F397426
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 304 | 173 | 297 | 156 |
Family's Representative Sequence
| Representative Sequence | 3300005341|Ga0070691_10005141|Ga0070691_100051413 |
| Length | 162 |
| Sequence | MPGRDGIAGLVCLAGSLGLLALTRGLPHPALVPIGPGFYPRIVLGVTAALSVVLVLADLLERRRARAGAAATVEAPLPLIRNPRLVGATFAIFAGYVTLMPLVGFRLATALFVLALQAALEPEPRRHWLRIVLVAVFTAWLTHLAFEGYLSVLLPRGRWTGF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 2 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 3 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 4 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 25 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 38 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 44 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 45 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 50 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 51 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 52 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 55 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 56 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 57 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 58 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 59 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 60 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 61 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 64 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 74 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 114 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 117 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 118 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 119 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 120 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 121 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 122 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 123 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 124 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 125 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 126 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 127 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 128 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 129 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 130 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 131 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 132 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 133 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 134 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 135 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 136 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 137 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 138 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 139 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 140 | 3300042117 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 | Metagenome | Rhizosphere |
| 141 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 142 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 143 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 144 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 145 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 146 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 147 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 148 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 149 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 150 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 151 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 152 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 153 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 154 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 155 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 156 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 157 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 158 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 159 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 160 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 161 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 162 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 163 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 165 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 166 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 167 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 168 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 169 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 170 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 171 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 172 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 173 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.7 |
| Metatranscriptomes | 0 |
| Isolates | 2.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 2.3 |
| Rhizoplane | 0.66 |
| Rhizosphere | 97.04 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065707_10179081 | 3300005295 | Bacteria | 1430 |
| 2 | Ga0070690_100000131 | 3300005330 | Bacteria | 38893 |
| 3 | Ga0068869_100000392 | 3300005334 | Bacteria | 23853 |
| 4 | Ga0070680_100002214 | 3300005336 | Bacteria | 14332 |
| 5 | Ga0070680_100628608 | 3300005336 | Unclassified | 922 |
| 6 | Ga0070682_100003841 | 3300005337 | Bacteria | 8339 |
| 7 | Ga0068868_100000656 | 3300005338 | Bacteria | 23322 |
| 8 | Ga0070689_100001412 | 3300005340 | Bacteria | 15327 |
| 9 | Ga0070691_10005141 | 3300005341 | Bacteria | 5949 |
| 10 | Ga0070691_10008455 | 3300005341 | Bacteria | 4710 |
| 11 | Ga0070687_100000175 | 3300005343 | Bacteria | 22196 |
| 12 | Ga0070687_100615385 | 3300005343 | Unclassified | 748 |
| 13 | Ga0070692_10000992 | 3300005345 | Bacteria | 9719 |
