F397587

General Info

Members Datasets Scaffolds Average Seq Length
304 206 608 253

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10526132|Ga0163162_105261322
Length 299
Sequence MSFEQGGPAATTRWQGGLAVTPAHAGRADEVATGDGGGGRVTEFVRLEVDGGVGTIRLDRPPMNAISRAVGDELRSVAAEATARDDVRAVIVYGGEKVFAAGADVKEMASLTYAEMAPIARSVSAGLGALAGIPKPTVAAITGYALGGGLEVVLTCDRRIAADNATLGVPEILLGIIPGGGGTQRLARLVGPARAKDMVYTGRFVRADEALAIGLVDELVPAADVYARARAYVEPFAHGPALAYAAAKKAIDGGLDVDLRTGLDIESDQFAGLFATDDQRIGMASFVEHGPGKAQFTGR

Samples

Sample ID Description Type Environment
1 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
75 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
115 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
116 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
117 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
118 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
119 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
120 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
121 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
122 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
123 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
124 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
125 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
128 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
129 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
130 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
131 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
132 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
133 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
134 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
135 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
136 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
137 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
138 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
139 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
140 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
141 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
142 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
143 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
144 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
145 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
146 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
147 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
148 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
149 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
154 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
155 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
156 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
174 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
175 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
176 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
177 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
178 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
179 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
181 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
182 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
183 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
184 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
185 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
186 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
187 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
