F397426

General Info

Members Datasets Scaffolds Average Seq Length
304 173 297 156

Family's Representative Sequence

Representative Sequence 3300005341|Ga0070691_10005141|Ga0070691_100051413
Length 162
Sequence MPGRDGIAGLVCLAGSLGLLALTRGLPHPALVPIGPGFYPRIVLGVTAALSVVLVLADLLERRRARAGAAATVEAPLPLIRNPRLVGATFAIFAGYVTLMPLVGFRLATALFVLALQAALEPEPRRHWLRIVLVAVFTAWLTHLAFEGYLSVLLPRGRWTGF

Samples

Sample ID Description Type Environment
1 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
2 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
3 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
4 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
118 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
119 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
120 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
121 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
122 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
123 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
124 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
125 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
126 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
127 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
128 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
129 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
130 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
131 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
132 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
133 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
136 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
137 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
138 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
139 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
140 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
141 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
142 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
143 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
144 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
145 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
146 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
147 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
148 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
149 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
152 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
153 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
159 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
160 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
161 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
162 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
163 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
164 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
165 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
166 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
167 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
168 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
169 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
170 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
171 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
172 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
173 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.7
Metatranscriptomes 0
Isolates 2.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 2.3
Rhizoplane 0.66
Rhizosphere 97.04
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10179081 3300005295 Bacteria 1430
2 Ga0070690_100000131 3300005330 Bacteria 38893
3 Ga0068869_100000392 3300005334 Bacteria 23853
4 Ga0070680_100002214 3300005336 Bacteria 14332
5 Ga0070680_100628608 3300005336 Unclassified 922
6 Ga0070682_100003841 3300005337 Bacteria 8339
7 Ga0068868_100000656 3300005338 Bacteria 23322
8 Ga0070689_100001412 3300005340 Bacteria 15327
9 Ga0070691_10005141 3300005341 Bacteria 5949
10 Ga0070691_10008455 3300005341 Bacteria 4710
11 Ga0070687_100000175 3300005343 Bacteria 22196
12 Ga0070687_100615385 3300005343 Unclassified 748
13 Ga0070692_10000992 3300005345 Bacteria 9719
14 Ga0070692_10001310 3300005345 Bacteria 8947
15 Ga0070692_10429135 3300005345 Bacteria 841
16 Ga0070669_101587165 3300005353 Unclassified 569
17 Ga0070675_100110676 3300005354 Bacteria 2323
18 Ga0070703_10003837 3300005406 Bacteria 4254
19 Ga0070703_10011205 3300005406 Bacteria 2532
20 Ga0070703_10346844 3300005406 Unclassified 632
21 Ga0070701_10000060 3300005438 Bacteria 29083
22 Ga0070701_10004359 3300005438 Bacteria 5720
23 Ga0070705_100000431 3300005440 Bacteria 24090
24 Ga0070705_100003244 3300005440 Bacteria 7994
25 Ga0070705_100192389 3300005440 Bacteria 1392
26 Ga0070705_100895568 3300005440 Unclassified 713
27 Ga0070700_100000587 3300005441 Bacteria 18243
28 Ga0070700_100030932 3300005441 Bacteria 3203
29 Ga0070700_100319804 3300005441 Bacteria 1140
30 Ga0070694_100000136 3300005444 Bacteria 36787
31 Ga0070694_100013830 3300005444 Bacteria 5046
32 Ga0070694_100172458 3300005444 Bacteria 1595
33 Ga0070662_100315209 3300005457 Bacteria 1274
34 Ga0070681_10002380 3300005458 Bacteria 17183
35 Ga0068867_100002957 3300005459 Bacteria 11965
36 Ga0068867_100182039 3300005459 Bacteria 1671
37 Ga0068867_101859075 3300005459 Unclassified 567
38 Ga0070706_101652813 3300005467 Bacteria 584
39 Ga0070707_100058426 3300005468 Bacteria 3699
40 Ga0070707_100592536 3300005468 Bacteria 1071
41 Ga0070707_100930392 3300005468 Unclassified 834
42 Ga0070698_100042676 3300005471 Bacteria 4652
43 Ga0070698_100083093 3300005471 Bacteria 3193
44 Ga0070698_100084320 3300005471 Bacteria 3166
45 Ga0070698_100419315 3300005471 Bacteria 1273
46 Ga0070699_100015436 3300005518 Bacteria 6563
47 Ga0070699_100423528 3300005518 Bacteria 1205
48 Ga0070679_100032345 3300005530 Bacteria 5174
49 Ga0070679_100205311 3300005530 Bacteria 1935
50 Ga0070697_100163590 3300005536 Bacteria 1881