| 14 | Ga0070692_10001310 | 3300005345 | Bacteria | 8947 |
| 15 | Ga0070692_10429135 | 3300005345 | Bacteria | 841 |
| 16 | Ga0070669_101587165 | 3300005353 | Unclassified | 569 |
| 17 | Ga0070675_100110676 | 3300005354 | Bacteria | 2323 |
| 18 | Ga0070703_10003837 | 3300005406 | Bacteria | 4254 |
| 19 | Ga0070703_10011205 | 3300005406 | Bacteria | 2532 |
| 20 | Ga0070703_10346844 | 3300005406 | Unclassified | 632 |
| 21 | Ga0070701_10000060 | 3300005438 | Bacteria | 29083 |
| 22 | Ga0070701_10004359 | 3300005438 | Bacteria | 5720 |
| 23 | Ga0070705_100000431 | 3300005440 | Bacteria | 24090 |
| 24 | Ga0070705_100003244 | 3300005440 | Bacteria | 7994 |
| 25 | Ga0070705_100192389 | 3300005440 | Bacteria | 1392 |
| 26 | Ga0070705_100895568 | 3300005440 | Unclassified | 713 |
| 27 | Ga0070700_100000587 | 3300005441 | Bacteria | 18243 |
| 28 | Ga0070700_100030932 | 3300005441 | Bacteria | 3203 |
| 29 | Ga0070700_100319804 | 3300005441 | Bacteria | 1140 |
| 30 | Ga0070694_100000136 | 3300005444 | Bacteria | 36787 |
| 31 | Ga0070694_100013830 | 3300005444 | Bacteria | 5046 |
| 32 | Ga0070694_100172458 | 3300005444 | Bacteria | 1595 |
| 33 | Ga0070662_100315209 | 3300005457 | Bacteria | 1274 |
| 34 | Ga0070681_10002380 | 3300005458 | Bacteria | 17183 |
| 35 | Ga0068867_100002957 | 3300005459 | Bacteria | 11965 |
| 36 | Ga0068867_100182039 | 3300005459 | Bacteria | 1671 |
| 37 | Ga0068867_101859075 | 3300005459 | Unclassified | 567 |
| 38 | Ga0070706_101652813 | 3300005467 | Bacteria | 584 |
| 39 | Ga0070707_100058426 | 3300005468 | Bacteria | 3699 |
| 40 | Ga0070707_100592536 | 3300005468 | Bacteria | 1071 |
| 41 | Ga0070707_100930392 | 3300005468 | Unclassified | 834 |
| 42 | Ga0070698_100042676 | 3300005471 | Bacteria | 4652 |
| 43 | Ga0070698_100083093 | 3300005471 | Bacteria | 3193 |
| 44 | Ga0070698_100084320 | 3300005471 | Bacteria | 3166 |
| 45 | Ga0070698_100419315 | 3300005471 | Bacteria | 1273 |
| 46 | Ga0070699_100015436 | 3300005518 | Bacteria | 6563 |
| 47 | Ga0070699_100423528 | 3300005518 | Bacteria | 1205 |
| 48 | Ga0070679_100032345 | 3300005530 | Bacteria | 5174 |
| 49 | Ga0070679_100205311 | 3300005530 | Bacteria | 1935 |
| 50 | Ga0070697_100163590 | 3300005536 | Bacteria | 1881 |
| 51 | Ga0070697_100979874 | 3300005536 | Bacteria | 751 |
| 52 | Ga0070686_100000285 | 3300005544 | Bacteria | 34108 |
| 53 | Ga0070686_100268207 | 3300005544 | Bacteria | 1254 |
| 54 | Ga0070695_100001799 | 3300005545 | Bacteria | 12087 |
| 55 | Ga0070695_100022709 | 3300005545 | Bacteria | 3850 |
| 56 | Ga0070695_100031072 | 3300005545 | Bacteria | 3328 |
| 57 | Ga0070695_100520367 | 3300005545 | Bacteria | 923 |
| 58 | Ga0070695_101069140 | 3300005545 | Unclassified | 659 |
| 59 | Ga0070696_100002841 | 3300005546 | Bacteria | 11515 |
| 60 | Ga0070696_100030181 | 3300005546 | Bacteria | 3710 |
| 61 | Ga0070696_100032776 | 3300005546 | Bacteria | 3566 |
| 62 | Ga0070696_100237898 | 3300005546 | Bacteria | 1372 |
| 63 | Ga0070696_100969860 | 3300005546 | Bacteria | 709 |
| 64 | Ga0070696_101036416 | 3300005546 | Unclassified | 687 |
| 65 | Ga0070693_100000278 | 3300005547 | Bacteria | 24050 |
| 66 | Ga0070693_100129392 | 3300005547 | Bacteria | 1576 |
| 67 | Ga0070693_100798721 | 3300005547 | Bacteria | 699 |
| 68 | Ga0070704_100000103 | 3300005549 | Bacteria | 29844 |
| 69 | Ga0070704_100045919 | 3300005549 | Bacteria | 3042 |
| 70 | Ga0070704_100066657 | 3300005549 | Bacteria | 2597 |
| 71 | Ga0070704_100086593 | 3300005549 | Bacteria | 2322 |
| 72 | Ga0070704_100107576 | 3300005549 | Bacteria | 2115 |
| 73 | Ga0070704_100427301 | 3300005549 | Bacteria | 1136 |
| 74 | Ga0070704_100714389 | 3300005549 | Bacteria | 890 |
| 75 | Ga0068855_100001779 | 3300005563 | Bacteria | 26944 |
| 76 | Ga0068857_100240574 | 3300005577 | Bacteria | 1657 |
| 77 | Ga0068854_100009113 | 3300005578 | Bacteria | 6398 |
| 78 | Ga0068854_101343770 | 3300005578 | Bacteria | 644 |
| 79 | Ga0068854_101800125 | 3300005578 | Unclassified | 561 |
| 80 | Ga0068856_100099318 | 3300005614 | Bacteria | 2901 |
| 81 | Ga0070702_100000039 | 3300005615 | Bacteria | 35203 |
| 82 | Ga0068852_100571892 | 3300005616 | Bacteria | 1132 |
| 83 | Ga0068859_100000420 | 3300005617 | Bacteria | 42401 |
| 84 | Ga0068859_100136430 | 3300005617 | Bacteria | 2526 |
| 85 | Ga0068866_10000153 | 3300005718 | Bacteria | 31527 |
| 86 | Ga0068866_10200452 | 3300005718 | Bacteria | 1192 |
| 87 | Ga0068861_100000399 | 3300005719 | Bacteria | 25138 |
| 88 | Ga0068870_10017240 | 3300005840 | Bacteria | 3467 |
| 89 | Ga0068870_10020769 | 3300005840 | Bacteria | 3203 |
| 90 | Ga0068863_100074364 | 3300005841 | Bacteria | 3214 |
| 91 | Ga0068858_100004592 | 3300005842 | Bacteria | 13518 |
| 92 | Ga0068860_100002022 | 3300005843 | Bacteria | 21401 |
| 93 | Ga0068862_100004066 | 3300005844 | Bacteria | 12403 |
| 94 | Ga0068862_100513479 | 3300005844 | Bacteria | 1139 |
| 95 | Ga0068862_101789230 | 3300005844 | Unclassified | 623 |
| 96 | Ga0081455_10031088 | 3300005937 | Bacteria | 4836 |
| 97 | Ga0081540_1021285 | 3300005983 | Bacteria | 3869 |
| 98 | Ga0070716_100149050 | 3300006173 | Bacteria | 1502 |
| 99 | Ga0097621_100000754 | 3300006237 | Bacteria | 22721 |
| 100 | Ga0068871_100001380 | 3300006358 | Bacteria | 16255 |
| 101 | Ga0075428_100004852 | 3300006844 | Bacteria | 14923 |
| 102 | Ga0075428_101639869 | 3300006844 | Unclassified | 672 |
| 103 | Ga0075430_100001797 | 3300006846 | Bacteria | 17542 |
| 104 | Ga0075430_100053008 | 3300006846 | Bacteria | 3416 |
| 105 | Ga0075430_100389387 | 3300006846 | Unclassified | 1150 |
| 106 | Ga0075430_100576219 | 3300006846 | Bacteria | 928 |
| 107 | Ga0075430_100795285 | 3300006846 | Bacteria | 779 |
| 108 | Ga0075431_100000072 | 3300006847 | Bacteria | 58754 |
| 109 | Ga0075431_100286697 | 3300006847 | Bacteria | 1666 |