188 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
189 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
190 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
191 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
192 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
193 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
194 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
195 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
196 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
197 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
198 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
199 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
200 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
201 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
202 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
203 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
204 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
205 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
206 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.38
Metatranscriptomes 0.66
Isolates 2.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.61
Nodule 0
Rhizoplane 6.91
Rhizosphere 83.55
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163162_10526132 3300013306 Bacteria 1312
2 Ga0070683_100367312 3300005329 Bacteria 1370
3 Ga0070670_100173445 3300005331 Bacteria 1871
4 Ga0070680_100092772 3300005336 Bacteria 2501
5 Ga0070680_100173565 3300005336 Bacteria 1815
6 Ga0070682_100022600 3300005337 Bacteria 3727
7 Ga0068868_100236811 3300005338 Bacteria 1533
8 Ga0068868_100496980 3300005338 Bacteria 1068
9 Ga0070691_10156806 3300005341 Bacteria 1171
10 Ga0070687_100073237 3300005343 Bacteria 1846
11 Ga0070661_100048024 3300005344 Bacteria 3124
12 Ga0070692_10005752 3300005345 Bacteria 5325
13 Ga0070668_100001660 3300005347 Bacteria 16146
14 Ga0070669_100116699 3300005353 Bacteria 2032
15 Ga0070675_100064529 3300005354 Bacteria 3027
16 Ga0070674_100144277 3300005356 Bacteria 1790
17 Ga0070673_100037863 3300005364 Bacteria 3679
18 Ga0070659_100014601 3300005366 Bacteria 5872
19 Ga0070659_100040425 3300005366 Bacteria 3644
20 Ga0070714_100070621 3300005435 Bacteria 3019
21 Ga0070714_100245433 3300005435 Bacteria 1654
22 Ga0070701_10014104 3300005438 Bacteria 3655
23 Ga0070700_100021918 3300005441 Bacteria 3718
24 Ga0070663_100151044 3300005455 Bacteria 1781
25 Ga0070681_10061384 3300005458 Bacteria 3734
26 Ga0070681_10100373 3300005458 Bacteria 2840
27 Ga0068867_100009302 3300005459 Bacteria 6931
28 Ga0070685_10422447 3300005466 Bacteria 928
29 Ga0070706_100698069 3300005467 Bacteria 941
30 Ga0070679_100465652 3300005530 Bacteria 1208
31 Ga0070684_100021214 3300005535 Bacteria 5400
32 Ga0070684_100086671 3300005535 Bacteria 2779
33 Ga0070684_100229369 3300005535 Bacteria 1695
34 Ga0068853_100171336 3300005539 Bacteria 1964
35 Ga0070672_100010075 3300005543 Bacteria 6543
36 Ga0070686_100069836 3300005544 Bacteria 2295
37 Ga0070665_100231440 3300005548 Bacteria 1848
38 Ga0070664_100015036 3300005564 Bacteria 6317
39 Ga0068857_100244141 3300005577 Bacteria 1645
40 Ga0068854_100042222 3300005578 Bacteria 3227
41 Ga0068856_100407091 3300005614 Bacteria 1380
42 Ga0070702_100335843 3300005615 Bacteria 1058
43 Ga0068852_100050000 3300005616 Bacteria 3579
44 Ga0068859_100185139 3300005617 Bacteria 2166
45 Ga0068864_100183366 3300005618 Bacteria 1915
46 Ga0068864_100276962 3300005618 Bacteria 1565
