F397504

General Info

Members Datasets Scaffolds Average Seq Length
304 190 608 151

Family's Representative Sequence

Representative Sequence 3300006048|Ga0075363_100041688|Ga0075363_1000416883
Length 173
Sequence MSEPKEDGSGGFADRFRRCEGPAMHDSVTVHIDASPETVWALVSDVTQIGRFSPETFEAEWVDGATGPAVGARFRGHVRRNGRGPVYWTSCTVTACDPGKEFAFGVGKPGKALNTWSFHLEPKDSGTDVTESFRLTDKLGLKLYWALLGWARGRTNRNGMRATLEGIKAAVEA

Samples

Sample ID Description Type Environment
1 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
46 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
47 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
50 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
68 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
69 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
70 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
71 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
72 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
73 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
74 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
75 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
76 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
77 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
78 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
79 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
80 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
81 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
82 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
83 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
84 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
85 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
86 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
87 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
90 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
91 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
92 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
93 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
94 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
95 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
96 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
97 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
98 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
99 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
100 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
101 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
102 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
103 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
104 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
105 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
106 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
107 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
108 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
109 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
110 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
111 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
112 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
113 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
114 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
115 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
116 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
117 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
118 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
119 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
120 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
121 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
122 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
123 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
124 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
125 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
126 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
127 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
128 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