| 110 | Ga0075431_100504396 | 3300006847 | Bacteria | 1201 |
| 111 | Ga0075431_101419566 | 3300006847 | Bacteria | 653 |
| 112 | Ga0075433_10287217 | 3300006852 | Bacteria | 1457 |
| 113 | Ga0075433_10678693 | 3300006852 | Bacteria | 903 |
| 114 | Ga0075429_100053218 | 3300006880 | Bacteria | 3522 |
| 115 | Ga0075429_100377494 | 3300006880 | Bacteria | 1241 |
| 116 | Ga0075429_101206071 | 3300006880 | Bacteria | 660 |
| 117 | Ga0068865_100003371 | 3300006881 | Bacteria | 9571 |
| 118 | Ga0075436_100926981 | 3300006914 | Bacteria | 652 |
| 119 | Ga0097620_100000420 | 3300006931 | Bacteria | 42401 |
| 120 | Ga0097620_100136440 | 3300006931 | Bacteria | 2526 |
| 121 | Ga0075435_100629331 | 3300007076 | Unclassified | 931 |
| 122 | Ga0111539_10025289 | 3300009094 | Bacteria | 7278 |
| 123 | Ga0111539_10218769 | 3300009094 | Bacteria | 2218 |
| 124 | Ga0105245_10000533 | 3300009098 | Bacteria | 34922 |
| 125 | Ga0105245_10027951 | 3300009098 | Bacteria | 4971 |
| 126 | Ga0105245_10273113 | 3300009098 | Bacteria | 1649 |
| 127 | Ga0114129_10002987 | 3300009147 | Bacteria | 23703 |
| 128 | Ga0114129_12821884 | 3300009147 | Bacteria | 577 |
| 129 | Ga0105243_10000495 | 3300009148 | Bacteria | 40193 |
| 130 | Ga0105243_10004756 | 3300009148 | Bacteria | 10672 |
| 131 | Ga0105243_10099244 | 3300009148 | Bacteria | 2413 |
| 132 | Ga0105241_10009614 | 3300009174 | Bacteria | 7108 |
| 133 | Ga0105241_10096209 | 3300009174 | Bacteria | 2345 |
| 134 | Ga0105242_10000248 | 3300009176 | Bacteria | 42523 |
| 135 | Ga0105242_10003680 | 3300009176 | Bacteria | 11930 |
| 136 | Ga0105242_10050091 | 3300009176 | Bacteria | 3400 |
| 137 | Ga0105249_10010445 | 3300009553 | Bacteria | 8157 |
| 138 | Ga0105249_10036559 | 3300009553 | Bacteria | 4455 |
| 139 | Ga0105239_10081132 | 3300010375 | Bacteria | 3570 |
| 140 | Ga0105246_10053457 | 3300011119 | Bacteria | 2779 |
| 141 | Ga0105246_10285906 | 3300011119 | Bacteria | 1325 |
| 142 | Ga0157322_1018748 | 3300012490 | Unclassified | 647 |
| 143 | Ga0157378_10000387 | 3300013297 | Bacteria | 43542 |
| 144 | Ga0163162_10359417 | 3300013306 | Bacteria | 1589 |
| 145 | Ga0157380_11105231 | 3300014326 | Bacteria | 832 |
| 146 | Ga0157377_10746998 | 3300014745 | Unclassified | 715 |
| 147 | Ga0207653_10002620 | 3300025885 | Bacteria | 5713 |
| 148 | Ga0207653_10003570 | 3300025885 | Bacteria | 4899 |
| 149 | Ga0207642_10000130 | 3300025899 | Bacteria | 20678 |
| 150 | Ga0207688_10041973 | 3300025901 | Bacteria | 2546 |
| 151 | Ga0207643_10070334 | 3300025908 | Bacteria | 2013 |
| 152 | Ga0207684_11333885 | 3300025910 | Bacteria | 590 |
| 153 | Ga0207654_10011544 | 3300025911 | Bacteria | 4507 |
| 154 | Ga0207654_10023949 | 3300025911 | Bacteria | 3276 |
| 155 | Ga0207707_10022504 | 3300025912 | Bacteria | 5509 |
| 156 | Ga0207660_10000756 | 3300025917 | Bacteria | 21503 |
| 157 | Ga0207660_10039006 | 3300025917 | Bacteria | 3318 |
| 158 | Ga0207660_10542125 | 3300025917 | Bacteria | 946 |
| 159 | Ga0207662_10000095 | 3300025918 | Bacteria | 41923 |
| 160 | Ga0207652_10003750 | 3300025921 | Bacteria | 12466 |
| 161 | Ga0207646_10049826 | 3300025922 | Bacteria | 3750 |
| 162 | Ga0207646_10234512 | 3300025922 | Bacteria | 1658 |
| 163 | Ga0207681_11368863 | 3300025923 | Unclassified | 594 |
| 164 | Ga0207659_10102993 | 3300025926 | Bacteria | 2156 |
| 165 | Ga0207687_10000432 | 3300025927 | Bacteria | 28412 |
| 166 | Ga0207706_10217678 | 3300025933 | Bacteria | 1673 |
| 167 | Ga0207686_10001368 | 3300025934 | Bacteria | 13851 |
| 168 | Ga0207686_10003894 | 3300025934 | Bacteria | 8003 |
| 169 | Ga0207686_10247648 | 3300025934 | Bacteria | 1300 |
| 170 | Ga0207709_10001646 | 3300025935 | Bacteria | 15123 |
| 171 | Ga0207709_10016902 | 3300025935 | Bacteria | 4065 |
| 172 | Ga0207670_10002845 | 3300025936 | Bacteria | 9135 |
| 173 | Ga0207670_10031378 | 3300025936 | Bacteria | 3405 |
| 174 | Ga0207670_10453722 | 3300025936 | Bacteria | 1034 |
| 175 | Ga0207704_10000281 | 3300025938 | Bacteria | 24286 |
| 176 | Ga0207665_10249358 | 3300025939 | Bacteria | 1311 |
| 177 | Ga0207689_10000977 | 3300025942 | Bacteria | 27402 |
| 178 | Ga0207689_10028165 | 3300025942 | Bacteria | 4698 |
| 179 | Ga0207667_10005008 | 3300025949 | Bacteria | 16189 |
| 180 | Ga0207712_10002627 | 3300025961 | Bacteria | 11512 |
| 181 | Ga0207712_10073432 | 3300025961 | Bacteria | 2467 |
| 182 | Ga0207640_10004566 | 3300025981 | Bacteria | 7511 |
| 183 | Ga0207640_11258376 | 3300025981 | Bacteria | 659 |
| 184 | Ga0207677_10000832 | 3300026023 | Bacteria | 17660 |
| 185 | Ga0207703_10005254 | 3300026035 | Bacteria | 10444 |
| 186 | Ga0207708_10000551 | 3300026075 | Bacteria | 28958 |
| 187 | Ga0207708_10451122 | 3300026075 | Bacteria | 1071 |
| 188 | Ga0207702_10013754 | 3300026078 | Bacteria | 6721 |
| 189 | Ga0207641_10060269 | 3300026088 | Bacteria | 3235 |
| 190 | Ga0207648_10000513 | 3300026089 | Bacteria | 43298 |
| 191 | Ga0207648_10282458 | 3300026089 | Bacteria | 1485 |
| 192 | Ga0207648_10915202 | 3300026089 | Bacteria | 820 |
| 193 | Ga0207674_10053886 | 3300026116 | Bacteria | 4097 |
| 194 | Ga0207674_10264213 | 3300026116 | Bacteria | 1668 |
| 195 | Ga0207675_100001063 | 3300026118 | Bacteria | 27254 |
| 196 | Ga0207698_10076668 | 3300026142 | Bacteria | 2677 |
| 197 | Ga0209999_1004765 | 3300027543 | Bacteria | 2438 |
| 198 | Ga0209966_1032319 | 3300027695 | Bacteria | 1065 |
| 199 | Ga0207428_10003903 | 3300027907 | Bacteria | 14300 |
| 200 | Ga0207428_10175115 | 3300027907 | Bacteria | 1623 |
| 201 | Ga0268265_10006650 | 3300028380 | Bacteria | 7822 |
| 202 | Ga0268264_10000827 | 3300028381 | Bacteria | 33217 |
| 203 | Ga0268264_10041894 | 3300028381 | Bacteria | 3788 |
| 204 | Ga0307408_100010548 | 3300031548 | Bacteria | 6094 |
| 205 | Ga0307408_100592242 | 3300031548 | Bacteria | 984 |
| 206 | Ga0307408_100954849 | 3300031548 | Bacteria | 788 |