47 Ga0068866_10029247 3300005718 Bacteria 2633
48 Ga0068870_10015852 3300005840 Bacteria 3586
49 Ga0068870_10250317 3300005840 Bacteria 1098
50 Ga0068863_100023016 3300005841 Bacteria 5955
51 Ga0068860_100288546 3300005843 Bacteria 1605
52 Ga0081455_10000018 3300005937 Bacteria 173683
53 Ga0070717_10097125 3300006028 Bacteria 2496
54 Ga0075365_10171074 3300006038 Bacteria 1516
55 Ga0075368_10004514 3300006042 Bacteria 4727
56 Ga0075363_100010506 3300006048 Bacteria 4401
57 Ga0075367_10072372 3300006178 Bacteria 2075
58 Ga0075428_100069121 3300006844 Bacteria 3863
59 Ga0075430_100000172 3300006846 Bacteria 42600
60 Ga0075430_100011555 3300006846 Bacteria 7507
61 Ga0075431_100048735 3300006847 Bacteria 4369
62 Ga0075431_100283322 3300006847 Bacteria 1678
63 Ga0075431_100399286 3300006847 Bacteria 1376
64 Ga0075433_10390604 3300006852 Bacteria 1228
65 Ga0075429_100020736 3300006880 Bacteria 5705
66 Ga0075429_100038767 3300006880 Bacteria 4148
67 Ga0068865_100001007 3300006881 Bacteria 16180
68 Ga0097620_100185137 3300006931 Bacteria 2166
69 Ga0111539_10189555 3300009094 Bacteria 2400
70 Ga0105245_10044697 3300009098 Bacteria 3954
71 Ga0105245_10077377 3300009098 Bacteria 3033
72 Ga0114129_10000056 3300009147 Bacteria 99329
73 Ga0114129_10001688 3300009147 Bacteria 30106
74 Ga0114129_10052886 3300009147 Bacteria 5699
75 Ga0114129_10223237 3300009147 Bacteria 2541
76 Ga0105243_10023226 3300009148 Bacteria 4720
77 Ga0105242_10416479 3300009176 Bacteria 1258
78 Ga0105248_10014374 3300009177 Bacteria 8712
79 Ga0105248_10092568 3300009177 Bacteria 3405
80 Ga0105238_10204432 3300009551 Bacteria 1951
81 Ga0105249_10016947 3300009553 Bacteria 6464
82 Ga0105249_10178046 3300009553 Bacteria 2067
83 Ga0105239_10246444 3300010375 Bacteria 2006
84 Ga0157371_10007167 3300013102 Bacteria 9058
85 Ga0157371_10220231 3300013102 Bacteria 1363
86 Ga0157369_10002337 3300013105 Bacteria 22828
87 Ga0157369_10005679 3300013105 Bacteria 14496
88 Ga0157372_10047529 3300013307 Bacteria 4769
89 Ga0157375_10067162 3300013308 Bacteria 3582
90 Ga0163163_10035229 3300014325 Bacteria 4855
91 Ga0163163_10502645 3300014325 Bacteria 1274
92 Ga0157380_10045220 3300014326 Bacteria 3454
93 Ga0157377_10023451 3300014745 Bacteria 3271
94 Ga0163161_10310242 3300017792 Bacteria 1244
95 Ga0206353_12064211 3300020082 Bacteria 1326
96 Ga0213875_10000097 3300021388 Bacteria 101618
97 Ga0224712_10113681 3300022467 Bacteria 1164
98 Ga0207688_10008385 3300025901 Bacteria 5621
99 Ga0207688_10222301 3300025901 Bacteria 1138
100 Ga0207647_10138957 3300025904 Bacteria 1424
101 Ga0207643_10007206 3300025908 Bacteria 5970
102 Ga0207705_10004774 3300025909 Bacteria 10205
103 Ga0207705_10033518 3300025909 Bacteria 3670
104 Ga0207707_10129264 3300025912 Bacteria 2209
105 Ga0207707_10386463 3300025912 Bacteria 1203
106 Ga0207660_10129494 3300025917 Bacteria 1919
107 Ga0207662_10064507 3300025918 Bacteria 2204
108 Ga0207657_10128467 3300025919 Bacteria 2079
109 Ga0207657_10180823 3300025919 Bacteria 1705
110 Ga0207649_10116944 3300025920 Bacteria 1791
111 Ga0207652_10019949 3300025921 Bacteria 5520
112 Ga0207652_10116078 3300025921 Bacteria 2378
113 Ga0207681_10112624 3300025923 Bacteria 1982
114 Ga0207694_10098678 3300025924 Bacteria 2313
115 Ga0207687_10079422 3300025927 Bacteria 2366
116 Ga0207687_10095217 3300025927 Bacteria 2180
117 Ga0207664_10125923 3300025929 Bacteria 2151
118 Ga0207664_10269582 3300025929 Bacteria 1491
119 Ga0207690_10000222 3300025932 Bacteria 42867
120 Ga0207690_10026297 3300025932 Bacteria 3663