129 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
130 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
131 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
132 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
133 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
134 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
135 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
136 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
137 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
138 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
139 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
140 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
141 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
142 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
143 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
144 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
145 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
146 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
161 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
162 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
163 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
164 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
165 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
166 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
167 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
168 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
169 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
170 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
171 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
173 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
174 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
175 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
176 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
177 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
178 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
179 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
180 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
181 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
182 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
183 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
184 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
185 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
186 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
187 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
188 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
189 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
190 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.68
Metatranscriptomes 0.99
Isolates 0.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.92
Nodule 0
Rhizoplane 6.58
Rhizosphere 85.2
Stem 0
Stem Tuber 0
Unclassified 8.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075363_100041688 3300006048 Bacteria 2422
2 Ga0070676_10388582 3300005328 Bacteria 968
3 Ga0070683_100772105 3300005329 Bacteria 921
4 Ga0070670_100074613 3300005331 Bacteria 2914
5 Ga0070680_100760077 3300005336 Bacteria 835
6 Ga0070675_100074848 3300005354 Bacteria 2814
7 Ga0070675_100269732 3300005354 Bacteria 1493
8 Ga0070671_100005267 3300005355 Bacteria 10310
9 Ga0070674_100512028 3300005356 Bacteria 1001
10 Ga0070659_100761576 3300005366 Bacteria 840
11 Ga0070667_100255498 3300005367 Bacteria 1568
12 Ga0070714_101061069 3300005435 Bacteria 789
13 Ga0070713_101110869 3300005436 Bacteria 764
14 Ga0070708_100211432 3300005445 Bacteria 1817
15 Ga0070678_100866093 3300005456 Bacteria 824
16 Ga0068867_100238265 3300005459 Bacteria 1474
17 Ga0070685_10363158 3300005466 Bacteria 993
18 Ga0070698_101197037 3300005471 Bacteria 709
19 Ga0070684_100515452 3300005535 Bacteria 1108
20 Ga0070672_100112031 3300005543 Bacteria 2225
21 Ga0070686_100105697 3300005544 Bacteria 1909
22 Ga0068856_101416542 3300005614 Bacteria 709
23 Ga0068861_102352652 3300005719 Bacteria 535