51 Ga0070697_100979874 3300005536 Bacteria 751
52 Ga0070686_100000285 3300005544 Bacteria 34108
53 Ga0070686_100268207 3300005544 Bacteria 1254
54 Ga0070695_100001799 3300005545 Bacteria 12087
55 Ga0070695_100022709 3300005545 Bacteria 3850
56 Ga0070695_100031072 3300005545 Bacteria 3328
57 Ga0070695_100520367 3300005545 Bacteria 923
58 Ga0070695_101069140 3300005545 Unclassified 659
59 Ga0070696_100002841 3300005546 Bacteria 11515
60 Ga0070696_100030181 3300005546 Bacteria 3710
61 Ga0070696_100032776 3300005546 Bacteria 3566
62 Ga0070696_100237898 3300005546 Bacteria 1372
63 Ga0070696_100969860 3300005546 Bacteria 709
64 Ga0070696_101036416 3300005546 Unclassified 687
65 Ga0070693_100000278 3300005547 Bacteria 24050
66 Ga0070693_100129392 3300005547 Bacteria 1576
67 Ga0070693_100798721 3300005547 Bacteria 699
68 Ga0070704_100000103 3300005549 Bacteria 29844
69 Ga0070704_100045919 3300005549 Bacteria 3042
70 Ga0070704_100066657 3300005549 Bacteria 2597
71 Ga0070704_100086593 3300005549 Bacteria 2322
72 Ga0070704_100107576 3300005549 Bacteria 2115
73 Ga0070704_100427301 3300005549 Bacteria 1136
74 Ga0070704_100714389 3300005549 Bacteria 890
75 Ga0068855_100001779 3300005563 Bacteria 26944
76 Ga0068857_100240574 3300005577 Bacteria 1657
77 Ga0068854_100009113 3300005578 Bacteria 6398
78 Ga0068854_101343770 3300005578 Bacteria 644
79 Ga0068854_101800125 3300005578 Unclassified 561
80 Ga0068856_100099318 3300005614 Bacteria 2901
81 Ga0070702_100000039 3300005615 Bacteria 35203
82 Ga0068852_100571892 3300005616 Bacteria 1132
83 Ga0068859_100000420 3300005617 Bacteria 42401
84 Ga0068859_100136430 3300005617 Bacteria 2526
85 Ga0068866_10000153 3300005718 Bacteria 31527
86 Ga0068866_10200452 3300005718 Bacteria 1192
87 Ga0068861_100000399 3300005719 Bacteria 25138
88 Ga0068870_10017240 3300005840 Bacteria 3467
89 Ga0068870_10020769 3300005840 Bacteria 3203
90 Ga0068863_100074364 3300005841 Bacteria 3214
91 Ga0068858_100004592 3300005842 Bacteria 13518
92 Ga0068860_100002022 3300005843 Bacteria 21401
93 Ga0068862_100004066 3300005844 Bacteria 12403
94 Ga0068862_100513479 3300005844 Bacteria 1139
95 Ga0068862_101789230 3300005844 Unclassified 623
96 Ga0081455_10031088 3300005937 Bacteria 4836
97 Ga0081540_1021285 3300005983 Bacteria 3869
98 Ga0070716_100149050 3300006173 Bacteria 1502
99 Ga0097621_100000754 3300006237 Bacteria 22721
100 Ga0068871_100001380 3300006358 Bacteria 16255
101 Ga0075428_100004852 3300006844 Bacteria 14923
102 Ga0075428_101639869 3300006844 Unclassified 672
103 Ga0075430_100001797 3300006846 Bacteria 17542
104 Ga0075430_100053008 3300006846 Bacteria 3416
105 Ga0075430_100389387 3300006846 Unclassified 1150
106 Ga0075430_100576219 3300006846 Bacteria 928
107 Ga0075430_100795285 3300006846 Bacteria 779
108 Ga0075431_100000072 3300006847 Bacteria 58754
109 Ga0075431_100286697 3300006847 Bacteria 1666
110 Ga0075431_100504396 3300006847 Bacteria 1201
111 Ga0075431_101419566 3300006847 Bacteria 653
112 Ga0075433_10287217 3300006852 Bacteria 1457
113 Ga0075433_10678693 3300006852 Bacteria 903
114 Ga0075429_100053218 3300006880 Bacteria 3522
115 Ga0075429_100377494 3300006880 Bacteria 1241
116 Ga0075429_101206071 3300006880 Bacteria 660
117 Ga0068865_100003371 3300006881 Bacteria 9571
118 Ga0075436_100926981 3300006914 Bacteria 652
119 Ga0097620_100000420 3300006931 Bacteria 42401
120 Ga0097620_100136440 3300006931 Bacteria 2526
121 Ga0075435_100629331 3300007076 Unclassified 931
122 Ga0111539_10025289 3300009094 Bacteria 7278
123 Ga0111539_10218769 3300009094 Bacteria 2218
124 Ga0105245_10000533 3300009098 Bacteria 34922
125 Ga0105245_10027951 3300009098 Bacteria 4971
126 Ga0105245_10273113 3300009098 Bacteria 1649
127 Ga0114129_10002987 3300009147 Bacteria 23703
128 Ga0114129_12821884 3300009147 Bacteria 577
129 Ga0105243_10000495 3300009148 Bacteria 40193
130 Ga0105243_10004756 3300009148 Bacteria 10672
131 Ga0105243_10099244 3300009148 Bacteria 2413
132 Ga0105241_10009614 3300009174 Bacteria 7108
133 Ga0105241_10096209 3300009174 Bacteria 2345
134 Ga0105242_10000248 3300009176 Bacteria 42523
135 Ga0105242_10003680 3300009176 Bacteria 11930
136 Ga0105242_10050091 3300009176 Bacteria 3400
137 Ga0105249_10010445 3300009553 Bacteria 8157
138 Ga0105249_10036559 3300009553 Bacteria 4455
139 Ga0105239_10081132 3300010375 Bacteria 3570
140 Ga0105246_10053457 3300011119 Bacteria 2779
141 Ga0105246_10285906 3300011119 Bacteria 1325
142 Ga0157322_1018748 3300012490 Unclassified 647
143 Ga0157378_10000387 3300013297 Bacteria 43542
144 Ga0163162_10359417 3300013306 Bacteria 1589
145 Ga0157380_11105231 3300014326 Bacteria 832
146 Ga0157377_10746998 3300014745 Unclassified 715
147 Ga0207653_10002620 3300025885 Bacteria 5713
148 Ga0207653_10003570 3300025885 Bacteria 4899
149 Ga0207642_10000130 3300025899 Bacteria 20678
150 Ga0207688_10041973 3300025901 Bacteria 2546
151 Ga0207643_10070334 3300025908 Bacteria 2013
152 Ga0207684_11333885 3300025910 Bacteria 590
153 Ga0207654_10011544 3300025911 Bacteria 4507
154 Ga0207654_10023949 3300025911 Bacteria 3276
155 Ga0207707_10022504 3300025912 Bacteria 5509
156 Ga0207660_10000756 3300025917 Bacteria 21503
157 Ga0207660_10039006 3300025917 Bacteria 3318
158 Ga0207660_10542125 3300025917 Bacteria 946
159 Ga0207662_10000095 3300025918 Bacteria 41923
160 Ga0207652_10003750 3300025921 Bacteria 12466
161 Ga0207646_10049826 3300025922 Bacteria 3750
162 Ga0207646_10234512 3300025922 Bacteria 1658
163 Ga0207681_11368863 3300025923 Unclassified 594
164 Ga0207659_10102993 3300025926 Bacteria 2156
165 Ga0207687_10000432 3300025927 Bacteria 28412
166 Ga0207706_10217678 3300025933 Bacteria 1673
167 Ga0207686_10001368 3300025934 Bacteria 13851
168 Ga0207686_10003894 3300025934 Bacteria 8003
169 Ga0207686_10247648 3300025934 Bacteria 1300
170 Ga0207709_10001646 3300025935 Bacteria 15123
171 Ga0207709_10016902 3300025935 Bacteria 4065
172 Ga0207670_10002845 3300025936 Bacteria 9135
173 Ga0207670_10031378 3300025936 Bacteria 3405