121 Ga0207690_10034927 3300025932 Bacteria 3242
122 Ga0207690_10048308 3300025932 Bacteria 2829
123 Ga0207709_10028352 3300025935 Bacteria 3237
124 Ga0207669_10003700 3300025937 Bacteria 6652
125 Ga0207691_10003397 3300025940 Bacteria 15481
126 Ga0207711_10262910 3300025941 Bacteria 1586
127 Ga0207689_10152740 3300025942 Bacteria 1903
128 Ga0207661_10032212 3300025944 Bacteria 4058
129 Ga0207661_10095263 3300025944 Bacteria 2488
130 Ga0207661_10535502 3300025944 Bacteria 1072
131 Ga0207667_10289485 3300025949 Bacteria 1674
132 Ga0207712_10021181 3300025961 Bacteria 4265
133 Ga0207668_10007375 3300025972 Bacteria 6536
134 Ga0207640_10074685 3300025981 Bacteria 2295
135 Ga0207658_10171215 3300025986 Bacteria 1789
136 Ga0207639_10131204 3300026041 Bacteria 2074
137 Ga0207678_10242171 3300026067 Bacteria 1545
138 Ga0207708_10000180 3300026075 Bacteria 49555
139 Ga0207641_10026907 3300026088 Bacteria 4749
140 Ga0207648_10005348 3300026089 Bacteria 12943
141 Ga0207648_10346843 3300026089 Bacteria 1338
142 Ga0207676_10114459 3300026095 Bacteria 2263
143 Ga0207674_10016918 3300026116 Bacteria 7964
144 Ga0207675_100006710 3300026118 Bacteria 10882
145 Ga0207683_10348799 3300026121 Bacteria 1358
146 Ga0207698_10324524 3300026142 Bacteria 1443
147 Ga0268265_10039794 3300028380 Bacteria 3467
148 Ga0268264_10241664 3300028381 Bacteria 1673
149 Ga0307515_10040352 3300028794 Bacteria 7384
150 Ga0307515_10398800 3300028794 Bacteria 1002
151 Ga0316182_1440866 3300030745 Bacteria 11079
152 Ga0307508_10177656 3300031616 Bacteria 1732
153 Ga0307508_10286002 3300031616 Bacteria 1242
154 Ga0307406_10040163 3300031901 Bacteria 2908
155 Ga0307406_10052351 3300031901 Bacteria 2596
156 Ga0307407_10177107 3300031903 Bacteria 1410
157 Ga0307409_100031403 3300031995 Bacteria 3833
158 Ga0307409_100271503 3300031995 Bacteria 1562
159 Ga0307409_100709961 3300031995 Bacteria 1006
160 Ga0307415_100493061 3300032126 Bacteria 1069
161 Ga0307415_100558199 3300032126 Bacteria 1012
162 Ga0307507_10071798 3300033179 Bacteria 3126
163 Ga0307507_10092110 3300033179 Bacteria 2590
164 Ga0373940_0001863 3300035088 Bacteria 3959
165 Ga0373942_0001291 3300035207 Bacteria 6556
166 Ga0373962_0002388 3300035242 Bacteria 4476
167 Ga0373931_0083300 3300035691 Bacteria 1769
168 Ga0373931_0255052 3300035691 Bacteria 1068
169 Ga0395898_0155351 3300037466 Bacteria 2188
170 Ga0395905_0064826 3300037471 Bacteria 3420
171 Ga0436364_0296067 3300037853 Bacteria 138817
172 Ga0436364_1246252 3300037853 Bacteria 3091
173 Ga0436365_0218752 3300039437 Bacteria 2787
174 Ga0439463_071463 3300042016 Bacteria 889
175 Ga0450900_007692 3300042136 Bacteria 1333
176 Ga0439464_0081326 3300042439 Bacteria 968
177 Ga0466969_0027675 3300044656 Bacteria 2902
178 Ga0466969_0054447 3300044656 Bacteria 1959
179 Ga0466965_0103929 3300044683 Bacteria 1455
180 Ga0466965_0129042 3300044683 Bacteria 1310
181 Ga0466966_0004593 3300044684 Bacteria 9097
182 Ga0466966_0020375 3300044684 Bacteria 4361
183 Ga0466966_0034700 3300044684 Bacteria 3261
184 Ga0466966_0065143 3300044684 Bacteria 2292
185 Ga0466961_0023170 3300044693 Bacteria 3993
186 Ga0466961_0361108 3300044693 Bacteria 883
187 Ga0466963_0011026 3300044694 Bacteria 5495
188 Ga0466963_0038686 3300044694 Bacteria 3121
189 Ga0466963_0045674 3300044694 Bacteria 2885
190 Ga0466971_0011030 3300044719 Bacteria 3956
191 Ga0466971_0067573 3300044719 Bacteria 1620
192 Ga0466971_0138545 3300044719 Bacteria 1132
193 Ga0466970_0134564 3300044765 Bacteria 1359