24 Ga0068863_101278748 3300005841 Bacteria 740
25 Ga0068858_100047638 3300005842 Bacteria 3973
26 Ga0068860_100474737 3300005843 Unclassified 1246
27 Ga0068860_101439744 3300005843 Bacteria 710
28 Ga0068860_102806894 3300005843 Bacteria 505
29 Ga0070717_10077672 3300006028 Bacteria 2780
30 Ga0075365_10603702 3300006038 Bacteria 776
31 Ga0075363_100134995 3300006048 Bacteria 1386
32 Ga0075363_100562387 3300006048 Bacteria 681
33 Ga0075364_10091913 3300006051 Bacteria 2014
34 Ga0070712_100387877 3300006175 Bacteria 1151
35 Ga0075367_10065732 3300006178 Bacteria 2172
36 Ga0075367_10501269 3300006178 Bacteria 770
37 Ga0075370_10304493 3300006353 Bacteria 948
38 Ga0075428_100000263 3300006844 Bacteria 51735
39 Ga0075430_100323590 3300006846 Bacteria 1274
40 Ga0068865_100889760 3300006881 Bacteria 774
41 Ga0075436_100261954 3300006914 Bacteria 1233
42 Ga0111539_10224024 3300009094 Bacteria 2190
43 Ga0111539_11713262 3300009094 Bacteria 729
44 Ga0105245_10801577 3300009098 Bacteria 980
45 Ga0105243_12965880 3300009148 Bacteria 515
46 Ga0105241_11258490 3300009174 Bacteria 703
47 Ga0105248_12649304 3300009177 Bacteria 572
48 Ga0105237_10864948 3300009545 Bacteria 911
49 Ga0105237_11271970 3300009545 Unclassified 742
50 Ga0105249_10158703 3300009553 Bacteria 2184
51 Ga0105249_12813576 3300009553 Bacteria 558
52 Ga0105246_10296040 3300011119 Bacteria 1304
53 Ga0105246_10815416 3300011119 Bacteria 829
54 Ga0163162_10689588 3300013306 Bacteria 1144
55 Ga0163162_13356168 3300013306 Bacteria 512
56 Ga0157377_10923152 3300014745 Bacteria 654
57 Ga0163161_10516226 3300017792 Bacteria 975
58 Ga0163161_10894123 3300017792 Bacteria 752
59 Ga0206354_10105906 3300020081 Bacteria 1802
60 Ga0206353_11010826 3300020082 Bacteria 1588
61 Ga0206353_11722896 3300020082 Bacteria 572
62 Ga0213876_10007764 3300021384 Bacteria 5823
63 Ga0213876_10048617 3300021384 Bacteria 2241
64 Ga0207645_10492886 3300025907 Bacteria 829
65 Ga0207693_10341504 3300025915 Bacteria 1172
66 Ga0207650_10216661 3300025925 Bacteria 1539
67 Ga0207659_11226486 3300025926 Bacteria 644
68 Ga0207664_10631082 3300025929 Unclassified 963
69 Ga0207664_10974973 3300025929 Bacteria 760
70 Ga0207664_11866444 3300025929 Bacteria 523
71 Ga0207644_10013448 3300025931 Bacteria 5456
72 Ga0207669_10480737 3300025937 Bacteria 990
73 Ga0207691_10114870 3300025940 Bacteria 2391
74 Ga0207661_10961713 3300025944 Bacteria 787
75 Ga0207712_10606528 3300025961 Bacteria 947
76 Ga0207712_11581860 3300025961 Bacteria 587
77 Ga0207658_11330541 3300025986 Bacteria 657
78 Ga0207658_12137270 3300025986 Bacteria 509
79 Ga0207703_10031986 3300026035 Bacteria 4162
80 Ga0207648_10375099 3300026089 Bacteria 1285
81 Ga0207648_11288801 3300026089 Bacteria 686
82 Ga0207675_100723582 3300026118 Bacteria 1005
83 Ga0207675_100764251 3300026118 Bacteria 978
84 Ga0207683_10798956 3300026121 Bacteria 876
85 Ga0207698_11397821 3300026142 Bacteria 715
86 Ga0268264_11458165 3300028381 Bacteria 695
87 Ga0265337_1000278 3300028556 Bacteria 28004
88 Ga0265326_10002588 3300028558 Bacteria 6068
89 Ga0265319_1001196 3300028563 Bacteria 16026
90 Ga0265334_10001074 3300028573 Bacteria 13362
91 Ga0265334_10028587 3300028573 Bacteria 2239
92 Ga0265318_10039444 3300028577 Bacteria 1802
93 Ga0265318_10049591 3300028577 Bacteria 1579
94 Ga0265318_10164221 3300028577 Bacteria 814
95 Ga0265323_10023855 3300028653 Unclassified 2330
96 Ga0265322_10002491 3300028654 Bacteria 5673
97 Ga0265322_10183483 3300028654 Bacteria 599
98 Ga0265336_10005463 3300028666 Bacteria 4684
99 Ga0265338_10000292 3300028800 Bacteria 90040
100 Ga0265338_10001426 3300028800 Bacteria 38858
101 Ga0265338_10736554 3300028800 Bacteria 678
102 Ga0265324_10008177 3300029957 Bacteria 4176
103 Ga0265332_10004104 3300031238 Bacteria 6911
104 Ga0265320_10108329 3300031240 Bacteria 1274
105 Ga0265320_10174004 3300031240 Bacteria 967
106 Ga0265325_10001200 3300031241 Bacteria 18476
107 Ga0265325_10002275 3300031241 Bacteria 13022
108 Ga0265340_10020855 3300031247 Bacteria 3362
109 Ga0265339_10019902 3300031249 Bacteria 3929