174 Ga0207670_10453722 3300025936 Bacteria 1034
175 Ga0207704_10000281 3300025938 Bacteria 24286
176 Ga0207665_10249358 3300025939 Bacteria 1311
177 Ga0207689_10000977 3300025942 Bacteria 27402
178 Ga0207689_10028165 3300025942 Bacteria 4698
179 Ga0207667_10005008 3300025949 Bacteria 16189
180 Ga0207712_10002627 3300025961 Bacteria 11512
181 Ga0207712_10073432 3300025961 Bacteria 2467
182 Ga0207640_10004566 3300025981 Bacteria 7511
183 Ga0207640_11258376 3300025981 Bacteria 659
184 Ga0207677_10000832 3300026023 Bacteria 17660
185 Ga0207703_10005254 3300026035 Bacteria 10444
186 Ga0207708_10000551 3300026075 Bacteria 28958
187 Ga0207708_10451122 3300026075 Bacteria 1071
188 Ga0207702_10013754 3300026078 Bacteria 6721
189 Ga0207641_10060269 3300026088 Bacteria 3235
190 Ga0207648_10000513 3300026089 Bacteria 43298
191 Ga0207648_10282458 3300026089 Bacteria 1485
192 Ga0207648_10915202 3300026089 Bacteria 820
193 Ga0207674_10053886 3300026116 Bacteria 4097
194 Ga0207674_10264213 3300026116 Bacteria 1668
195 Ga0207675_100001063 3300026118 Bacteria 27254
196 Ga0207698_10076668 3300026142 Bacteria 2677
197 Ga0209999_1004765 3300027543 Bacteria 2438
198 Ga0209966_1032319 3300027695 Bacteria 1065
199 Ga0207428_10003903 3300027907 Bacteria 14300
200 Ga0207428_10175115 3300027907 Bacteria 1623
201 Ga0268265_10006650 3300028380 Bacteria 7822
202 Ga0268264_10000827 3300028381 Bacteria 33217
203 Ga0268264_10041894 3300028381 Bacteria 3788
204 Ga0307408_100010548 3300031548 Bacteria 6094
205 Ga0307408_100592242 3300031548 Bacteria 984
206 Ga0307408_100954849 3300031548 Bacteria 788
207 Ga0307405_10032172 3300031731 Bacteria 3098
208 Ga0307405_10218707 3300031731 Bacteria 1396
209 Ga0307406_10484875 3300031901 Bacteria 999
210 Ga0307412_11959989 3300031911 Bacteria 541
211 Ga0307409_102548988 3300031995 Bacteria 540
212 Ga0307416_100184642 3300032002 Bacteria 1959
213 Ga0307416_100196212 3300032002 Bacteria 1910
214 Ga0307416_101434134 3300032002 Bacteria 796
215 Ga0307416_101539114 3300032002 Bacteria 771
216 Ga0307411_10111627 3300032005 Bacteria 1958
217 Ga0307411_10943120 3300032005 Bacteria 769
218 Ga0307415_100813970 3300032126 Bacteria 854
219 Ga0373930_0004384 3300034816 Bacteria 2294
220 Ga0373948_0002060 3300034817 Bacteria 2912
221 Ga0373958_0006525 3300034819 Bacteria 1822
222 Ga0373928_0003711 3300035084 Bacteria 2910
223 Ga0373929_0036497 3300035085 Bacteria 1074
224 Ga0373929_0038361 3300035085 Bacteria 1054
225 Ga0373940_0015511 3300035088 Bacteria 1875
226 Ga0373932_0238592 3300035112 Bacteria 659
227 Ga0373939_0001211 3300035114 Bacteria 6303
228 Ga0373939_0060329 3300035114 Bacteria 1205
229 Ga0373942_0081604 3300035207 Bacteria 961
230 Ga0373931_0004111 3300035691 Bacteria 6604
231 Ga0373931_0004119 3300035691 Bacteria 6594
232 Ga0373931_0004688 3300035691 Bacteria 6259
233 Ga0373931_0062853 3300035691 Bacteria 2005
234 Ga0373931_0210443 3300035691 Bacteria 1166
235 Ga0395905_0405026 3300037471 Bacteria 1259
236 Ga0439439_0181465 3300041406 Bacteria 606
237 Ga0451807_1436759 3300041486 Bacteria 2193
238 Ga0439441_000352 3300042001 Bacteria 4718
239 Ga0439441_006456 3300042001 Bacteria 1862
240 Ga0439441_153211 3300042001 Unclassified 544
241 Ga0439455_0013914 3300042012 Bacteria 1831
242 Ga0439462_0033213 3300042015 Bacteria 1368
243 Ga0450913_007928 3300042117 Unclassified 808
244 Ga0439446_0005214 3300042156 Bacteria 3334
245 Ga0439434_0000265 3300042435 Bacteria 14847
246 Ga0439435_0000039 3300042436 Bacteria 14411
247 Ga0439435_0012348 3300042436 Bacteria 2068
248 Ga0439444_0093729 3300042437 Unclassified 673
249 Ga0439464_0032752 3300042439 Bacteria 1461
250 Ga0439464_0057476 3300042439 Bacteria 1134
251 Ga0451577_0035929 3300042876 Bacteria 4463
252 Ga0451577_0240335 3300042876 Bacteria 1639
253 Ga0453683_1215490 3300044673 Unclassified 505
254 Ga0466963_0439948 3300044694 Bacteria 920
255 Ga0451576_0003270 3300045051 Bacteria 22501
256 Ga0451576_0230453 3300045051 Bacteria 1934
257 Ga0451576_0389174 3300045051 Bacteria 1461
258 Ga0451576_0399861 3300045051 Bacteria 1440
259 Ga0466967_0006233 3300045976 Bacteria 8409
260 Ga0496102_1108516 3300048905 Bacteria 711
261 Ga0501298_084860 3300049521 Bacteria 702
262 Ga0501031_0297196 3300049568 Bacteria 1047
263 Ga0501033_0292328 3300049570 Bacteria 1149
264 Ga0501039_0469481 3300049575 Unclassified 988
265 Ga0501039_0961818 3300049575 Bacteria 664
266 Ga0501040_0102228 3300049576 Bacteria 2000
267 Ga0501040_0323429 3300049576 Bacteria 1103
268 Ga0501040_0534779 3300049576 Unclassified 846
269 Ga0501040_0782651 3300049576 Unclassified 690
270 Ga0501042_0284289 3300049578 Bacteria 1195
271 Ga0501067_0284161 3300049583 Bacteria 921
272 Ga0501069_0188478 3300049585 Bacteria 1193
273 Ga0501071_0577271 3300049587 Bacteria 864
274 Ga0501071_1011065 3300049587 Bacteria 642
275 Ga0501072_0172512 3300049588 Bacteria 1726
276 Ga0501072_0361126 3300049588 Unclassified 1153
277 Ga0501072_0363447 3300049588 Bacteria 1149
278 Ga0501076_0245341 3300049592 Bacteria 1465
279 Ga0501076_0853537 3300049592 Bacteria 751
280 Ga0501076_1229021 3300049592 Bacteria 616
281 Ga0501077_0324185 3300049593 Bacteria 982
282 Ga0501045_0036921 3300049824 Bacteria 3550
283 Ga0501045_0729385 3300049824 Bacteria 731
284 nmdc:mga05p37_1874284_c1 3300050507 Bacteria 574
285 nmdc:mga05p37_1935_c1 3300050507 Bacteria 24113
286 nmdc:mga09592_859475_c1 3300050508 Bacteria 765
287 nmdc:mga09592_89148_c1 3300050508 Bacteria 2635
288 nmdc:mga0qj67_126303_c1 3300050509 Bacteria 2070
289 nmdc:mga0qj67_27289_c1 3300050509 Bacteria 4424
290 nmdc:mga0qj67_61795_c1 3300050509 Bacteria 2975
291 nmdc:mga06r32_113663_c1 3300050510 Bacteria 2665
292 nmdc:mga06r32_79664_c1 3300050510 Bacteria 3186
293 nmdc:mga06r32_987_c1 3300050510 Bacteria 25489
294 nmdc:mga08y16_122804_c1 3300050511 Bacteria 2702
295 nmdc:mga08y16_299548_c1 3300050511 Bacteria 1658
296 nmdc:mga08y16_60877_c1 3300050511 Bacteria 3942
297 Ga0501082_1460837 3300060353 Unclassified 597