194 Ga0466957_0016575 3300044842 Bacteria 4309
195 Ga0466960_0245356 3300044901 Bacteria 993
196 Ga0466959_0004629 3300045049 Bacteria 9249
197 Ga0466959_0029690 3300045049 Bacteria 4051
198 Ga0466959_0062668 3300045049 Bacteria 2701
199 Ga0466958_0008909 3300045836 Bacteria 5575
200 Ga0466958_0022683 3300045836 Bacteria 3680
201 Ga0466958_0042354 3300045836 Bacteria 2742
202 Ga0466958_0071462 3300045836 Bacteria 2125
203 Ga0466958_0119322 3300045836 Bacteria 1650
204 Ga0466967_0032405 3300045976 Bacteria 4413
205 Ga0466967_0041283 3300045976 Bacteria 3977
206 Ga0466967_0066800 3300045976 Bacteria 3205
207 Ga0466967_0067507 3300045976 Bacteria 3190
208 Ga0466967_0299194 3300045976 Bacteria 1548
209 Ga0466967_0410422 3300045976 Bacteria 1319
210 Ga0466967_0491383 3300045976 Bacteria 1203
211 Ga0495629_0330564 3300046459 Bacteria 1041
212 Ga0495594_0035922 3300046499 Bacteria 2701
213 Ga0495645_0090468 3300046543 Bacteria 2187
214 Ga0495600_0141153 3300046809 Bacteria 1563
215 Ga0495675_0057486 3300047444 Bacteria 2466
216 Ga0496104_0071003 3300048907 Bacteria 3311
217 Ga0496105_0213585 3300048908 Bacteria 1572
218 Ga0496105_0337433 3300048908 Bacteria 1206
219 Ga0496106_0552023 3300048909 Bacteria 924
220 Ga0496108_0043561 3300048911 Bacteria 3749
221 Ga0496108_0164254 3300048911 Bacteria 1920
222 Ga0496109_0416073 3300048912 Bacteria 1270
223 Ga0496110_0010868 3300048913 Bacteria 7421
224 Ga0496110_0192211 3300048913 Bacteria 1853
225 Ga0496110_0206664 3300048913 Bacteria 1784
226 Ga0496110_0332151 3300048913 Bacteria 1385
227 Ga0496111_0026028 3300048914 Bacteria 4129
228 Ga0496111_0180780 3300048914 Bacteria 1568
229 Ga0496111_0624047 3300048914 Bacteria 788
230 Ga0496112_0007675 3300048915 Bacteria 9598
231 Ga0496112_0023624 3300048915 Bacteria 5878
232 Ga0496112_0048557 3300048915 Bacteria 4161
233 Ga0496113_0338981 3300048916 Bacteria 1206
234 Ga0496113_0647040 3300048916 Bacteria 845
235 Ga0496114_0029242 3300048917 Bacteria 4527
236 Ga0496114_0060827 3300048917 Bacteria 3157
237 Ga0501031_0028500 3300049568 Bacteria 3640
238 Ga0501031_0407676 3300049568 Bacteria 879
239 Ga0501032_0018027 3300049569 Bacteria 4952
240 Ga0501032_0063608 3300049569 Bacteria 2470
241 Ga0501032_0123250 3300049569 Bacteria 1713
242 Ga0501033_0026729 3300049570 Bacteria 4342
243 Ga0501034_0048470 3300049571 Bacteria 4287
244 Ga0501036_0016896 3300049572 Bacteria 6095
245 Ga0501037_0009658 3300049573 Bacteria 7081
246 Ga0501038_0006027 3300049574 Bacteria 11218
247 Ga0501038_0033639 3300049574 Bacteria 4514
248 Ga0501038_0190645 3300049574 Bacteria 1650
249 Ga0501039_0009483 3300049575 Bacteria 7421
250 Ga0501042_0019938 3300049578 Bacteria 4664
251 Ga0501043_0028595 3300049579 Bacteria 4376
252 Ga0501043_0074860 3300049579 Bacteria 2660
253 Ga0501046_0001938 3300049580 Bacteria 19639
254 Ga0501046_0024257 3300049580 Bacteria 4978
255 Ga0501047_0009441 3300049581 Bacteria 9215
256 Ga0501047_0025976 3300049581 Bacteria 5631
257 Ga0501047_0087083 3300049581 Bacteria 3001
258 Ga0501047_0420109 3300049581 Bacteria 1168
259 Ga0501048_0012779 3300049582 Bacteria 6242
260 Ga0501067_0025266 3300049583 Bacteria 3292
261 Ga0501069_0106741 3300049585 Bacteria 1592
262 Ga0501070_0030630 3300049586 Bacteria 4508
263 Ga0501073_0091602 3300049589 Bacteria 2113
264 Ga0501080_0129594 3300049742 Bacteria 2335
265 Ga0501080_0212831 3300049742 Bacteria 1771
266 Ga0501081_0267415 3300049743 Bacteria 1250
267 Ga0501035_0025992 3300049822 Bacteria 5363