| 207 | Ga0307405_10032172 | 3300031731 | Bacteria | 3098 |
| 208 | Ga0307405_10218707 | 3300031731 | Bacteria | 1396 |
| 209 | Ga0307406_10484875 | 3300031901 | Bacteria | 999 |
| 210 | Ga0307412_11959989 | 3300031911 | Bacteria | 541 |
| 211 | Ga0307409_102548988 | 3300031995 | Bacteria | 540 |
| 212 | Ga0307416_100184642 | 3300032002 | Bacteria | 1959 |
| 213 | Ga0307416_100196212 | 3300032002 | Bacteria | 1910 |
| 214 | Ga0307416_101434134 | 3300032002 | Bacteria | 796 |
| 215 | Ga0307416_101539114 | 3300032002 | Bacteria | 771 |
| 216 | Ga0307411_10111627 | 3300032005 | Bacteria | 1958 |
| 217 | Ga0307411_10943120 | 3300032005 | Bacteria | 769 |
| 218 | Ga0307415_100813970 | 3300032126 | Bacteria | 854 |
| 219 | Ga0373930_0004384 | 3300034816 | Bacteria | 2294 |
| 220 | Ga0373948_0002060 | 3300034817 | Bacteria | 2912 |
| 221 | Ga0373958_0006525 | 3300034819 | Bacteria | 1822 |
| 222 | Ga0373928_0003711 | 3300035084 | Bacteria | 2910 |
| 223 | Ga0373929_0036497 | 3300035085 | Bacteria | 1074 |
| 224 | Ga0373929_0038361 | 3300035085 | Bacteria | 1054 |
| 225 | Ga0373940_0015511 | 3300035088 | Bacteria | 1875 |
| 226 | Ga0373932_0238592 | 3300035112 | Bacteria | 659 |
| 227 | Ga0373939_0001211 | 3300035114 | Bacteria | 6303 |
| 228 | Ga0373939_0060329 | 3300035114 | Bacteria | 1205 |
| 229 | Ga0373942_0081604 | 3300035207 | Bacteria | 961 |
| 230 | Ga0373931_0004111 | 3300035691 | Bacteria | 6604 |
| 231 | Ga0373931_0004119 | 3300035691 | Bacteria | 6594 |
| 232 | Ga0373931_0004688 | 3300035691 | Bacteria | 6259 |
| 233 | Ga0373931_0062853 | 3300035691 | Bacteria | 2005 |
| 234 | Ga0373931_0210443 | 3300035691 | Bacteria | 1166 |
| 235 | Ga0395905_0405026 | 3300037471 | Bacteria | 1259 |
| 236 | Ga0439439_0181465 | 3300041406 | Bacteria | 606 |
| 237 | Ga0451807_1436759 | 3300041486 | Bacteria | 2193 |
| 238 | Ga0439441_000352 | 3300042001 | Bacteria | 4718 |
| 239 | Ga0439441_006456 | 3300042001 | Bacteria | 1862 |
| 240 | Ga0439441_153211 | 3300042001 | Unclassified | 544 |
| 241 | Ga0439455_0013914 | 3300042012 | Bacteria | 1831 |
| 242 | Ga0439462_0033213 | 3300042015 | Bacteria | 1368 |
| 243 | Ga0450913_007928 | 3300042117 | Unclassified | 808 |
| 244 | Ga0439446_0005214 | 3300042156 | Bacteria | 3334 |
| 245 | Ga0439434_0000265 | 3300042435 | Bacteria | 14847 |
| 246 | Ga0439435_0000039 | 3300042436 | Bacteria | 14411 |
| 247 | Ga0439435_0012348 | 3300042436 | Bacteria | 2068 |
| 248 | Ga0439444_0093729 | 3300042437 | Unclassified | 673 |
| 249 | Ga0439464_0032752 | 3300042439 | Bacteria | 1461 |
| 250 | Ga0439464_0057476 | 3300042439 | Bacteria | 1134 |
| 251 | Ga0451577_0035929 | 3300042876 | Bacteria | 4463 |
| 252 | Ga0451577_0240335 | 3300042876 | Bacteria | 1639 |
| 253 | Ga0453683_1215490 | 3300044673 | Unclassified | 505 |
| 254 | Ga0466963_0439948 | 3300044694 | Bacteria | 920 |
| 255 | Ga0451576_0003270 | 3300045051 | Bacteria | 22501 |
| 256 | Ga0451576_0230453 | 3300045051 | Bacteria | 1934 |
| 257 | Ga0451576_0389174 | 3300045051 | Bacteria | 1461 |
| 258 | Ga0451576_0399861 | 3300045051 | Bacteria | 1440 |
| 259 | Ga0466967_0006233 | 3300045976 | Bacteria | 8409 |
| 260 | Ga0496102_1108516 | 3300048905 | Bacteria | 711 |
| 261 | Ga0501298_084860 | 3300049521 | Bacteria | 702 |
| 262 | Ga0501031_0297196 | 3300049568 | Bacteria | 1047 |
| 263 | Ga0501033_0292328 | 3300049570 | Bacteria | 1149 |
| 264 | Ga0501039_0469481 | 3300049575 | Unclassified | 988 |
| 265 | Ga0501039_0961818 | 3300049575 | Bacteria | 664 |
| 266 | Ga0501040_0102228 | 3300049576 | Bacteria | 2000 |
| 267 | Ga0501040_0323429 | 3300049576 | Bacteria | 1103 |
| 268 | Ga0501040_0534779 | 3300049576 | Unclassified | 846 |
| 269 | Ga0501040_0782651 | 3300049576 | Unclassified | 690 |
| 270 | Ga0501042_0284289 | 3300049578 | Bacteria | 1195 |
| 271 | Ga0501067_0284161 | 3300049583 | Bacteria | 921 |
| 272 | Ga0501069_0188478 | 3300049585 | Bacteria | 1193 |
| 273 | Ga0501071_0577271 | 3300049587 | Bacteria | 864 |
| 274 | Ga0501071_1011065 | 3300049587 | Bacteria | 642 |
| 275 | Ga0501072_0172512 | 3300049588 | Bacteria | 1726 |
| 276 | Ga0501072_0361126 | 3300049588 | Unclassified | 1153 |
| 277 | Ga0501072_0363447 | 3300049588 | Bacteria | 1149 |
| 278 | Ga0501076_0245341 | 3300049592 | Bacteria | 1465 |
| 279 | Ga0501076_0853537 | 3300049592 | Bacteria | 751 |
| 280 | Ga0501076_1229021 | 3300049592 | Bacteria | 616 |
| 281 | Ga0501077_0324185 | 3300049593 | Bacteria | 982 |
| 282 | Ga0501045_0036921 | 3300049824 | Bacteria | 3550 |
| 283 | Ga0501045_0729385 | 3300049824 | Bacteria | 731 |
| 284 | nmdc:mga05p37_1874284_c1 | 3300050507 | Bacteria | 574 |
| 285 | nmdc:mga05p37_1935_c1 | 3300050507 | Bacteria | 24113 |
| 286 | nmdc:mga09592_859475_c1 | 3300050508 | Bacteria | 765 |
| 287 | nmdc:mga09592_89148_c1 | 3300050508 | Bacteria | 2635 |
| 288 | nmdc:mga0qj67_126303_c1 | 3300050509 | Bacteria | 2070 |
| 289 | nmdc:mga0qj67_27289_c1 | 3300050509 | Bacteria | 4424 |
| 290 | nmdc:mga0qj67_61795_c1 | 3300050509 | Bacteria | 2975 |
| 291 | nmdc:mga06r32_113663_c1 | 3300050510 | Bacteria | 2665 |
| 292 | nmdc:mga06r32_79664_c1 | 3300050510 | Bacteria | 3186 |
| 293 | nmdc:mga06r32_987_c1 | 3300050510 | Bacteria | 25489 |
| 294 | nmdc:mga08y16_122804_c1 | 3300050511 | Bacteria | 2702 |
| 295 | nmdc:mga08y16_299548_c1 | 3300050511 | Bacteria | 1658 |
| 296 | nmdc:mga08y16_60877_c1 | 3300050511 | Bacteria | 3942 |
| 297 | Ga0501082_1460837 | 3300060353 | Unclassified | 597 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031731 | Ga0307405_10032172 | Ga0307405_100321723 | 126 |
| 2 | 3300031911 | Ga0307412_11959989 | Ga0307412_119599892 | 126 |
| 3 | 3300031995 | Ga0307409_102548988 | Ga0307409_1025489882 | 126 |
| 4 | 3300032002 | Ga0307416_100184642 | Ga0307416_1001846422 | 126 |
| 5 | 3300049587 | Ga0501071_1011065 | Ga0501071_1011065_11_406 | 131 |