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031731 Ga0307405_10032172 Ga0307405_100321723 126
2 3300031911 Ga0307412_11959989 Ga0307412_119599892 126
3 3300031995 Ga0307409_102548988 Ga0307409_1025489882 126
4 3300032002 Ga0307416_100184642 Ga0307416_1001846422 126
5 3300049587 Ga0501071_1011065 Ga0501071_1011065_11_406 131
6 3300009098 Ga0105245_10273113 Ga0105245_102731132 136
7 3300041406 Ga0439439_0181465 Ga0439439_0181465_67_549 136
8 3300049583 Ga0501067_0284161 Ga0501067_0284161_14_475 140
9 3300049585 Ga0501069_0188478 Ga0501069_0188478_275_736 140
10 3300005353 Ga0070669_101587165 Ga0070669_1015871651 141
11 3300005459 Ga0068867_101859075 Ga0068867_1018590751 141
12 3300005544 Ga0070686_100268207 Ga0070686_1002682072 141
13 3300005578 Ga0068854_101800125 Ga0068854_1018001251 141
14 3300005844 Ga0068862_101789230 Ga0068862_1017892301 141
15 3300025923 Ga0207681_11368863 Ga0207681_113688632 141
16 3300025981 Ga0207640_11258376 Ga0207640_112583762 141
17 3300026089 Ga0207648_10915202 Ga0207648_109152021 141
18 3300035085 Ga0373929_0038361 Ga0373929_0038361_19_480 141
19 3300035114 Ga0373939_0060329 Ga0373939_0060329_208_669 141
20 3300035207 Ga0373942_0081604 Ga0373942_0081604_318_779 141
21 3300035691 Ga0373931_0004688 Ga0373931_0004688_3992_4453 141
22 3300005546 Ga0070696_100032776 Ga0070696_1000327764 144
23 3300042876 Ga0451577_0240335 Ga0451577_0240335_812_1291 151
24 3300005546 Ga0070696_100969860 Ga0070696_1009698601 152
25 3300005578 Ga0068854_101343770 Ga0068854_1013437702 152
26 3300025917 Ga0207660_10542125 Ga0207660_105421252 152
27 3300032005 Ga0307411_10111627 Ga0307411_101116272 152
28 3300041486 Ga0451807_1436759 Ga0451807_1436759_1139_1597 152
29 3300042012 Ga0439455_0013914 Ga0439455_0013914_117_575 152
30 3300042439 Ga0439464_0057476 Ga0439464_0057476_659_1117 152
31 3300049576 Ga0501040_0534779 Ga0501040_0534779_13_471 152
32 3300005458 Ga0070681_10002380 Ga0070681_1000238012 153
33 3300005471 Ga0070698_100419315 Ga0070698_1004193152 153
34 3300005518 Ga0070699_100423528 Ga0070699_1004235281 153
35 3300005530 Ga0070679_100032345 Ga0070679_1000323456 153
36 3300025912 Ga0207707_10022504 Ga0207707_100225045 153
37 3300025936 Ga0207670_10453722 Ga0207670_104537222 153
38 3300031548 Ga0307408_100954849 Ga0307408_1009548492 153
39 3300049521 Ga0501298_084860 Ga0501298_084860_190_651 153
40 3300049570 Ga0501033_0292328 Ga0501033_0292328_82_543 153
41 3300049576 Ga0501040_0102228 Ga0501040_0102228_678_1139 153
42 3300049587 Ga0501071_0577271 Ga0501071_0577271_26_487 153
43 3300049588 Ga0501072_0363447 Ga0501072_0363447_140_601 153
44 3300049593 Ga0501077_0324185 Ga0501077_0324185_189_650 153
45 iso_pu_bacteria 2513237101 2513696733 153
46 iso_pu_bacteria 2721755755 2723846574 153
47 iso_pu_bacteria 2874604998 2874605601 153
48 iso_pu_bacteria 2922386360 2922391334 153
49 iso_pu_bacteria 8006964411 8006969700 153
50 iso_pu_bacteria 8006994254 8006995613 153
51 iso_pu_bacteria 8056681323 8056684992 153
52 3300005336 Ga0070680_100628608 Ga0070680_1006286082 154
53 3300005440 Ga0070705_100895568 Ga0070705_1008955681 154
54 3300005441 Ga0070700_100319804 Ga0070700_1003198042 154
55 3300005444 Ga0070694_100172458 Ga0070694_1001724582 154
56 3300005471 Ga0070698_100083093 Ga0070698_1000830933 154
57 3300005545 Ga0070695_100520367 Ga0070695_1005203672 154
58 3300005546 Ga0070696_100237898 Ga0070696_1002378982 154
59 3300005549 Ga0070704_100086593 Ga0070704_1000865932 154
60 3300005549 Ga0070704_100107576 Ga0070704_1001075762 154
61 3300005549 Ga0070704_100427301 Ga0070704_1004273012 154
62 3300005549 Ga0070704_100714389 Ga0070704_1007143891 154
63 3300006846 Ga0075430_100053008 Ga0075430_1000530084 154
64 3300006846 Ga0075430_100576219 Ga0075430_1005762192 154
65 3300006846 Ga0075430_100795285 Ga0075430_1007952852 154
66 3300006847 Ga0075431_100504396 Ga0075431_1005043962 154
67 3300006847 Ga0075431_101419566 Ga0075431_1014195661 154
68 3300006852 Ga0075433_10287217 Ga0075433_102872172 154
69 3300006880 Ga0075429_101206071 Ga0075429_1012060711 154
70 3300006914 Ga0075436_100926981 Ga0075436_1009269812 154
71 3300009148 Ga0105243_10099244 Ga0105243_100992442 154
72 3300014326 Ga0157380_11105231 Ga0157380_111052311 154
73 3300027543 Ga0209999_1004765 Ga0209999_10047652 154
74 3300027695 Ga0209966_1032319 Ga0209966_10323192 154
75 3300031548 Ga0307408_100010548 Ga0307408_1000105482 154
76 3300032002 Ga0307416_101434134 Ga0307416_1014341342 154
77 3300032002 Ga0307416_101539114 Ga0307416_1015391142 154
78 3300032005 Ga0307411_10943120 Ga0307411_109431201 154