110 Ga0265339_10033655 3300031249 Bacteria 2884
111 Ga0265327_10000624 3300031251 Bacteria 58153
112 Ga0265327_10002576 3300031251 Bacteria 18765
113 Ga0265327_10004376 3300031251 Bacteria 12541
114 Ga0265327_10024408 3300031251 Bacteria 3554
115 Ga0265327_10031131 3300031251 Bacteria 3003
116 Ga0265327_10133555 3300031251 Bacteria 1166
117 Ga0265327_10171639 3300031251 Bacteria 996
118 Ga0265316_10120798 3300031344 Bacteria 1979
119 Ga0265316_10158106 3300031344 Bacteria 1695
120 Ga0307513_10294026 3300031456 Bacteria 1394
121 Ga0265313_10000999 3300031595 Bacteria 27763
122 Ga0265313_10340848 3300031595 Unclassified 595
123 Ga0265314_10011183 3300031711 Bacteria 7433
124 Ga0265314_10055751 3300031711 Bacteria 2725
125 Ga0265314_10325257 3300031711 Bacteria 854
126 Ga0265342_10016010 3300031712 Bacteria 4912
127 Ga0307409_100787637 3300031995 Bacteria 957
128 Ga0373923_0088331 3300035111 Unclassified 1353
129 Ga0373953_0165413 3300035117 Unclassified 951
130 Ga0373953_0254835 3300035117 Bacteria 763
131 Ga0373954_0210551 3300035118 Unclassified 955
132 Ga0373954_0351993 3300035118 Bacteria 727
133 Ga0373956_0021308 3300035119 Bacteria 2765
134 Ga0373960_0165203 3300035121 Bacteria 764
135 Ga0373943_0793398 3300035170 Bacteria 563
136 Ga0373955_0092664 3300035172 Bacteria 1724
137 Ga0373955_0297013 3300035172 Bacteria 974
138 Ga0373924_0178093 3300035410 Bacteria 935
139 Ga0373937_0013796 3300036401 Bacteria 7119
140 Ga0373937_0089749 3300036401 Bacteria 2846
141 Ga0436365_1576742 3300039437 Bacteria 7505
142 Ga0451802_0759163 3300041460 Bacteria 787
143 Ga0451853_1235456 3300041512 Bacteria 1069
144 Ga0451853_3480871 3300041512 Bacteria 1765
145 Ga0466966_0045415 3300044684 Bacteria 2808
146 Ga0466961_0039128 3300044693 Bacteria 3040
147 Ga0466961_0076823 3300044693 Bacteria 2116
148 Ga0466963_0097128 3300044694 Bacteria 2013
149 Ga0466971_0038888 3300044719 Bacteria 2135
150 Ga0466970_0102015 3300044765 Bacteria 1563
151 Ga0466959_0076726 3300045049 Bacteria 2412
152 Ga0466958_0127925 3300045836 Bacteria 1593
153 Ga0466958_0305791 3300045836 Bacteria 1021
154 Ga0466967_0048825 3300045976 Bacteria 3699
155 Ga0466967_0236180 3300045976 Bacteria 1742
156 Ga0466967_0299611 3300045976 Bacteria 1547
157 Ga0466967_0440141 3300045976 Bacteria 1273
158 Ga0495641_0481465 3300046461 Bacteria 565
159 Ga0495651_0008939 3300046462 Bacteria 7692
160 Ga0495651_0063839 3300046462 Bacteria 2814
161 Ga0495651_0205164 3300046462 Bacteria 1376
162 Ga0495653_0019006 3300046463 Bacteria 5576
163 Ga0495653_0038067 3300046463 Bacteria 3776
164 Ga0495653_0099174 3300046463 Bacteria 2114
165 Ga0495653_0346243 3300046463 Bacteria 957
166 Ga0495653_0453154 3300046463 Bacteria 807
167 Ga0495582_0188957 3300046473 Unclassified 1175
168 Ga0495662_0313557 3300046476 Unclassified 771
169 Ga0495664_0073610 3300046477 Bacteria 2043
170 Ga0495608_0005736 3300046511 Bacteria 8860
171 Ga0495608_0021818 3300046511 Bacteria 4392
172 Ga0495608_0130961 3300046511 Bacteria 1605
173 Ga0495618_0142409 3300046514 Bacteria 1533
174 Ga0495618_0255648 3300046514 Bacteria 1098
175 Ga0495628_0008939 3300046516 Bacteria 8567
176 Ga0495628_0130330 3300046516 Bacteria 1924
177 Ga0495628_0171185 3300046516 Bacteria 1646
178 Ga0495630_0013033 3300046517 Bacteria 6040
179 Ga0495630_0065178 3300046517 Bacteria 2737
180 Ga0495652_0113714 3300046529 Bacteria 2173
181 Ga0495652_0185741 3300046529 Bacteria 1591
182 Ga0495652_0685896 3300046529 Unclassified 690
183 Ga0495640_0008465 3300046533 Bacteria 8068
184 Ga0495586_0377174 3300046535 Bacteria 815
185 Ga0495587_0006009 3300046536 Bacteria 7911
186 Ga0495645_0326122 3300046543 Unclassified 996
187 Ga0495667_0010516 3300046559 Bacteria 6262
188 Ga0495667_0012624 3300046559 Bacteria 5727
189 Ga0495667_0197926 3300046559 Unclassified 1286
190 Ga0495667_0238105 3300046559 Bacteria 1160
191 Ga0495668_0608281 3300046616 Bacteria 604
192 Ga0495634_0363828 3300046642 Bacteria 864
193 Ga0495635_0172545 3300046663 Bacteria 1470
194 Ga0495657_0016282 3300046675 Bacteria 5419
195 Ga0495657_0064933 3300046675 Bacteria 2402