| 6 | 3300009098 | Ga0105245_10273113 | Ga0105245_102731132 | 136 |
| 7 | 3300041406 | Ga0439439_0181465 | Ga0439439_0181465_67_549 | 136 |
| 8 | 3300049583 | Ga0501067_0284161 | Ga0501067_0284161_14_475 | 140 |
| 9 | 3300049585 | Ga0501069_0188478 | Ga0501069_0188478_275_736 | 140 |
| 10 | 3300005353 | Ga0070669_101587165 | Ga0070669_1015871651 | 141 |
| 11 | 3300005459 | Ga0068867_101859075 | Ga0068867_1018590751 | 141 |
| 12 | 3300005544 | Ga0070686_100268207 | Ga0070686_1002682072 | 141 |
| 13 | 3300005578 | Ga0068854_101800125 | Ga0068854_1018001251 | 141 |
| 14 | 3300005844 | Ga0068862_101789230 | Ga0068862_1017892301 | 141 |
| 15 | 3300025923 | Ga0207681_11368863 | Ga0207681_113688632 | 141 |
| 16 | 3300025981 | Ga0207640_11258376 | Ga0207640_112583762 | 141 |
| 17 | 3300026089 | Ga0207648_10915202 | Ga0207648_109152021 | 141 |
| 18 | 3300035085 | Ga0373929_0038361 | Ga0373929_0038361_19_480 | 141 |
| 19 | 3300035114 | Ga0373939_0060329 | Ga0373939_0060329_208_669 | 141 |
| 20 | 3300035207 | Ga0373942_0081604 | Ga0373942_0081604_318_779 | 141 |
| 21 | 3300035691 | Ga0373931_0004688 | Ga0373931_0004688_3992_4453 | 141 |
| 22 | 3300005546 | Ga0070696_100032776 | Ga0070696_1000327764 | 144 |
| 23 | 3300042876 | Ga0451577_0240335 | Ga0451577_0240335_812_1291 | 151 |
| 24 | 3300005546 | Ga0070696_100969860 | Ga0070696_1009698601 | 152 |
| 25 | 3300005578 | Ga0068854_101343770 | Ga0068854_1013437702 | 152 |
| 26 | 3300025917 | Ga0207660_10542125 | Ga0207660_105421252 | 152 |
| 27 | 3300032005 | Ga0307411_10111627 | Ga0307411_101116272 | 152 |
| 28 | 3300041486 | Ga0451807_1436759 | Ga0451807_1436759_1139_1597 | 152 |
| 29 | 3300042012 | Ga0439455_0013914 | Ga0439455_0013914_117_575 | 152 |
| 30 | 3300042439 | Ga0439464_0057476 | Ga0439464_0057476_659_1117 | 152 |
| 31 | 3300049576 | Ga0501040_0534779 | Ga0501040_0534779_13_471 | 152 |
| 32 | 3300005458 | Ga0070681_10002380 | Ga0070681_1000238012 | 153 |
| 33 | 3300005471 | Ga0070698_100419315 | Ga0070698_1004193152 | 153 |
| 34 | 3300005518 | Ga0070699_100423528 | Ga0070699_1004235281 | 153 |
| 35 | 3300005530 | Ga0070679_100032345 | Ga0070679_1000323456 | 153 |
| 36 | 3300025912 | Ga0207707_10022504 | Ga0207707_100225045 | 153 |
| 37 | 3300025936 | Ga0207670_10453722 | Ga0207670_104537222 | 153 |
| 38 | 3300031548 | Ga0307408_100954849 | Ga0307408_1009548492 | 153 |
| 39 | 3300049521 | Ga0501298_084860 | Ga0501298_084860_190_651 | 153 |
| 40 | 3300049570 | Ga0501033_0292328 | Ga0501033_0292328_82_543 | 153 |
| 41 | 3300049576 | Ga0501040_0102228 | Ga0501040_0102228_678_1139 | 153 |
| 42 | 3300049587 | Ga0501071_0577271 | Ga0501071_0577271_26_487 | 153 |
| 43 | 3300049588 | Ga0501072_0363447 | Ga0501072_0363447_140_601 | 153 |
| 44 | 3300049593 | Ga0501077_0324185 | Ga0501077_0324185_189_650 | 153 |
| 45 | iso_pu_bacteria | 2513237101 | 2513696733 | 153 |
| 46 | iso_pu_bacteria | 2721755755 | 2723846574 | 153 |
| 47 | iso_pu_bacteria | 2874604998 | 2874605601 | 153 |
| 48 | iso_pu_bacteria | 2922386360 | 2922391334 | 153 |
| 49 | iso_pu_bacteria | 8006964411 | 8006969700 | 153 |
| 50 | iso_pu_bacteria | 8006994254 | 8006995613 | 153 |
| 51 | iso_pu_bacteria | 8056681323 | 8056684992 | 153 |
| 52 | 3300005336 | Ga0070680_100628608 | Ga0070680_1006286082 | 154 |
| 53 | 3300005440 | Ga0070705_100895568 | Ga0070705_1008955681 | 154 |
| 54 | 3300005441 | Ga0070700_100319804 | Ga0070700_1003198042 | 154 |
| 55 | 3300005444 | Ga0070694_100172458 | Ga0070694_1001724582 | 154 |
| 56 | 3300005471 | Ga0070698_100083093 | Ga0070698_1000830933 | 154 |
| 57 | 3300005545 | Ga0070695_100520367 | Ga0070695_1005203672 | 154 |
| 58 | 3300005546 | Ga0070696_100237898 | Ga0070696_1002378982 | 154 |
| 59 | 3300005549 | Ga0070704_100086593 | Ga0070704_1000865932 | 154 |
| 60 | 3300005549 | Ga0070704_100107576 | Ga0070704_1001075762 | 154 |
| 61 | 3300005549 | Ga0070704_100427301 | Ga0070704_1004273012 | 154 |
| 62 | 3300005549 | Ga0070704_100714389 | Ga0070704_1007143891 | 154 |
| 63 | 3300006846 | Ga0075430_100053008 | Ga0075430_1000530084 | 154 |
| 64 | 3300006846 | Ga0075430_100576219 | Ga0075430_1005762192 | 154 |
| 65 | 3300006846 | Ga0075430_100795285 | Ga0075430_1007952852 | 154 |
| 66 | 3300006847 | Ga0075431_100504396 | Ga0075431_1005043962 | 154 |
| 67 | 3300006847 | Ga0075431_101419566 | Ga0075431_1014195661 | 154 |
| 68 | 3300006852 | Ga0075433_10287217 | Ga0075433_102872172 | 154 |
| 69 | 3300006880 | Ga0075429_101206071 | Ga0075429_1012060711 | 154 |
| 70 | 3300006914 | Ga0075436_100926981 | Ga0075436_1009269812 | 154 |
| 71 | 3300009148 | Ga0105243_10099244 | Ga0105243_100992442 | 154 |
| 72 | 3300014326 | Ga0157380_11105231 | Ga0157380_111052311 | 154 |
| 73 | 3300027543 | Ga0209999_1004765 | Ga0209999_10047652 | 154 |
| 74 | 3300027695 | Ga0209966_1032319 | Ga0209966_10323192 | 154 |
| 75 | 3300031548 | Ga0307408_100010548 | Ga0307408_1000105482 | 154 |
| 76 | 3300032002 | Ga0307416_101434134 | Ga0307416_1014341342 | 154 |
| 77 | 3300032002 | Ga0307416_101539114 | Ga0307416_1015391142 | 154 |
| 78 | 3300032005 | Ga0307411_10943120 | Ga0307411_109431201 | 154 |
| 79 | 3300032126 | Ga0307415_100813970 | Ga0307415_1008139702 | 154 |
| 80 | 3300042001 | Ga0439441_006456 | Ga0439441_006456_307_771 | 154 |
| 81 | 3300044694 | Ga0466963_0439948 | Ga0466963_0439948_208_693 | 154 |
| 82 | 3300045976 | Ga0466967_0006233 | Ga0466967_0006233_1798_2283 | 154 |
| 83 | 3300049592 | Ga0501076_0853537 | Ga0501076_0853537_148_612 | 154 |
| 84 | 3300050508 | nmdc:mga09592_859475_c1 | nmdc:mga09592_859475_c1_170_640 | 154 |
| 85 | 3300050509 | nmdc:mga0qj67_27289_c1 | nmdc:mga0qj67_27289_c1_2654_3118 | 154 |
| 86 | 3300050510 | nmdc:mga06r32_113663_c1 | nmdc:mga06r32_113663_c1_570_1034 | 154 |
| 87 | 3300005341 | Ga0070691_10005141 | Ga0070691_100051413 | 155 |