79 3300032126 Ga0307415_100813970 Ga0307415_1008139702 154
80 3300042001 Ga0439441_006456 Ga0439441_006456_307_771 154
81 3300044694 Ga0466963_0439948 Ga0466963_0439948_208_693 154
82 3300045976 Ga0466967_0006233 Ga0466967_0006233_1798_2283 154
83 3300049592 Ga0501076_0853537 Ga0501076_0853537_148_612 154
84 3300050508 nmdc:mga09592_859475_c1 nmdc:mga09592_859475_c1_170_640 154
85 3300050509 nmdc:mga0qj67_27289_c1 nmdc:mga0qj67_27289_c1_2654_3118 154
86 3300050510 nmdc:mga06r32_113663_c1 nmdc:mga06r32_113663_c1_570_1034 154
87 3300005341 Ga0070691_10005141 Ga0070691_100051413 155
88 3300005343 Ga0070687_100615385 Ga0070687_1006153851 155
89 3300005345 Ga0070692_10000992 Ga0070692_1000099211 155
90 3300005345 Ga0070692_10429135 Ga0070692_104291351 155
91 3300005406 Ga0070703_10011205 Ga0070703_100112052 155
92 3300005406 Ga0070703_10346844 Ga0070703_103468441 155
93 3300005438 Ga0070701_10004359 Ga0070701_100043594 155
94 3300005440 Ga0070705_100003244 Ga0070705_1000032443 155
95 3300005441 Ga0070700_100030932 Ga0070700_1000309322 155
96 3300005444 Ga0070694_100013830 Ga0070694_1000138302 155
97 3300005459 Ga0068867_100182039 Ga0068867_1001820392 155
98 3300005467 Ga0070706_101652813 Ga0070706_1016528131 155
99 3300005468 Ga0070707_100058426 Ga0070707_1000584262 155
100 3300005468 Ga0070707_100592536 Ga0070707_1005925361 155
101 3300005468 Ga0070707_100930392 Ga0070707_1009303921 155
102 3300005471 Ga0070698_100042676 Ga0070698_1000426763 155
103 3300005471 Ga0070698_100084320 Ga0070698_1000843203 155
104 3300005518 Ga0070699_100015436 Ga0070699_1000154363 155
105 3300005536 Ga0070697_100163590 Ga0070697_1001635902 155
106 3300005545 Ga0070695_100022709 Ga0070695_1000227092 155
107 3300005545 Ga0070695_100031072 Ga0070695_1000310722 155
108 3300005546 Ga0070696_100030181 Ga0070696_1000301813 155
109 3300005546 Ga0070696_101036416 Ga0070696_1010364162 155
110 3300005547 Ga0070693_100129392 Ga0070693_1001293922 155
111 3300005547 Ga0070693_100798721 Ga0070693_1007987211 155
112 3300005549 Ga0070704_100045919 Ga0070704_1000459192 155
113 3300005549 Ga0070704_100066657 Ga0070704_1000666572 155
114 3300005577 Ga0068857_100240574 Ga0068857_1002405742 155
115 3300005617 Ga0068859_100136430 Ga0068859_1001364302 155
116 3300005718 Ga0068866_10200452 Ga0068866_102004522 155
117 3300005840 Ga0068870_10017240 Ga0068870_100172403 155
118 3300005844 Ga0068862_100513479 Ga0068862_1005134792 155
119 3300006844 Ga0075428_101639869 Ga0075428_1016398692 155
120 3300006846 Ga0075430_100001797 Ga0075430_1000017978 155
121 3300006846 Ga0075430_100389387 Ga0075430_1003893872 155
122 3300006847 Ga0075431_100000072 Ga0075431_10000007250 155
123 3300006847 Ga0075431_100286697 Ga0075431_1002866972 155
124 3300006880 Ga0075429_100377494 Ga0075429_1003774942 155
125 3300006931 Ga0097620_100136440 Ga0097620_1001364402 155
126 3300007076 Ga0075435_100629331 Ga0075435_1006293312 155
127 3300009098 Ga0105245_10027951 Ga0105245_100279514 155
128 3300009148 Ga0105243_10004756 Ga0105243_100047563 155
129 3300009174 Ga0105241_10096209 Ga0105241_100962092 155
130 3300009176 Ga0105242_10003680 Ga0105242_100036806 155
131 3300009176 Ga0105242_10050091 Ga0105242_100500912 155
132 3300009553 Ga0105249_10036559 Ga0105249_100365592 155
133 3300011119 Ga0105246_10053457 Ga0105246_100534572 155
134 3300025885 Ga0207653_10003570 Ga0207653_100035703 155
135 3300025908 Ga0207643_10070334 Ga0207643_100703342 155
136 3300025910 Ga0207684_11333885 Ga0207684_113338851 155
137 3300025911 Ga0207654_10023949 Ga0207654_100239493 155
138 3300025917 Ga0207660_10039006 Ga0207660_100390062 155
139 3300025922 Ga0207646_10049826 Ga0207646_100498263 155
140 3300025922 Ga0207646_10234512 Ga0207646_102345122 155
141 3300025934 Ga0207686_10003894 Ga0207686_100038947 155
142 3300025934 Ga0207686_10247648 Ga0207686_102476482 155
143 3300025935 Ga0207709_10016902 Ga0207709_100169023 155
144 3300025936 Ga0207670_10031378 Ga0207670_100313782 155
145 3300025942 Ga0207689_10028165 Ga0207689_100281651 155
146 3300025961 Ga0207712_10073432 Ga0207712_100734321 155
147 3300026075 Ga0207708_10451122 Ga0207708_104511222 155
148 3300026089 Ga0207648_10282458 Ga0207648_102824583 155
149 3300026116 Ga0207674_10053886 Ga0207674_100538861 155
150 3300026116 Ga0207674_10264213 Ga0207674_102642132 155
151 3300028381 Ga0268264_10041894 Ga0268264_100418942 155
152 3300031548 Ga0307408_100592242 Ga0307408_1005922422 155
153 3300031731 Ga0307405_10218707 Ga0307405_102187072 155
154 3300031901 Ga0307406_10484875 Ga0307406_104848752 155
155 3300032002 Ga0307416_100196212 Ga0307416_1001962122 155