196 Ga0495657_0121410 3300046675 Bacteria 1645
197 Ga0495657_0580251 3300046675 Unclassified 650
198 Ga0495599_0233803 3300046678 Unclassified 1122
199 Ga0495623_0115255 3300046679 Bacteria 1624
200 Ga0495658_0206446 3300046683 Unclassified 1226
201 Ga0495613_0048571 3300046689 Bacteria 3134
202 Ga0495613_0077952 3300046689 Bacteria 2411
203 Ga0495624_0226806 3300046690 Bacteria 1132
204 Ga0495624_0673509 3300046690 Unclassified 615
205 Ga0495600_0031565 3300046809 Bacteria 3433
206 Ga0495600_0342337 3300046809 Unclassified 937
207 Ga0495674_0027055 3300047319 Bacteria 5245
208 Ga0495674_0435398 3300047319 Bacteria 1055
209 Ga0495674_0910739 3300047319 Bacteria 678
210 Ga0495672_0101030 3300047320 Bacteria 1564
211 Ga0495676_0541512 3300047321 Bacteria 761
212 Ga0495680_0003162 3300047322 Bacteria 16399
213 Ga0495680_0016178 3300047322 Bacteria 6413
214 Ga0495680_0081530 3300047322 Bacteria 2442
215 Ga0495680_0386478 3300047322 Unclassified 968
216 Ga0495675_0076251 3300047444 Bacteria 2113
217 Ga0495675_0214678 3300047444 Bacteria 1166
218 Ga0495684_0016139 3300047471 Bacteria 5750
219 Ga0495684_0167291 3300047471 Bacteria 1637
220 Ga0495684_0242650 3300047471 Bacteria 1313
221 Ga0495602_0140971 3300048088 Bacteria 1908
222 Ga0496102_1483980 3300048905 Bacteria 597
223 Ga0496104_1063777 3300048907 Unclassified 713
224 Ga0496105_1071247 3300048908 Bacteria 600
225 Ga0496105_1237013 3300048908 Unclassified 548
226 Ga0496106_0882519 3300048909 Bacteria 707
227 Ga0496108_0528492 3300048911 Bacteria 1030
228 Ga0496109_0496015 3300048912 Bacteria 1153
229 Ga0496109_0637304 3300048912 Bacteria 1003
230 Ga0496109_0813805 3300048912 Bacteria 872
231 Ga0496110_0403548 3300048913 Bacteria 1246
232 Ga0496110_0478887 3300048913 Bacteria 1134
233 Ga0496110_0487532 3300048913 Unclassified 1123
234 Ga0496110_0710099 3300048913 Bacteria 907
235 Ga0496110_1404260 3300048913 Bacteria 608
236 Ga0496112_0035507 3300048915 Bacteria 4857
237 Ga0496114_0425989 3300048917 Bacteria 1176
238 Ga0496114_0487260 3300048917 Bacteria 1091
239 Ga0496114_0581987 3300048917 Bacteria 988
240 Ga0496115_0227904 3300048918 Bacteria 1537
241 Ga0501032_0011972 3300049569 Bacteria 6213
242 Ga0501034_0000644 3300049571 Bacteria 54163
243 Ga0501034_0052742 3300049571 Bacteria 4097
244 Ga0501034_0352844 3300049571 Bacteria 1399
245 Ga0501034_0358517 3300049571 Bacteria 1385
246 Ga0501037_0033914 3300049573 Bacteria 3769
247 Ga0501038_0102315 3300049574 Bacteria 2384
248 Ga0501040_1101342 3300049576 Bacteria 576
249 Ga0501043_0861429 3300049579 Bacteria 652
250 Ga0501047_0146842 3300049581 Bacteria 2235
251 Ga0501048_0688654 3300049582 Bacteria 734
252 Ga0501067_0215281 3300049583 Bacteria 1070
253 Ga0501068_0109906 3300049584 Bacteria 1713
254 Ga0501068_0136627 3300049584 Unclassified 1535
255 Ga0501068_0294286 3300049584 Bacteria 1039
256 Ga0501068_1141617 3300049584 Bacteria 516
257 Ga0501070_0010523 3300049586 Bacteria 7821
258 Ga0501070_0108677 3300049586 Bacteria 2291
259 Ga0501070_0216361 3300049586 Bacteria 1572
260 Ga0501071_0333890 3300049587 Bacteria 1152
261 Ga0501072_0081125 3300049588 Bacteria 2571
262 Ga0501072_0302466 3300049588 Unclassified 1271
263 Ga0501072_0607856 3300049588 Unclassified 862
264 Ga0501073_0089474 3300049589 Bacteria 2140
265 Ga0501073_0156753 3300049589 Bacteria 1578
266 Ga0501073_0364639 3300049589 Bacteria 998
267 Ga0501073_0392509 3300049589 Bacteria 959
268 Ga0501075_0107363 3300049591 Bacteria 2122
269 Ga0501076_0208153 3300049592 Bacteria 1598
270 Ga0501079_0185551 3300049741 Bacteria 1624
271 Ga0501080_0002501 3300049742 Bacteria 16096
272 Ga0501080_0052356 3300049742 Bacteria 3800
273 Ga0501080_0056597 3300049742 Bacteria 3651
274 Ga0501080_0183994 3300049742 Bacteria 1922
275 Ga0501080_0421043 3300049742 Bacteria 1200
276 Ga0501083_0103164 3300049744 Bacteria 1880
277 Ga0501035_0176303 3300049822 Bacteria 1844
278 Ga0501044_0007289 3300049823 Bacteria 12153
279 nmdc:mga03n38_43582_c1 3300050490 Bacteria 1967
280 nmdc:mga03n38_799965_c1 3300050490 Bacteria 549
