 GO:0016787
AF-A0A2N2YBN3-F1-model_v4 Alpha/beta hydrolase 0.9645 47 160 GO:0016020
GO:0016787
AF-A0A2V6XQ55-F1-model_v4 Rhodanese domain-containing protein 0.9641 49 160 GO:0016787

Feature Viewer

pLDDT pTM Quality
89.44 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map