156 3300035691 Ga0373931_0210443 Ga0373931_0210443_297_764 155
157 3300042001 Ga0439441_000352 Ga0439441_000352_3101_3589 155
158 3300042001 Ga0439441_153211 Ga0439441_153211_63_530 155
159 3300042015 Ga0439462_0033213 Ga0439462_0033213_250_717 155
160 3300042117 Ga0450913_007928 Ga0450913_007928_17_493 155
161 3300042156 Ga0439446_0005214 Ga0439446_0005214_466_933 155
162 3300042435 Ga0439434_0000265 Ga0439434_0000265_5173_5640 155
163 3300042436 Ga0439435_0000039 Ga0439435_0000039_13555_14022 155
164 3300042436 Ga0439435_0012348 Ga0439435_0012348_711_1178 155
165 3300042437 Ga0439444_0093729 Ga0439444_0093729_145_612 155
166 3300042439 Ga0439464_0032752 Ga0439464_0032752_352_828 155
167 3300045051 Ga0451576_0399861 Ga0451576_0399861_897_1370 155
168 3300049578 Ga0501042_0284289 Ga0501042_0284289_385_852 155
169 3300049592 Ga0501076_1229021 Ga0501076_1229021_20_487 155
170 3300050509 nmdc:mga0qj67_126303_c1 nmdc:mga0qj67_126303_c1_856_1341 155
171 3300050509 nmdc:mga0qj67_61795_c1 nmdc:mga0qj67_61795_c1_1595_2062 155
172 3300050510 nmdc:mga06r32_79664_c1 nmdc:mga06r32_79664_c1_293_760 155
173 3300050510 nmdc:mga06r32_987_c1 nmdc:mga06r32_987_c1_15506_15991 155
174 3300050511 nmdc:mga08y16_122804_c1 nmdc:mga08y16_122804_c1_71_538 155
175 3300005440 Ga0070705_100192389 Ga0070705_1001923892 156
176 3300005545 Ga0070695_101069140 Ga0070695_1010691401 156
177 3300009094 Ga0111539_10025289 Ga0111539_100252893 156
178 3300009147 Ga0114129_12821884 Ga0114129_128218842 156
179 3300027907 Ga0207428_10175115 Ga0207428_101751152 156
180 3300044673 Ga0453683_1215490 Ga0453683_1215490_12_482 156
181 3300049568 Ga0501031_0297196 Ga0501031_0297196_326_796 156
182 3300049575 Ga0501039_0469481 Ga0501039_0469481_134_604 156
183 3300049575 Ga0501039_0961818 Ga0501039_0961818_171_641 156
184 3300049576 Ga0501040_0323429 Ga0501040_0323429_287_757 156
185 3300049576 Ga0501040_0782651 Ga0501040_0782651_26_496 156
186 3300049588 Ga0501072_0361126 Ga0501072_0361126_333_803 156
187 3300049592 Ga0501076_0245341 Ga0501076_0245341_699_1169 156
188 3300049824 Ga0501045_0036921 Ga0501045_0036921_2047_2517 156
189 3300050507 nmdc:mga05p37_1874284_c1 nmdc:mga05p37_1874284_c1_28_498 156
190 3300050511 nmdc:mga08y16_60877_c1 nmdc:mga08y16_60877_c1_1980_2456 156
191 3300060353 Ga0501082_1460837 Ga0501082_1460837_72_542 156
192 3300005937 Ga0081455_10031088 Ga0081455_100310882 157
193 3300005983 Ga0081540_1021285 Ga0081540_10212853 157
194 3300037471 Ga0395905_0405026 Ga0395905_0405026_215_697 157
195 3300005295 Ga0065707_10179081 Ga0065707_101790812 158
196 3300005330 Ga0070690_100000131 Ga0070690_10000013134 158
197 3300005334 Ga0068869_100000392 Ga0068869_1000003926 158
198 3300005336 Ga0070680_100002214 Ga0070680_10000221419 158
199 3300005337 Ga0070682_100003841 Ga0070682_1000038419 158
200 3300005338 Ga0068868_100000656 Ga0068868_1000006566 158
201 3300005340 Ga0070689_100001412 Ga0070689_1000014123 158
202 3300005341 Ga0070691_10008455 Ga0070691_100084552 158
203 3300005343 Ga0070687_100000175 Ga0070687_10000017529 158
204 3300005345 Ga0070692_10001310 Ga0070692_100013104 158
205 3300005354 Ga0070675_100110676 Ga0070675_1001106762 158
206 3300005406 Ga0070703_10003837 Ga0070703_100038371 158
207 3300005438 Ga0070701_10000060 Ga0070701_100000609 158
208 3300005440 Ga0070705_100000431 Ga0070705_10000043119 158
209 3300005441 Ga0070700_100000587 Ga0070700_10000058726 158
210 3300005444 Ga0070694_100000136 Ga0070694_10000013611 158
211 3300005457 Ga0070662_100315209 Ga0070662_1003152092 158
212 3300005459 Ga0068867_100002957 Ga0068867_1000029573 158
213 3300005530 Ga0070679_100205311 Ga0070679_1002053112 158
214 3300005536 Ga0070697_100979874 Ga0070697_1009798742 158
215 3300005544 Ga0070686_100000285 Ga0070686_10000028516 158
216 3300005545 Ga0070695_100001799 Ga0070695_10000179911 158
217 3300005546 Ga0070696_100002841 Ga0070696_1000028415 158
218 3300005547 Ga0070693_100000278 Ga0070693_10000027828 158
219 3300005549 Ga0070704_100000103 Ga0070704_10000010327 158
220 3300005563 Ga0068855_100001779 Ga0068855_10000177921 158
221 3300005578 Ga0068854_100009113 Ga0068854_1000091133 158
222 3300005614 Ga0068856_100099318 Ga0068856_1000993182 158
223 3300005615 Ga0070702_100000039 Ga0070702_10000003927 158
224 3300005616 Ga0068852_100571892 Ga0068852_1005718922 158
225 3300005617 Ga0068859_100000420 Ga0068859_10000042022 158
226 3300005718 Ga0068866_10000153 Ga0068866_1000015322 158
227 3300005719 Ga0068861_100000399 Ga0068861_1000003997 158
228 3300005840 Ga0068870_10020769 Ga0068870_100207691 158
229 3300005841 Ga0068863_100074364 Ga0068863_1000743642 158
230 3300005842 Ga0068858_100004592 Ga0068858_1000045927 158
231 3300005843 Ga0068860_100002022 Ga0068860_1000020223 158
232 3300005844 Ga0068862_100004066 Ga0068862_10000406612 158
233 3300006173 Ga0070716_100149050 Ga0070716_1001490502 158
234 3300006237 Ga0097621_100000754 Ga0097621_10000075427 158
235 3300006358 Ga0068871_100001380 Ga0068871_1000013804 158
236 3300006844 Ga0075428_100004852 Ga0075428_10000485218 158
237 3300006852 Ga0075433_10678693 Ga0075433_106786932 158
238 3300006880 Ga0075429_100053218 Ga0075429_1000532182 158
239 3300006881 Ga0068865_100003371 Ga0068865_1000033716 158
240 3300006931 Ga0097620_100000420 Ga0097620_10000042022 158
241 3300009094 Ga0111539_10218769 Ga0111539_102187692 158
242 3300009098 Ga0105245_10000533 Ga0105245_1000053319 158
243 3300009147 Ga0114129_10002987 Ga0114129_100029876 158
244 3300009148 Ga0105243_10000495 Ga0105243_100004958 158
245 3300009174 Ga0105241_10009614 Ga0105241_100096144 158
246 3300009176 Ga0105242_10000248 Ga0105242_1000024823 158
247 3300009553 Ga0105249_10010445 Ga0105249_100104456 158
248 3300010375 Ga0105239_10081132 Ga0105239_100811322 158
249 3300011119 Ga0105246_10285906 Ga0105246_102859062 158
250 3300012490 Ga0157322_1018748 Ga0157322_10187481 158
251 3300013297 Ga0157378_10000387 Ga0157378_1000038725 158
252 3300013306 Ga0163162_10359417 Ga0163162_103594172 158
253 3300014745 Ga0157377_10746998 Ga0157377_107469981 158
254 3300025885 Ga0207653_10002620 Ga0207653_100026208 158
255 3300025899 Ga0207642_10000130 Ga0207642_1000013021 158
256 3300025901 Ga0207688_10041973 Ga0207688_100419732 158
257 3300025911 Ga0207654_10011544 Ga0207654_100115447 158
258 3300025917 Ga0207660_10000756 Ga0207660_100007569 158
259 3300025918 Ga0207662_10000095 Ga0207662_1000009528 158
260 3300025921 Ga0207652_10003750 Ga0207652_100037502 158
261 3300025926 Ga0207659_10102993 Ga0207659_101029932 158
262 3300025927 Ga0207687_10000432 Ga0207687_100004327 158
263 3300025933 Ga0207706_10217678 Ga0207706_102176782 158
264 3300025934 Ga0207686_10001368 Ga0207686_100013687 158
265 3300025935 Ga0207709_10001646 Ga0207709_1000164610 158
266 3300025936 Ga0207670_10002845 Ga0207670_100028459 158
267 3300025938 Ga0207704_10000281 Ga0207704_100002814 158
268 3300025939 Ga0207665_10249358 Ga0207665_102493582 158
269 3300025942 Ga0207689_10000977 Ga0207689_100009779 158
270 3300025949 Ga0207667_10005008 Ga0207667_100050083 158
271 3300025961 Ga0207712_10002627 Ga0207712_100026279 158
272 3300025981 Ga0207640_10004566 Ga0207640_100045663 158
273 3300026023 Ga0207677_10000832 Ga0207677_1000083218 158
274 3300026035 Ga0207703_10005254 Ga0207703_100052548 158
275 3300026075 Ga0207708_10000551 Ga0207708_100005519 158
276 3300026078 Ga0207702_10013754 Ga0207702_100137547 158
277 3300026088 Ga0207641_10060269 Ga0207641_100602695 158
278 3300026089 Ga0207648_10000513 Ga0207648_1000051324 158
279 3300026118 Ga0207675_100001063 Ga0207675_1000010639 158
280 3300026142 Ga0207698_10076668 Ga0207698_100766682 158
281 3300027907 Ga0207428_10003903 Ga0207428_100039032 158
282 3300028380 Ga0268265_10006650 Ga0268265_100066503 158
283 3300028381 Ga0268264_10000827 Ga0268264_1000082724 158
284 3300034816 Ga0373930_0004384 Ga0373930_0004384_945_1421 158
285 3300034817 Ga0373948_0002060 Ga0373948_0002060_655_1131 158
286 3300034819 Ga0373958_0006525 Ga0373958_0006525_962_1438 158
287 3300035084 Ga0373928_0003711 Ga0373928_0003711_32_508 158
288 3300035085 Ga0373929_0036497 Ga0373929_0036497_473_949 158
289 3300035088 Ga0373940_0015511 Ga0373940_0015511_1158_1634 158
290 3300035112 Ga0373932_0238592 Ga0373932_0238592_16_492 158
291 3300035114 Ga0373939_0001211 Ga0373939_0001211_3875_4351 158
292 3300035691 Ga0373931_0004111 Ga0373931_0004111_5831_6307 158
293 3300035691 Ga0373931_0004119 Ga0373931_0004119_2767_3243 158
294 3300035691 Ga0373931_0062853 Ga0373931_0062853_1252_1728 158
295 3300042876 Ga0451577_0035929 Ga0451577_0035929_199_675 158
296 3300045051 Ga0451576_0003270 Ga0451576_0003270_19222_19698 158
297 3300045051 Ga0451576_0230453 Ga0451576_0230453_342_818 158
298 3300045051 Ga0451576_0389174 Ga0451576_0389174_282_758 158
299 3300048905 Ga0496102_1108516 Ga0496102_1108516_101_577 158
300 3300049588 Ga0501072_0172512 Ga0501072_0172512_21_509 158
301 3300049824 Ga0501045_0729385 Ga0501045_0729385_66_542 158
302 3300050507 nmdc:mga05p37_1935_c1 nmdc:mga05p37_1935_c1_3026_3502 158
303 3300050508 nmdc:mga09592_89148_c1 nmdc:mga09592_89148_c1_2006_2482 158
304 3300050511 nmdc:mga08y16_299548_c1 nmdc:mga08y16_299548_c1_1127_1603 158

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07331

TctB

Tripartite tricarboxylate transporter TctB family

5

155

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
8sm3-assembly1.cif.gz_B structure of bacillus cereus vd045 gabija gaja-gajb complex 0.569 75 132
4fxx-assembly6.cif.gz_D-2 structure of sf1 coiled-coil domain 0.5493 2 77
6w1s-assembly1.cif.gz_V atomic model of the mammalian mediator complex 0.5315 6 95
6ww7-assembly1.cif.gz_E structure of the human er membrane protein complex in a lipid nanodisc 0.5219 6 82
7nsu-assembly1.cif.gz_D colicine9 intact translocation complex 0.5099 6 131
ID Description Score Start End Superfamily
1t5eD03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.7075 6 63 1.10.287.470
1t5eD03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.6398 6 63 1.10.287.470
af_O06612_48_145_1.10.287.850 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;HP0062-like domain 0.622 3 68 1.10.287.850
af_F4KFV7_645_750_1.20.58.1080 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.533 1 77 1.20.58.1080
af_Q9NRG4_292_365_1.25.40.970 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat; 0.5073 79 147 1.25.40.970
ID Description Score Start End GO Terms
AF-A0A4V2E5T2-F1-model_v4 DUF1468 domain-containing protein 0.9305 1 158 GO:0016020
AF-A0A7C2R2I5-F1-model_v4 DUF1468 domain-containing protein 0.9256 1 158 GO:0016020
AF-A0A4V2E5T2-F1-model_v4 DUF1468 domain-containing protein 0.925 1 158 GO:0016020
AF-A0A537C6A6-F1-model_v4 Tripartite tricarboxylate transporter TctB family protein 0.9231 1 158 GO:0016020
AF-A0A7C2R2I5-F1-model_v4 DUF1468 domain-containing protein 0.92 1 158 GO:0016020

Feature Viewer

pLDDT pTM Quality
89.95 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map