| 88 | 3300005343 | Ga0070687_100615385 | Ga0070687_1006153851 | 155 |
| 89 | 3300005345 | Ga0070692_10000992 | Ga0070692_1000099211 | 155 |
| 90 | 3300005345 | Ga0070692_10429135 | Ga0070692_104291351 | 155 |
| 91 | 3300005406 | Ga0070703_10011205 | Ga0070703_100112052 | 155 |
| 92 | 3300005406 | Ga0070703_10346844 | Ga0070703_103468441 | 155 |
| 93 | 3300005438 | Ga0070701_10004359 | Ga0070701_100043594 | 155 |
| 94 | 3300005440 | Ga0070705_100003244 | Ga0070705_1000032443 | 155 |
| 95 | 3300005441 | Ga0070700_100030932 | Ga0070700_1000309322 | 155 |
| 96 | 3300005444 | Ga0070694_100013830 | Ga0070694_1000138302 | 155 |
| 97 | 3300005459 | Ga0068867_100182039 | Ga0068867_1001820392 | 155 |
| 98 | 3300005467 | Ga0070706_101652813 | Ga0070706_1016528131 | 155 |
| 99 | 3300005468 | Ga0070707_100058426 | Ga0070707_1000584262 | 155 |
| 100 | 3300005468 | Ga0070707_100592536 | Ga0070707_1005925361 | 155 |
| 101 | 3300005468 | Ga0070707_100930392 | Ga0070707_1009303921 | 155 |
| 102 | 3300005471 | Ga0070698_100042676 | Ga0070698_1000426763 | 155 |
| 103 | 3300005471 | Ga0070698_100084320 | Ga0070698_1000843203 | 155 |
| 104 | 3300005518 | Ga0070699_100015436 | Ga0070699_1000154363 | 155 |
| 105 | 3300005536 | Ga0070697_100163590 | Ga0070697_1001635902 | 155 |
| 106 | 3300005545 | Ga0070695_100022709 | Ga0070695_1000227092 | 155 |
| 107 | 3300005545 | Ga0070695_100031072 | Ga0070695_1000310722 | 155 |
| 108 | 3300005546 | Ga0070696_100030181 | Ga0070696_1000301813 | 155 |
| 109 | 3300005546 | Ga0070696_101036416 | Ga0070696_1010364162 | 155 |
| 110 | 3300005547 | Ga0070693_100129392 | Ga0070693_1001293922 | 155 |
| 111 | 3300005547 | Ga0070693_100798721 | Ga0070693_1007987211 | 155 |
| 112 | 3300005549 | Ga0070704_100045919 | Ga0070704_1000459192 | 155 |
| 113 | 3300005549 | Ga0070704_100066657 | Ga0070704_1000666572 | 155 |
| 114 | 3300005577 | Ga0068857_100240574 | Ga0068857_1002405742 | 155 |
| 115 | 3300005617 | Ga0068859_100136430 | Ga0068859_1001364302 | 155 |
| 116 | 3300005718 | Ga0068866_10200452 | Ga0068866_102004522 | 155 |
| 117 | 3300005840 | Ga0068870_10017240 | Ga0068870_100172403 | 155 |
| 118 | 3300005844 | Ga0068862_100513479 | Ga0068862_1005134792 | 155 |
| 119 | 3300006844 | Ga0075428_101639869 | Ga0075428_1016398692 | 155 |
| 120 | 3300006846 | Ga0075430_100001797 | Ga0075430_1000017978 | 155 |
| 121 | 3300006846 | Ga0075430_100389387 | Ga0075430_1003893872 | 155 |
| 122 | 3300006847 | Ga0075431_100000072 | Ga0075431_10000007250 | 155 |
| 123 | 3300006847 | Ga0075431_100286697 | Ga0075431_1002866972 | 155 |
| 124 | 3300006880 | Ga0075429_100377494 | Ga0075429_1003774942 | 155 |
| 125 | 3300006931 | Ga0097620_100136440 | Ga0097620_1001364402 | 155 |
| 126 | 3300007076 | Ga0075435_100629331 | Ga0075435_1006293312 | 155 |
| 127 | 3300009098 | Ga0105245_10027951 | Ga0105245_100279514 | 155 |
| 128 | 3300009148 | Ga0105243_10004756 | Ga0105243_100047563 | 155 |
| 129 | 3300009174 | Ga0105241_10096209 | Ga0105241_100962092 | 155 |
| 130 | 3300009176 | Ga0105242_10003680 | Ga0105242_100036806 | 155 |
| 131 | 3300009176 | Ga0105242_10050091 | Ga0105242_100500912 | 155 |
| 132 | 3300009553 | Ga0105249_10036559 | Ga0105249_100365592 | 155 |
| 133 | 3300011119 | Ga0105246_10053457 | Ga0105246_100534572 | 155 |
| 134 | 3300025885 | Ga0207653_10003570 | Ga0207653_100035703 | 155 |
| 135 | 3300025908 | Ga0207643_10070334 | Ga0207643_100703342 | 155 |
| 136 | 3300025910 | Ga0207684_11333885 | Ga0207684_113338851 | 155 |
| 137 | 3300025911 | Ga0207654_10023949 | Ga0207654_100239493 | 155 |
| 138 | 3300025917 | Ga0207660_10039006 | Ga0207660_100390062 | 155 |
| 139 | 3300025922 | Ga0207646_10049826 | Ga0207646_100498263 | 155 |
| 140 | 3300025922 | Ga0207646_10234512 | Ga0207646_102345122 | 155 |
| 141 | 3300025934 | Ga0207686_10003894 | Ga0207686_100038947 | 155 |
| 142 | 3300025934 | Ga0207686_10247648 | Ga0207686_102476482 | 155 |
| 143 | 3300025935 | Ga0207709_10016902 | Ga0207709_100169023 | 155 |
| 144 | 3300025936 | Ga0207670_10031378 | Ga0207670_100313782 | 155 |
| 145 | 3300025942 | Ga0207689_10028165 | Ga0207689_100281651 | 155 |
| 146 | 3300025961 | Ga0207712_10073432 | Ga0207712_100734321 | 155 |
| 147 | 3300026075 | Ga0207708_10451122 | Ga0207708_104511222 | 155 |
| 148 | 3300026089 | Ga0207648_10282458 | Ga0207648_102824583 | 155 |
| 149 | 3300026116 | Ga0207674_10053886 | Ga0207674_100538861 | 155 |
| 150 | 3300026116 | Ga0207674_10264213 | Ga0207674_102642132 | 155 |
| 151 | 3300028381 | Ga0268264_10041894 | Ga0268264_100418942 | 155 |
| 152 | 3300031548 | Ga0307408_100592242 | Ga0307408_1005922422 | 155 |
| 153 | 3300031731 | Ga0307405_10218707 | Ga0307405_102187072 | 155 |
| 154 | 3300031901 | Ga0307406_10484875 | Ga0307406_104848752 | 155 |
| 155 | 3300032002 | Ga0307416_100196212 | Ga0307416_1001962122 | 155 |
| 156 | 3300035691 | Ga0373931_0210443 | Ga0373931_0210443_297_764 | 155 |
| 157 | 3300042001 | Ga0439441_000352 | Ga0439441_000352_3101_3589 | 155 |
| 158 | 3300042001 | Ga0439441_153211 | Ga0439441_153211_63_530 | 155 |
| 159 | 3300042015 | Ga0439462_0033213 | Ga0439462_0033213_250_717 | 155 |
| 160 | 3300042117 | Ga0450913_007928 | Ga0450913_007928_17_493 | 155 |
| 161 | 3300042156 | Ga0439446_0005214 | Ga0439446_0005214_466_933 | 155 |
| 162 | 3300042435 | Ga0439434_0000265 | Ga0439434_0000265_5173_5640 | 155 |
| 163 | 3300042436 | Ga0439435_0000039 | Ga0439435_0000039_13555_14022 | 155 |
| 164 | 3300042436 | Ga0439435_0012348 | Ga0439435_0012348_711_1178 | 155 |
| 165 | 3300042437 | Ga0439444_0093729 | Ga0439444_0093729_145_612 | 155 |
| 166 | 3300042439 | Ga0439464_0032752 | Ga0439464_0032752_352_828 | 155 |
| 167 | 3300045051 | Ga0451576_0399861 | Ga0451576_0399861_897_1370 | 155 |
| 168 | 3300049578 | Ga0501042_0284289 | Ga0501042_0284289_385_852 | 155 |
| 169 | 3300049592 | Ga0501076_1229021 | Ga0501076_1229021_20_487 | 155 |