268 Ga0501035_0047119 3300049822 Bacteria 3871
269 Ga0501044_0016208 3300049823 Bacteria 8011
270 Ga0501044_0462105 3300049823 Bacteria 1174
271 nmdc:mga00v17_113521_c1 3300050491 Bacteria 1720
272 nmdc:mga00v17_5542_c1 3300050491 Bacteria 6653
273 nmdc:mga0yw44_266772_c1 3300050492 Bacteria 1142
274 nmdc:mga07m45_59187_c1 3300050496 Bacteria 2167
275 nmdc:mga05p37_171358_c1 3300050507 Bacteria 2647
276 nmdc:mga05p37_720_c1 3300050507 Bacteria 36593
277 nmdc:mga05p37_8792_c1 3300050507 Bacteria 11934
278 nmdc:mga09592_13817_c1 3300050508 Bacteria 6597
279 nmdc:mga09592_438254_c1 3300050508 Bacteria 1128
280 nmdc:mga0qj67_26355_c1 3300050509 Bacteria 4500
281 nmdc:mga0qj67_263_c2 3300050509 Bacteria 17708
282 nmdc:mga06r32_312696_c1 3300050510 Bacteria 1556
283 nmdc:mga06r32_68289_c1 3300050510 Bacteria 3434
284 nmdc:mga08y16_559607_c1 3300050511 Bacteria 1156
285 Ga0500646_0000083 3300053090 Bacteria 26729
286 Ga0500583_0043745 3300053092 Bacteria 2047
287 Ga0500654_046347 3300053099 Bacteria 2399
288 Ga0500594_0056440 3300053118 Bacteria 1120
289 Ga0500568_0003911 3300053139 Bacteria 8106
290 Ga0500588_0011735 3300053146 Bacteria 2153
291 Ga0501084_0357644 3300054114 Bacteria 1234
292 Ga0466962_0007260 3300061719 Bacteria 5309
293 Ga0466962_0030387 3300061719 Bacteria 2587
294 Ga0530510_0046477 3300061734 Bacteria 3136
295 Ga0530510_0065600 3300061734 Bacteria 2631
296 2515853538 2515154155 Bacteria 7985436
297 2676478464 2675903058 Bacteria 6822861
298 2774396886 2773857762 Bacteria 5971770
299 2809198525 2808606439 Bacteria 5952208
300 2812352895 2811994878 Bacteria 5992952
301 2827629522 2827628540 Bacteria 6858585
302 2866555140 2866552031 Bacteria 5824618
303 2891969587 2891968417 Bacteria 5821697
304 8056211862 8056207758 Bacteria 8639239
305 Ga0163162_10526132
306 Ga0070683_100367312
307 Ga0070670_100173445
308 Ga0070680_100092772
309 Ga0070680_100173565
310 Ga0070682_100022600
311 Ga0068868_100236811
312 Ga0068868_100496980
313 Ga0070691_10156806
314 Ga0070687_100073237
315 Ga0070661_100048024
316 Ga0070692_10005752
317 Ga0070668_100001660
318 Ga0070669_100116699
319 Ga0070675_100064529
320 Ga0070674_100144277
321 Ga0070673_100037863
322 Ga0070659_100014601
323 Ga0070659_100040425
324 Ga0070714_100070621
325 Ga0070714_100245433
326 Ga0070701_10014104
327 Ga0070700_100021918
328 Ga0070663_100151044
329 Ga0070681_10061384
330 Ga0070681_10100373
331 Ga0068867_100009302
332 Ga0070685_10422447
333 Ga0070706_100698069
334 Ga0070679_100465652
335 Ga0070684_100021214
336 Ga0070684_100086671
337 Ga0070684_100229369
338 Ga0068853_100171336
339 Ga0070672_100010075
340 Ga0070686_100069836
341 Ga0070665_100231440
342 Ga0070664_100015036
343 Ga0068857_100244141
344 Ga0068854_100042222
345 Ga0068856_100407091
346 Ga0070702_100335843
347 Ga0068852_100050000
348 Ga0068859_100185139
349 Ga0068864_100183366
350 Ga0068864_100276962
351 Ga0068866_10029247
352 Ga0068870_10015852
353 Ga0068870_10250317
354 Ga0068863_100023016
355 Ga0068860_100288546
356 Ga0081455_10000018
357 Ga0070717_10097125
358 Ga0075365_10171074
359 Ga0075368_10004514
360 Ga0075363_100010506
361 Ga0075367_10072372
362 Ga0075428_100069121
363 Ga0075430_100000172
364 Ga0075430_100011555
365 Ga0075431_100048735
366 Ga0075431_100283322
367 Ga0075431_100399286
368 Ga0075433_10390604
369 Ga0075429_100020736
370 Ga0075429_100038767
371 Ga0068865_100001007
372 Ga0097620_100185137
373 Ga0111539_10189555
374 Ga0105245_10044697
375 Ga0105245_10077377
376 Ga0114129_10000056
377 Ga0114129_10001688