281 nmdc:mga00v17_228429_c1 3300050491 Bacteria 1205
282 nmdc:mga00v17_237846_c1 3300050491 Bacteria 1180
283 nmdc:mga06z11_404465_c1 3300050494 Bacteria 822
284 nmdc:mga06z11_416814_c1 3300050494 Bacteria 809
285 nmdc:mga07m45_51513_c2 3300050496 Bacteria 1704
286 nmdc:mga09592_819480_c1 3300050508 Bacteria 786
287 nmdc:mga0qj67_244555_c1 3300050509 Bacteria 1456
288 nmdc:mga0qj67_299976_c1 3300050509 Bacteria 1302
289 nmdc:mga0qj67_499743_c1 3300050509 Bacteria 978
290 nmdc:mga08y16_57136_c1 3300050511 Bacteria 4078
291 Ga0495601_0209944 3300053077 Bacteria 1272
292 Ga0495595_0002360 3300053084 Bacteria 7356
293 Ga0495619_0004588 3300053085 Bacteria 8824
294 Ga0495619_0045806 3300053085 Bacteria 2874
295 Ga0495619_0965359 3300053085 Bacteria 571
296 Ga0495619_1130501 3300053085 Unclassified 520
297 Ga0500566_0173160 3300053094 Bacteria 1114
298 Ga0500604_0025424 3300053151 Bacteria 1702
299 Ga0500616_0001293 3300053153 Bacteria 24874
300 Ga0501084_0000104 3300054114 Bacteria 62893
301 Ga0501082_0421333 3300060353 Bacteria 1166
302 Ga0466962_0037333 3300061719 Bacteria 2326
303 Ga0530510_0020473 3300061734 Bacteria 4703
304 3003000064 3002998708 Bacteria 11715108
305 Ga0075363_100041688
306 Ga0070676_10388582
307 Ga0070683_100772105
308 Ga0070670_100074613
309 Ga0070680_100760077
310 Ga0070675_100074848
311 Ga0070675_100269732
312 Ga0070671_100005267
313 Ga0070674_100512028
314 Ga0070659_100761576
315 Ga0070667_100255498
316 Ga0070714_101061069
317 Ga0070713_101110869
318 Ga0070708_100211432
319 Ga0070678_100866093
320 Ga0068867_100238265
321 Ga0070685_10363158
322 Ga0070698_101197037
323 Ga0070684_100515452
324 Ga0070672_100112031
325 Ga0070686_100105697
326 Ga0068856_101416542
327 Ga0068861_102352652
328 Ga0068863_101278748
329 Ga0068858_100047638
330 Ga0068860_100474737
331 Ga0068860_101439744
332 Ga0068860_102806894
333 Ga0070717_10077672
334 Ga0075365_10603702
335 Ga0075363_100134995
336 Ga0075363_100562387
337 Ga0075364_10091913
338 Ga0070712_100387877
339 Ga0075367_10065732
340 Ga0075367_10501269
341 Ga0075370_10304493
342 Ga0075428_100000263
343 Ga0075430_100323590
344 Ga0068865_100889760
345 Ga0075436_100261954
346 Ga0111539_10224024
347 Ga0111539_11713262
348 Ga0105245_10801577
349 Ga0105243_12965880
350 Ga0105241_11258490
351 Ga0105248_12649304
352 Ga0105237_10864948
353 Ga0105237_11271970
354 Ga0105249_10158703
355 Ga0105249_12813576
356 Ga0105246_10296040
357 Ga0105246_10815416
358 Ga0163162_10689588
359 Ga0163162_13356168
360 Ga0157377_10923152
361 Ga0163161_10516226
362 Ga0163161_10894123
363 Ga0206354_10105906
364 Ga0206353_11010826
365 Ga0206353_11722896
366 Ga0213876_10007764
367 Ga0213876_10048617
368 Ga0207645_10492886
369 Ga0207693_10341504
370 Ga0207650_10216661
371 Ga0207659_11226486
372 Ga0207664_10631082
373 Ga0207664_10974973
374 Ga0207664_11866444
375 Ga0207644_10013448
376 Ga0207669_10480737
377 Ga0207691_10114870
378 Ga0207661_10961713
379 Ga0207712_10606528
380 Ga0207712_11581860
381 Ga0207658_11330541
382 Ga0207658_12137270
383 Ga0207703_10031986
384 Ga0207648_10375099
385 Ga0207648_11288801
386 Ga0207675_100723582
387 Ga0207675_100764251
388 Ga0207683_10798956
389 Ga0207698_11397821
390 Ga0268264_11458165
391 Ga0265337_1000278
392 Ga0265326_10002588
393 Ga0265319_1001196
394 Ga0265334_10001074
395 Ga0265334_10028587
396 Ga0265318_10039444
397 Ga0265318_10049591
398 Ga0265318_10164221
399 Ga0265323_10023855
400 Ga0265322_10002491
401 Ga0265322_10183483
402 Ga0265336_10005463
403 Ga0265338_10000292
404 Ga0265338_10001426
405 Ga0265338_10736554
406 Ga0265324_10008177
407 Ga0265332_10004104
408 Ga0265320_10108329
409 Ga0265320_10174004
410 Ga0265325_10001200
411 Ga0265325_10002275
412 Ga0265340_10020855
413 Ga0265339_10019902
414 Ga0265339_10033655
415 Ga0265327_10000624
416 Ga0265327_10002576
417 Ga0265327_10004376
418 Ga0265327_10024408
419 Ga0265327_10031131
420 Ga0265327_10133555
421 Ga0265327_10171639
422 Ga0265316_10120798
423 Ga0265316_10158106
424 Ga0307513_10294026
425 Ga0265313_10000999
426 Ga0265313_10340848
427 Ga0265314_10011183