| 170 | 3300050509 | nmdc:mga0qj67_126303_c1 | nmdc:mga0qj67_126303_c1_856_1341 | 155 |
| 171 | 3300050509 | nmdc:mga0qj67_61795_c1 | nmdc:mga0qj67_61795_c1_1595_2062 | 155 |
| 172 | 3300050510 | nmdc:mga06r32_79664_c1 | nmdc:mga06r32_79664_c1_293_760 | 155 |
| 173 | 3300050510 | nmdc:mga06r32_987_c1 | nmdc:mga06r32_987_c1_15506_15991 | 155 |
| 174 | 3300050511 | nmdc:mga08y16_122804_c1 | nmdc:mga08y16_122804_c1_71_538 | 155 |
| 175 | 3300005440 | Ga0070705_100192389 | Ga0070705_1001923892 | 156 |
| 176 | 3300005545 | Ga0070695_101069140 | Ga0070695_1010691401 | 156 |
| 177 | 3300009094 | Ga0111539_10025289 | Ga0111539_100252893 | 156 |
| 178 | 3300009147 | Ga0114129_12821884 | Ga0114129_128218842 | 156 |
| 179 | 3300027907 | Ga0207428_10175115 | Ga0207428_101751152 | 156 |
| 180 | 3300044673 | Ga0453683_1215490 | Ga0453683_1215490_12_482 | 156 |
| 181 | 3300049568 | Ga0501031_0297196 | Ga0501031_0297196_326_796 | 156 |
| 182 | 3300049575 | Ga0501039_0469481 | Ga0501039_0469481_134_604 | 156 |
| 183 | 3300049575 | Ga0501039_0961818 | Ga0501039_0961818_171_641 | 156 |
| 184 | 3300049576 | Ga0501040_0323429 | Ga0501040_0323429_287_757 | 156 |
| 185 | 3300049576 | Ga0501040_0782651 | Ga0501040_0782651_26_496 | 156 |
| 186 | 3300049588 | Ga0501072_0361126 | Ga0501072_0361126_333_803 | 156 |
| 187 | 3300049592 | Ga0501076_0245341 | Ga0501076_0245341_699_1169 | 156 |
| 188 | 3300049824 | Ga0501045_0036921 | Ga0501045_0036921_2047_2517 | 156 |
| 189 | 3300050507 | nmdc:mga05p37_1874284_c1 | nmdc:mga05p37_1874284_c1_28_498 | 156 |
| 190 | 3300050511 | nmdc:mga08y16_60877_c1 | nmdc:mga08y16_60877_c1_1980_2456 | 156 |
| 191 | 3300060353 | Ga0501082_1460837 | Ga0501082_1460837_72_542 | 156 |
| 192 | 3300005937 | Ga0081455_10031088 | Ga0081455_100310882 | 157 |
| 193 | 3300005983 | Ga0081540_1021285 | Ga0081540_10212853 | 157 |
| 194 | 3300037471 | Ga0395905_0405026 | Ga0395905_0405026_215_697 | 157 |
| 195 | 3300005295 | Ga0065707_10179081 | Ga0065707_101790812 | 158 |
| 196 | 3300005330 | Ga0070690_100000131 | Ga0070690_10000013134 | 158 |
| 197 | 3300005334 | Ga0068869_100000392 | Ga0068869_1000003926 | 158 |
| 198 | 3300005336 | Ga0070680_100002214 | Ga0070680_10000221419 | 158 |
| 199 | 3300005337 | Ga0070682_100003841 | Ga0070682_1000038419 | 158 |
| 200 | 3300005338 | Ga0068868_100000656 | Ga0068868_1000006566 | 158 |
| 201 | 3300005340 | Ga0070689_100001412 | Ga0070689_1000014123 | 158 |
| 202 | 3300005341 | Ga0070691_10008455 | Ga0070691_100084552 | 158 |
| 203 | 3300005343 | Ga0070687_100000175 | Ga0070687_10000017529 | 158 |
| 204 | 3300005345 | Ga0070692_10001310 | Ga0070692_100013104 | 158 |
| 205 | 3300005354 | Ga0070675_100110676 | Ga0070675_1001106762 | 158 |
| 206 | 3300005406 | Ga0070703_10003837 | Ga0070703_100038371 | 158 |
| 207 | 3300005438 | Ga0070701_10000060 | Ga0070701_100000609 | 158 |
| 208 | 3300005440 | Ga0070705_100000431 | Ga0070705_10000043119 | 158 |
| 209 | 3300005441 | Ga0070700_100000587 | Ga0070700_10000058726 | 158 |
| 210 | 3300005444 | Ga0070694_100000136 | Ga0070694_10000013611 | 158 |
| 211 | 3300005457 | Ga0070662_100315209 | Ga0070662_1003152092 | 158 |
| 212 | 3300005459 | Ga0068867_100002957 | Ga0068867_1000029573 | 158 |
| 213 | 3300005530 | Ga0070679_100205311 | Ga0070679_1002053112 | 158 |
| 214 | 3300005536 | Ga0070697_100979874 | Ga0070697_1009798742 | 158 |
| 215 | 3300005544 | Ga0070686_100000285 | Ga0070686_10000028516 | 158 |
| 216 | 3300005545 | Ga0070695_100001799 | Ga0070695_10000179911 | 158 |
| 217 | 3300005546 | Ga0070696_100002841 | Ga0070696_1000028415 | 158 |
| 218 | 3300005547 | Ga0070693_100000278 | Ga0070693_10000027828 | 158 |
| 219 | 3300005549 | Ga0070704_100000103 | Ga0070704_10000010327 | 158 |
| 220 | 3300005563 | Ga0068855_100001779 | Ga0068855_10000177921 | 158 |
| 221 | 3300005578 | Ga0068854_100009113 | Ga0068854_1000091133 | 158 |
| 222 | 3300005614 | Ga0068856_100099318 | Ga0068856_1000993182 | 158 |
| 223 | 3300005615 | Ga0070702_100000039 | Ga0070702_10000003927 | 158 |
| 224 | 3300005616 | Ga0068852_100571892 | Ga0068852_1005718922 | 158 |
| 225 | 3300005617 | Ga0068859_100000420 | Ga0068859_10000042022 | 158 |
| 226 | 3300005718 | Ga0068866_10000153 | Ga0068866_1000015322 | 158 |
| 227 | 3300005719 | Ga0068861_100000399 | Ga0068861_1000003997 | 158 |
| 228 | 3300005840 | Ga0068870_10020769 | Ga0068870_100207691 | 158 |
| 229 | 3300005841 | Ga0068863_100074364 | Ga0068863_1000743642 | 158 |
| 230 | 3300005842 | Ga0068858_100004592 | Ga0068858_1000045927 | 158 |
| 231 | 3300005843 | Ga0068860_100002022 | Ga0068860_1000020223 | 158 |
| 232 | 3300005844 | Ga0068862_100004066 | Ga0068862_10000406612 | 158 |
| 233 | 3300006173 | Ga0070716_100149050 | Ga0070716_1001490502 | 158 |
| 234 | 3300006237 | Ga0097621_100000754 | Ga0097621_10000075427 | 158 |
| 235 | 3300006358 | Ga0068871_100001380 | Ga0068871_1000013804 | 158 |
| 236 | 3300006844 | Ga0075428_100004852 | Ga0075428_10000485218 | 158 |
| 237 | 3300006852 | Ga0075433_10678693 | Ga0075433_106786932 | 158 |
| 238 | 3300006880 | Ga0075429_100053218 | Ga0075429_1000532182 | 158 |
| 239 | 3300006881 | Ga0068865_100003371 | Ga0068865_1000033716 | 158 |
| 240 | 3300006931 | Ga0097620_100000420 | Ga0097620_10000042022 | 158 |
| 241 | 3300009094 | Ga0111539_10218769 | Ga0111539_102187692 | 158 |
| 242 | 3300009098 | Ga0105245_10000533 | Ga0105245_1000053319 | 158 |
| 243 | 3300009147 | Ga0114129_10002987 | Ga0114129_100029876 | 158 |
| 244 | 3300009148 | Ga0105243_10000495 | Ga0105243_100004958 | 158 |
| 245 | 3300009174 | Ga0105241_10009614 | Ga0105241_100096144 | 158 |
| 246 | 3300009176 | Ga0105242_10000248 | Ga0105242_1000024823 | 158 |
| 247 | 3300009553 | Ga0105249_10010445 | Ga0105249_100104456 | 158 |
| 248 | 3300010375 | Ga0105239_10081132 | Ga0105239_100811322 | 158 |