378 Ga0114129_10052886
379 Ga0114129_10223237
380 Ga0105243_10023226
381 Ga0105242_10416479
382 Ga0105248_10014374
383 Ga0105248_10092568
384 Ga0105238_10204432
385 Ga0105249_10016947
386 Ga0105249_10178046
387 Ga0105239_10246444
388 Ga0157371_10007167
389 Ga0157371_10220231
390 Ga0157369_10002337
391 Ga0157369_10005679
392 Ga0157372_10047529
393 Ga0157375_10067162
394 Ga0163163_10035229
395 Ga0163163_10502645
396 Ga0157380_10045220
397 Ga0157377_10023451
398 Ga0163161_10310242
399 Ga0206353_12064211
400 Ga0213875_10000097
401 Ga0224712_10113681
402 Ga0207688_10008385
403 Ga0207688_10222301
404 Ga0207647_10138957
405 Ga0207643_10007206
406 Ga0207705_10004774
407 Ga0207705_10033518
408 Ga0207707_10129264
409 Ga0207707_10386463
410 Ga0207660_10129494
411 Ga0207662_10064507
412 Ga0207657_10128467
413 Ga0207657_10180823
414 Ga0207649_10116944
415 Ga0207652_10019949
416 Ga0207652_10116078
417 Ga0207681_10112624
418 Ga0207694_10098678
419 Ga0207687_10079422
420 Ga0207687_10095217
421 Ga0207664_10125923
422 Ga0207664_10269582
423 Ga0207690_10000222
424 Ga0207690_10026297
425 Ga0207690_10034927
426 Ga0207690_10048308
427 Ga0207709_10028352
428 Ga0207669_10003700
429 Ga0207691_10003397
430 Ga0207711_10262910
431 Ga0207689_10152740
432 Ga0207661_10032212
433 Ga0207661_10095263
434 Ga0207661_10535502
435 Ga0207667_10289485
436 Ga0207712_10021181
437 Ga0207668_10007375
438 Ga0207640_10074685
439 Ga0207658_10171215
440 Ga0207639_10131204
441 Ga0207678_10242171
442 Ga0207708_10000180
443 Ga0207641_10026907
444 Ga0207648_10005348
445 Ga0207648_10346843
446 Ga0207676_10114459
447 Ga0207674_10016918
448 Ga0207675_100006710
449 Ga0207683_10348799
450 Ga0207698_10324524
451 Ga0268265_10039794
452 Ga0268264_10241664
453 Ga0307515_10040352
454 Ga0307515_10398800
455 Ga0316182_1440866
456 Ga0307508_10177656
457 Ga0307508_10286002
458 Ga0307406_10040163
459 Ga0307406_10052351
460 Ga0307407_10177107
461 Ga0307409_100031403
462 Ga0307409_100271503
463 Ga0307409_100709961
464 Ga0307415_100493061
465 Ga0307415_100558199
466 Ga0307507_10071798
467 Ga0307507_10092110
468 Ga0373940_0001863
469 Ga0373942_0001291
470 Ga0373962_0002388
471 Ga0373931_0083300
472 Ga0373931_0255052
473 Ga0395898_0155351
474 Ga0395905_0064826
475 Ga0436364_0296067
476 Ga0436364_1246252
477 Ga0436365_0218752
478 Ga0439463_071463
479 Ga0450900_007692
480 Ga0439464_0081326
481 Ga0466969_0027675
482 Ga0466969_0054447
483 Ga0466965_0103929
484 Ga0466965_0129042
485 Ga0466966_0004593
486 Ga0466966_0020375
487 Ga0466966_0034700
488 Ga0466966_0065143
489 Ga0466961_0023170
490 Ga0466961_0361108
491 Ga0466963_0011026
492 Ga0466963_0038686
493 Ga0466963_0045674
494 Ga0466971_0011030
495 Ga0466971_0067573
496 Ga0466971_0138545
497 Ga0466970_0134564
498 Ga0466957_0016575
499 Ga0466960_0245356
500 Ga0466959_0004629
501 Ga0466959_0029690
502 Ga0466959_0062668
503 Ga0466958_0008909
504 Ga0466958_0022683
505 Ga0466958_0042354
506 Ga0466958_0071462
507 Ga0466958_0119322
508 Ga0466967_0032405
509 Ga0466967_0041283
510 Ga0466967_0066800
511 Ga0466967_0067507
512 Ga0466967_0299194
513 Ga0466967_0410422
514 Ga0466967_0491383
515 Ga0495629_0330564
516 Ga0495594_0035922
517 Ga0495645_0090468
518 Ga0495600_0141153
519 Ga0495675_0057486
520 Ga0496104_0071003
521 Ga0496105_0213585
522 Ga0496105_0337433
523 Ga0496106_0552023
524 Ga0496108_0043561
525 Ga0496108_0164254
526 Ga0496109_0416073
527 Ga0496110_0010868
528 Ga0496110_0192211
529 Ga0496110_0206664
530 Ga0496110_0332151
531 Ga0496111_0026028
532 Ga0496111_0180780
533 Ga0496111_0624047
534 Ga0496112_0007675
535 Ga0496112_0023624
536 Ga0496112_0048557
537 Ga0496113_0338981
538 Ga0496113_0647040
539 Ga0496114_0029242
540 Ga0496114_0060827
541 Ga0501031_0028500
542 Ga0501031_0407676
543 Ga0501032_0018027
544 Ga0501032_0063608
545 Ga0501032_0123250
546 Ga0501033_0026729
547 Ga0501034_0048470
548 Ga0501036_0016896
549 Ga0501037_0009658
550 Ga0501038_0006027
551 Ga0501038_0033639
552 Ga0501038_0190645
553 Ga0501039_0009483
554 Ga0501042_0019938
555 Ga0501043_0028595
556 Ga0501043_0074860
557 Ga0501046_0001938
558 Ga0501046_0024257
559 Ga0501047_0009441
560 Ga0501047_0025976
561 Ga0501047_0087083
562 Ga0501047_0420109
563 Ga0501048_0012779
564 Ga0501067_0025266
565 Ga0501069_0106741
566 Ga0501070_0030630
567 Ga0501073_0091602
568 Ga0501080_0129594
569 Ga0501080_0212831
570 Ga0501081_0267415
571 Ga0501035_0025992
572 Ga0501035_0047119
573 Ga0501044_0016208
574 Ga0501044_0462105
575 nmdc:mga00v17_113521_c1
576 nmdc:mga00v17_5542_c1
577 nmdc:mga0yw44_266772_c1
578 nmdc:mga07m45_59187_c1
579 nmdc:mga05p37_171358_c1
580 nmdc:mga05p37_720_c1
581 nmdc:mga05p37_8792_c1
582 nmdc:mga09592_13817_c1
583 nmdc:mga09592_438254_c1
584 nmdc:mga0qj67_26355_c1
585 nmdc:mga0qj67_263_c2
586 nmdc:mga06r32_312696_c1
587 nmdc:mga06r32_68289_c1
588 nmdc:mga08y16_559607_c1
589 Ga0500646_0000083
590 Ga0500583_0043745
591 Ga0500654_046347
592 Ga0500594_0056440
593 Ga0500568_0003911
594 Ga0500588_0011735
595 Ga0501084_0357644
596 Ga0466962_0007260
597 Ga0466962_0030387
598 Ga0530510_0046477
599 Ga0530510_0065600
600 2515853538
601 2676478464
602 2774396886
603 2809198525
604 2812352895
605 2827629522
606 2866555140
607 2891969587
608 8056211862

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

48

299

0.96

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

53

250

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lao-assembly1.cif.gz_C crystal structure of enoyl-coa hydratase from pseudomonas aeruginosa pa01 0.9313 71 192
3lao-assembly1.cif.gz_A crystal structure of enoyl-coa hydratase from pseudomonas aeruginosa pa01 0.9126 71 192
4q1i-assembly1.cif.gz_A structure and mechanism of a dehydratase/decarboxylase enzyme couple involved in polyketide beta-branching 0.9061 64 193
4di1-assembly1.cif.gz_B crystal structure of enoyl-coa hydratase echa17 from mycobacterium marinum 0.8963 2 214
5z7r-assembly1.cif.gz_A crystal structure of crotonase from clostridium acetobutylicum 0.8961 1 229
ID Description Score Start End Superfamily
af_P30084_233_289_1.10.12.10 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9809 182 232 1.10.12.10
2hw5B02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9787 182 232 1.10.12.10
1mj3E02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9787 182 232 1.10.12.10
1mj3C02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9785 182 232 1.10.12.10
2hw5F02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9778 182 232 1.10.12.10
ID Description Score Start End GO Terms
AF-A0A6B3IPN9-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.9687 50 178 GO:0006635
GO:0016836
GO:0016853
AF-A0A7W1E3B8-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.9678 63 235 GO:0006635
GO:0016836
GO:0016853
AF-T0YY04-F1-model_v4 Enoyl-CoA hydratase/isomerase 0.9635 45 235 GO:0006635
GO:0016836
GO:0016853
AF-A0A6B3IPN9-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.9614 50 178 GO:0006635
GO:0016836
GO:0016853
AF-A0A067D9Z2-F1-model_v4 Enoyl-CoA hydratase 0.9611 38 173 GO:0016836

Map