428 Ga0265314_10055751
429 Ga0265314_10325257
430 Ga0265342_10016010
431 Ga0307409_100787637
432 Ga0373923_0088331
433 Ga0373953_0165413
434 Ga0373953_0254835
435 Ga0373954_0210551
436 Ga0373954_0351993
437 Ga0373956_0021308
438 Ga0373960_0165203
439 Ga0373943_0793398
440 Ga0373955_0092664
441 Ga0373955_0297013
442 Ga0373924_0178093
443 Ga0373937_0013796
444 Ga0373937_0089749
445 Ga0436365_1576742
446 Ga0451802_0759163
447 Ga0451853_1235456
448 Ga0451853_3480871
449 Ga0466966_0045415
450 Ga0466961_0039128
451 Ga0466961_0076823
452 Ga0466963_0097128
453 Ga0466971_0038888
454 Ga0466970_0102015
455 Ga0466959_0076726
456 Ga0466958_0127925
457 Ga0466958_0305791
458 Ga0466967_0048825
459 Ga0466967_0236180
460 Ga0466967_0299611
461 Ga0466967_0440141
462 Ga0495641_0481465
463 Ga0495651_0008939
464 Ga0495651_0063839
465 Ga0495651_0205164
466 Ga0495653_0019006
467 Ga0495653_0038067
468 Ga0495653_0099174
469 Ga0495653_0346243
470 Ga0495653_0453154
471 Ga0495582_0188957
472 Ga0495662_0313557
473 Ga0495664_0073610
474 Ga0495608_0005736
475 Ga0495608_0021818
476 Ga0495608_0130961
477 Ga0495618_0142409
478 Ga0495618_0255648
479 Ga0495628_0008939
480 Ga0495628_0130330
481 Ga0495628_0171185
482 Ga0495630_0013033
483 Ga0495630_0065178
484 Ga0495652_0113714
485 Ga0495652_0185741
486 Ga0495652_0685896
487 Ga0495640_0008465
488 Ga0495586_0377174
489 Ga0495587_0006009
490 Ga0495645_0326122
491 Ga0495667_0010516
492 Ga0495667_0012624
493 Ga0495667_0197926
494 Ga0495667_0238105
495 Ga0495668_0608281
496 Ga0495634_0363828
497 Ga0495635_0172545
498 Ga0495657_0016282
499 Ga0495657_0064933
500 Ga0495657_0121410
501 Ga0495657_0580251
502 Ga0495599_0233803
503 Ga0495623_0115255
504 Ga0495658_0206446
505 Ga0495613_0048571
506 Ga0495613_0077952
507 Ga0495624_0226806
508 Ga0495624_0673509
509 Ga0495600_0031565
510 Ga0495600_0342337
511 Ga0495674_0027055
512 Ga0495674_0435398
513 Ga0495674_0910739
514 Ga0495672_0101030
515 Ga0495676_0541512
516 Ga0495680_0003162
517 Ga0495680_0016178
518 Ga0495680_0081530
519 Ga0495680_0386478
520 Ga0495675_0076251
521 Ga0495675_0214678
522 Ga0495684_0016139
523 Ga0495684_0167291
524 Ga0495684_0242650
525 Ga0495602_0140971
526 Ga0496102_1483980
527 Ga0496104_1063777
528 Ga0496105_1071247
529 Ga0496105_1237013
530 Ga0496106_0882519
531 Ga0496108_0528492
532 Ga0496109_0496015
533 Ga0496109_0637304
534 Ga0496109_0813805
535 Ga0496110_0403548
536 Ga0496110_0478887
537 Ga0496110_0487532
538 Ga0496110_0710099
539 Ga0496110_1404260
540 Ga0496112_0035507
541 Ga0496114_0425989
542 Ga0496114_0487260
543 Ga0496114_0581987
544 Ga0496115_0227904
545 Ga0501032_0011972
546 Ga0501034_0000644
547 Ga0501034_0052742
548 Ga0501034_0352844
549 Ga0501034_0358517
550 Ga0501037_0033914
551 Ga0501038_0102315
552 Ga0501040_1101342
553 Ga0501043_0861429
554 Ga0501047_0146842
555 Ga0501048_0688654
556 Ga0501067_0215281
557 Ga0501068_0109906
558 Ga0501068_0136627
559 Ga0501068_0294286
560 Ga0501068_1141617
561 Ga0501070_0010523
562 Ga0501070_0108677
563 Ga0501070_0216361
564 Ga0501071_0333890
565 Ga0501072_0081125
566 Ga0501072_0302466
567 Ga0501072_0607856
568 Ga0501073_0089474
569 Ga0501073_0156753
570 Ga0501073_0364639
571 Ga0501073_0392509
572 Ga0501075_0107363
573 Ga0501076_0208153
574 Ga0501079_0185551
575 Ga0501080_0002501
576 Ga0501080_0052356
577 Ga0501080_0056597
578 Ga0501080_0183994
579 Ga0501080_0421043
580 Ga0501083_0103164
581 Ga0501035_0176303
582 Ga0501044_0007289
583 nmdc:mga03n38_43582_c1
584 nmdc:mga03n38_799965_c1
585 nmdc:mga00v17_228429_c1
586 nmdc:mga00v17_237846_c1
587 nmdc:mga06z11_404465_c1
588 nmdc:mga06z11_416814_c1
589 nmdc:mga07m45_51513_c2
590 nmdc:mga09592_819480_c1
591 nmdc:mga0qj67_244555_c1
592 nmdc:mga0qj67_299976_c1
593 nmdc:mga0qj67_499743_c1
594 nmdc:mga08y16_57136_c1
595 Ga0495601_0209944
596 Ga0495595_0002360
597 Ga0495619_0004588
598 Ga0495619_0045806
599 Ga0495619_0965359
600 Ga0495619_1130501
601 Ga0500566_0173160
602 Ga0500604_0025424
603 Ga0500616_0001293
604 Ga0501084_0000104
605 Ga0501082_0421333
606 Ga0466962_0037333
607 Ga0530510_0020473
608 3003000064

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10604

Polyketide_cyc2

Polyketide cyclase / dehydrase and lipid transport

25

172

0.82

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

33

172

0.76

PF03364

Polyketide_cyc

Polyketide cyclase / dehydrase and lipid transport

32

163

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xn5-assembly1.cif.gz_A solution structure of bacillus halodurans protein bh1534: the northeast structural genomics consortium target bhr29 0.8443 1 111
7wa9-assembly1.cif.gz_A crystal structure of msmeg_5634 from mycobacterium smegmatis 0.8134 1 148
7wa9-assembly1.cif.gz_A crystal structure of msmeg_5634 from mycobacterium smegmatis 0.7929 1 148
3ijt-assembly1.cif.gz_A structural characterization of smu.440, a hypothetical protein from streptococcus mutans 0.7834 1 149
3ggn-assembly2.cif.gz_A crystal structure of dr_a0006 from deinococcus radiodurans. northeast structural genomics consortium target drr147d 0.7784 1 151
ID Description Score Start End Superfamily
af_O07748_5_153_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8961 2 150 3.30.530.20
af_O07748_5_153_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8669 2 150 3.30.530.20
af_I6Y1P2_6_156_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8397 3 150 3.30.530.20
af_P9WM73_75_221_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8248 2 148 3.30.530.20
af_P9WLU7_2_142_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.816 1 146 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A4R8S2M2-F1-model_v4 Polyketide cyclase / dehydrase and lipid transport 0.9753 2 150
AF-A0A4Q2SM28-F1-model_v4 SRPBCC family protein 0.9751 2 149
AF-A0A495NSB3-F1-model_v4 deleted 0.9732 2 149
AF-A0A399XM68-F1-model_v4 Cyclase 0.9681 1 152
AF-A0A2S6AI32-F1-model_v4 Cyclase 0.9662 1 149

Map