| 249 | 3300011119 | Ga0105246_10285906 | Ga0105246_102859062 | 158 |
| 250 | 3300012490 | Ga0157322_1018748 | Ga0157322_10187481 | 158 |
| 251 | 3300013297 | Ga0157378_10000387 | Ga0157378_1000038725 | 158 |
| 252 | 3300013306 | Ga0163162_10359417 | Ga0163162_103594172 | 158 |
| 253 | 3300014745 | Ga0157377_10746998 | Ga0157377_107469981 | 158 |
| 254 | 3300025885 | Ga0207653_10002620 | Ga0207653_100026208 | 158 |
| 255 | 3300025899 | Ga0207642_10000130 | Ga0207642_1000013021 | 158 |
| 256 | 3300025901 | Ga0207688_10041973 | Ga0207688_100419732 | 158 |
| 257 | 3300025911 | Ga0207654_10011544 | Ga0207654_100115447 | 158 |
| 258 | 3300025917 | Ga0207660_10000756 | Ga0207660_100007569 | 158 |
| 259 | 3300025918 | Ga0207662_10000095 | Ga0207662_1000009528 | 158 |
| 260 | 3300025921 | Ga0207652_10003750 | Ga0207652_100037502 | 158 |
| 261 | 3300025926 | Ga0207659_10102993 | Ga0207659_101029932 | 158 |
| 262 | 3300025927 | Ga0207687_10000432 | Ga0207687_100004327 | 158 |
| 263 | 3300025933 | Ga0207706_10217678 | Ga0207706_102176782 | 158 |
| 264 | 3300025934 | Ga0207686_10001368 | Ga0207686_100013687 | 158 |
| 265 | 3300025935 | Ga0207709_10001646 | Ga0207709_1000164610 | 158 |
| 266 | 3300025936 | Ga0207670_10002845 | Ga0207670_100028459 | 158 |
| 267 | 3300025938 | Ga0207704_10000281 | Ga0207704_100002814 | 158 |
| 268 | 3300025939 | Ga0207665_10249358 | Ga0207665_102493582 | 158 |
| 269 | 3300025942 | Ga0207689_10000977 | Ga0207689_100009779 | 158 |
| 270 | 3300025949 | Ga0207667_10005008 | Ga0207667_100050083 | 158 |
| 271 | 3300025961 | Ga0207712_10002627 | Ga0207712_100026279 | 158 |
| 272 | 3300025981 | Ga0207640_10004566 | Ga0207640_100045663 | 158 |
| 273 | 3300026023 | Ga0207677_10000832 | Ga0207677_1000083218 | 158 |
| 274 | 3300026035 | Ga0207703_10005254 | Ga0207703_100052548 | 158 |
| 275 | 3300026075 | Ga0207708_10000551 | Ga0207708_100005519 | 158 |
| 276 | 3300026078 | Ga0207702_10013754 | Ga0207702_100137547 | 158 |
| 277 | 3300026088 | Ga0207641_10060269 | Ga0207641_100602695 | 158 |
| 278 | 3300026089 | Ga0207648_10000513 | Ga0207648_1000051324 | 158 |
| 279 | 3300026118 | Ga0207675_100001063 | Ga0207675_1000010639 | 158 |
| 280 | 3300026142 | Ga0207698_10076668 | Ga0207698_100766682 | 158 |
| 281 | 3300027907 | Ga0207428_10003903 | Ga0207428_100039032 | 158 |
| 282 | 3300028380 | Ga0268265_10006650 | Ga0268265_100066503 | 158 |
| 283 | 3300028381 | Ga0268264_10000827 | Ga0268264_1000082724 | 158 |
| 284 | 3300034816 | Ga0373930_0004384 | Ga0373930_0004384_945_1421 | 158 |
| 285 | 3300034817 | Ga0373948_0002060 | Ga0373948_0002060_655_1131 | 158 |
| 286 | 3300034819 | Ga0373958_0006525 | Ga0373958_0006525_962_1438 | 158 |
| 287 | 3300035084 | Ga0373928_0003711 | Ga0373928_0003711_32_508 | 158 |
| 288 | 3300035085 | Ga0373929_0036497 | Ga0373929_0036497_473_949 | 158 |
| 289 | 3300035088 | Ga0373940_0015511 | Ga0373940_0015511_1158_1634 | 158 |
| 290 | 3300035112 | Ga0373932_0238592 | Ga0373932_0238592_16_492 | 158 |
| 291 | 3300035114 | Ga0373939_0001211 | Ga0373939_0001211_3875_4351 | 158 |
| 292 | 3300035691 | Ga0373931_0004111 | Ga0373931_0004111_5831_6307 | 158 |
| 293 | 3300035691 | Ga0373931_0004119 | Ga0373931_0004119_2767_3243 | 158 |
| 294 | 3300035691 | Ga0373931_0062853 | Ga0373931_0062853_1252_1728 | 158 |
| 295 | 3300042876 | Ga0451577_0035929 | Ga0451577_0035929_199_675 | 158 |
| 296 | 3300045051 | Ga0451576_0003270 | Ga0451576_0003270_19222_19698 | 158 |
| 297 | 3300045051 | Ga0451576_0230453 | Ga0451576_0230453_342_818 | 158 |
| 298 | 3300045051 | Ga0451576_0389174 | Ga0451576_0389174_282_758 | 158 |
| 299 | 3300048905 | Ga0496102_1108516 | Ga0496102_1108516_101_577 | 158 |
| 300 | 3300049588 | Ga0501072_0172512 | Ga0501072_0172512_21_509 | 158 |
| 301 | 3300049824 | Ga0501045_0729385 | Ga0501045_0729385_66_542 | 158 |
| 302 | 3300050507 | nmdc:mga05p37_1935_c1 | nmdc:mga05p37_1935_c1_3026_3502 | 158 |
| 303 | 3300050508 | nmdc:mga09592_89148_c1 | nmdc:mga09592_89148_c1_2006_2482 | 158 |
| 304 | 3300050511 | nmdc:mga08y16_299548_c1 | nmdc:mga08y16_299548_c1_1127_1603 | 158 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8sm3-assembly1.cif.gz_B | structure of bacillus cereus vd045 gabija gaja-gajb complex | 0.569 | 75 | 132 |
| 4fxx-assembly6.cif.gz_D-2 | structure of sf1 coiled-coil domain | 0.5493 | 2 | 77 |
| 6w1s-assembly1.cif.gz_V | atomic model of the mammalian mediator complex | 0.5315 | 6 | 95 |
| 6ww7-assembly1.cif.gz_E | structure of the human er membrane protein complex in a lipid nanodisc | 0.5219 | 6 | 82 |
| 7nsu-assembly1.cif.gz_D | colicine9 intact translocation complex | 0.5099 | 6 | 131 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1t5eD03 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin | 0.7075 | 6 | 63 | 1.10.287.470 |
| 1t5eD03 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin | 0.6398 | 6 | 63 | 1.10.287.470 |
| af_O06612_48_145_1.10.287.850 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;HP0062-like domain | 0.622 | 3 | 68 | 1.10.287.850 |
| af_F4KFV7_645_750_1.20.58.1080 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; | 0.533 | 1 | 77 | 1.20.58.1080 |
| af_Q9NRG4_292_365_1.25.40.970 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat; | 0.5073 | 79 | 147 | 1.25.40.970 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4V2E5T2-F1-model_v4 | DUF1468 domain-containing protein | 0.9305 | 1 | 158 |
GO:0016020
|
| AF-A0A7C2R2I5-F1-model_v4 | DUF1468 domain-containing protein | 0.9256 | 1 | 158 |
GO:0016020
|
| AF-A0A4V2E5T2-F1-model_v4 | DUF1468 domain-containing protein | 0.925 | 1 | 158 |
GO:0016020
|
| AF-A0A537C6A6-F1-model_v4 | Tripartite tricarboxylate transporter TctB family protein | 0.9231 | 1 | 158 |
GO:0016020
|
| AF-A0A7C2R2I5-F1-model_v4 | DUF1468 domain-containing protein | 0.92 | 1 | 158 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar