F397236

General Info

Members Datasets Scaffolds Average Seq Length
303 197 297 165

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0000229|Ga0495686_0000229_66545_67105
Length 186
Sequence MSTKYVLDPADRRRLLASPAGWIACGFGSGLTPKAQGTFGSLAAILPWLFLRTLSIEYWLAIIAVSFALGVWACDVAGRIIGVADHRSLVWDEFVGQWIALIPALFIHELWAVPAAFVLFRAFDVRKPWPIGWIDRRVKGGLGVMIDDVVAGVFAAVVLYLIYIISTGIIIGFAGYLIYLMFGHHS

Samples

Sample ID Description Type Environment
1 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
2 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
3 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
4 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
5 2941471342 Luteibacter sp. 621 Isolate Unclassified
6 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
7 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
8 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
9 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
10 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
11 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
12 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
17 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
18 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
19 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
20 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
21 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
71 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
72 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
73 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
74 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
79 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
82 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
84 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
110 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
111 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
116 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
117 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
118 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
119 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
120 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
121 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
122 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
123 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
124 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
125 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
126 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
127 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
128 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
129 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
130 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
131 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
132 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
133 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
134 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
135 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
136 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
137 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
138 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
139 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
140 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
141 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
142 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
143 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
144 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
145 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
146 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
147 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
148 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
149 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
150 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
151 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
154 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
155 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
158 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
159 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
160 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
161 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
162 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
163 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
164 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
165 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
166 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
167 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
179 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
180 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
181 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
182 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
183 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
184 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
185 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
186 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
187 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
188 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
191 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
192 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
193 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
194 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
195 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
196 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
197 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.36
Metatranscriptomes 0.66
Isolates 1.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.58
Nodule 0
Rhizoplane 3.3
Rhizosphere 76.24
Stem 0
Stem Tuber 0
Unclassified 11.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1001729 3300001904 Bacteria 3936
2 JGI24740J21852_10002486 3300001979 Bacteria 8337
3 JGI24739J22299_10007591 3300001989 Bacteria 4062
4 JGI24737J22298_10012310 3300001990 Bacteria 2789
5 JGI24735J21928_10047970 3300002067 Bacteria 1237
6 JGI24738J21930_10016457 3300002075 Bacteria 1562
7 rootH1_10075932 3300003316 Bacteria 2381
8 rootL2_10199438 3300003322 Bacteria 1992
9 rootH1_10256663 3300003323 Bacteria 2828
10 Ga0006562J51391_1042664 3300003578 Bacteria 8710
11 Ga0006562J51391_1042666 3300003578 Bacteria 6180
12 Ga0055525_1000055 3300003759 Bacteria 215181
13 Ga0055527_1000210 3300003760 Bacteria 37874
14 Ga0055535_1000454 3300003761 Bacteria 37846
15 Ga0055542_1000468 3300003762 Bacteria 37874
16 Ga0055529_1000479 3300003763 Bacteria 37884
17 Ga0055540_1053095 3300003792 Bacteria 830
18 Ga0055543_1007681 3300004625 Bacteria 2464
19 Ga0065165_1000108 3300005262 Bacteria 139605
20 Ga0065165_1005817 3300005262 Bacteria 6725
21 Ga0070658_10014704 3300005327 Bacteria 6277
22 Ga0070666_10000013 3300005335 Bacteria 230442
23 Ga0070666_10000487 3300005335 Bacteria 23992
24 Ga0070661_100007367 3300005344 Bacteria 7588
25 Ga0070661_100095657 3300005344 Bacteria 2203
26 Ga0070661_100231950 3300005344 Bacteria 1419
27 Ga0070668_100014083 3300005347 Bacteria 5978
28 Ga0070667_100000072 3300005367 Bacteria 122929
29 Ga0070663_100005396 3300005455 Bacteria 7595
30 Ga0070663_100128248 3300005455 Bacteria 1923
31 Ga0068853_100001849 3300005539 Bacteria 15546
32 Ga0068853_100010111 3300005539 Bacteria 7625
33 Ga0070693_100325362 3300005547 Bacteria 1044
34 Ga0070665_100007039 3300005548 Bacteria 11429
35 Ga0068855_100042790 3300005563 Bacteria 5366
36 Ga0068855_100071187 3300005563 Bacteria 4044
37 Ga0070664_100664193 3300005564 Bacteria 969
38 Ga0068857_100013283 3300005577 Bacteria 7173
39 Ga0068854_100002865 3300005578 Bacteria 10728
40 Ga0068856_100733794 3300005614 Bacteria 1008
41 Ga0068856_100942343 3300005614 Bacteria 882
42 Ga0068852_100006036 3300005616 Bacteria 8728
43 Ga0068852_100049027 3300005616 Bacteria 3611
44 Ga0068852_100058443 3300005616 Bacteria 3341
45 Ga0068859_100373175 3300005617 Bacteria 1522
46 Ga0068864_100004209 3300005618 Bacteria 11834
47 Ga0068851_10000908 3300005834 Bacteria 12753
48 Ga0068851_10010365 3300005834 Bacteria 4350
49 Ga0068863_100006254 3300005841 Bacteria 11695
50 Ga0068863_101226554 3300005841 Bacteria 756
51 Ga0068860_100017401 3300005843 Bacteria 7003
52 Ga0068862_100453617 3300005844 Bacteria 1209
53 Ga0070716_100260207 3300006173 Bacteria 1187
54 Ga0097621_100001824 3300006237 Bacteria 14593
55 Ga0068871_100069663 3300006358 Bacteria 2889
56 Ga0097620_100373206 3300006931 Bacteria 1522
57 Ga0105250_10412687 3300009092 Unclassified 600
58 Ga0105240_10011172 3300009093 Bacteria 12533
59 Ga0105240_10023678 3300009093 Bacteria 8112
60 Ga0105240_10032548 3300009093 Bacteria 6750
61 Ga0105240_10143630 3300009093 Bacteria 2850
62 Ga0105245_10101667 3300009098 Bacteria 2661
63 Ga0105245_10459777 3300009098 Bacteria 1283
64 Ga0105247_10002916 3300009101 Bacteria 11384
65 Ga0105241_10014588 3300009174 Bacteria 5754
66 Ga0105237_10000084 3300009545 Bacteria 125742
67 Ga0105237_10589687 3300009545 Bacteria 1118
68 Ga0105238_10000131 3300009551 Bacteria 82050
69 Ga0105249_10680199 3300009553 Bacteria 1088
70 Ga0105239_10002525 3300010375 Bacteria 23254
71 Ga0105239_10018126 3300010375 Bacteria 7783
72 Ga0105239_10029526 3300010375 Bacteria 6028
73 Ga0105239_10117030 3300010375 Bacteria 2958
74 Ga0105239_10182761 3300010375 Bacteria 2346
75 Ga0157314_1000507 3300012500 Bacteria 3702
76 Ga0157370_10045998 3300013104 Bacteria 4186
77 Ga0157370_10638925 3300013104 Bacteria 973
78 Ga0157369_10065473 3300013105 Bacteria 3911
79 Ga0157369_10169698 3300013105 Bacteria 2299
80 Ga0157374_10384425 3300013296 Bacteria 1398
81 Ga0163162_10000221 3300013306 Bacteria 52249
82 Ga0157372_10000334 3300013307 Bacteria 51813
83 Ga0157372_10124881 3300013307 Bacteria 2959
84 Ga0157372_11052393 3300013307 Bacteria 942
85 Ga0157375_11830008 3300013308 Unclassified 720
86 Ga0163163_10000112 3300014325 Bacteria 86324
87 Ga0163163_10000585 3300014325 Bacteria 32121
88 Ga0182008_10006516 3300014497 Bacteria 6516
89 Ga0157379_10007853 3300014968 Bacteria 9242
90 Ga0157376_11297484 3300014969 Unclassified 758
91 Ga0182006_1000031 3300015261 Bacteria 240055
92 Ga0182006_1000496 3300015261 Bacteria 30592
93 Ga0182007_10003787 3300015262 Bacteria 7047
94 Ga0182007_10046249 3300015262 Bacteria 1442
95 Ga0182005_1001001 3300015265 Bacteria 12121
96 Ga0182005_1002650 3300015265 Bacteria 6301
97 Ga0183369_1013 3300015685 Bacteria 222738
98 Ga0209674_100785 3300025226 Bacteria 10709
99 Ga0209672_100004 3300025228 Bacteria 1467504
100 Ga0209147_110118 3300025229 Bacteria 1093
101 Ga0209563_100076 3300025230 Bacteria 215269
102 Ga0209437_100782 3300025233 Bacteria 14969
103 Ga0209258_100003 3300025242 Bacteria 1467504
104 Ga0209148_1000025 3300025254 Bacteria 663262
105 Ga0209129_1001515 3300025258 Bacteria 12873
106 Ga0209455_1000004 3300025272 Bacteria 1467504
107 Ga0209758_1000301 3300025297 Bacteria 96998
108 Ga0209051_1007151 3300025303 Bacteria 6152
109 Ga0209051_1086804 3300025303 Bacteria 883
110 Ga0207656_10002307 3300025321 Bacteria 6408
111 Ga0207656_10003182 3300025321 Bacteria 5613
112 Ga0207680_10000001 3300025903 Bacteria 1091453
113 Ga0207680_10000598 3300025903 Bacteria 17011
114 Ga0207647_10000034 3300025904 Bacteria 99280
115 Ga0207647_10002308 3300025904 Bacteria 14534
116 Ga0207705_10023786 3300025909 Bacteria 4371
117 Ga0207705_10307269 3300025909 Bacteria 1217
118 Ga0207654_10000719 3300025911 Bacteria 18479
119 Ga0207654_10397228 3300025911 Bacteria 958
120 Ga0207695_10004205 3300025913 Bacteria 19775
121 Ga0207695_10037931 3300025913 Bacteria 5195
122 Ga0207695_10058752 3300025913 Bacteria 3991
123 Ga0207695_10128550 3300025913 Bacteria 2493
124 Ga0207695_10129186 3300025913 Bacteria 2486
125 Ga0207671_10000011 3300025914 Bacteria 530349
126 Ga0207649_10006569 3300025920 Bacteria 6318
127 Ga0207649_10103192 3300025920 Bacteria 1891
128 Ga0207694_10000654 3300025924 Bacteria 31284
129 Ga0207687_10197149 3300025927 Bacteria 1571
130 Ga0207687_10255264 3300025927 Bacteria 1395
131 Ga0207711_10001918 3300025941 Bacteria 18898
132 Ga0207667_10000219 3300025949 Bacteria 80218
133 Ga0207667_10000446 3300025949 Bacteria 55443
134 Ga0207668_10008877 3300025972 Bacteria 6012
135 Ga0207640_10000280 3300025981 Bacteria 34294
136 Ga0207640_10010303 3300025981 Bacteria 5260
137 Ga0207640_10169460 3300025981 Bacteria 1625
138 Ga0207658_10000997 3300025986 Bacteria 23236
139 Ga0207658_10085292 3300025986 Bacteria 2432
140 Ga0207639_10001412 3300026041 Bacteria 16219
141 Ga0207639_10007087 3300026041 Bacteria 7646
142 Ga0207678_10002665 3300026067 Bacteria 16207
143 Ga0207678_10044550 3300026067 Bacteria 3837
144 Ga0207702_10956320 3300026078 Bacteria 849
145 Ga0207641_10025217 3300026088 Bacteria 4903
146 Ga0207676_10038682 3300026095 Bacteria 3643
147 Ga0207676_11285484 3300026095 Bacteria 726
148 Ga0207674_10001145 3300026116 Bacteria 34394
149 Ga0207698_10010564 3300026142 Bacteria 5943
150 Ga0207698_10037112 3300026142 Bacteria 3585
151 Ga0207698_10225080 3300026142 Bacteria 1698
152 Ga0268266_10000075 3300028379 Bacteria 218045
153 Ga0268266_10002665 3300028379 Bacteria 18789
154 Ga0268264_10003031 3300028381 Bacteria 14566
155 Ga0268264_11639370 3300028381 Unclassified 654
156 Ga0307405_10666438 3300031731 Bacteria 857
157 Ga0307412_10001016 3300031911 Bacteria 16068
158 Ga0395899_0045161 3300037312 Bacteria 3282
159 Ga0395900_0046633 3300037418 Bacteria 4463
160 Ga0395898_0044330 3300037466 Bacteria 4379
161 Ga0395901_0175871 3300038443 Bacteria 2245
162 Ga0439436_0000032 3300041404 Bacteria 46437
163 Ga0439465_0010578 3300041413 Bacteria 2897
164 Ga0451791_1129347 3300041451 Bacteria 8600
165 Ga0451793_0152202 3300041452 Bacteria 631
166 Ga0451793_0561099 3300041452 Bacteria 877
167 Ga0451802_0459958 3300041460 Bacteria 930
168 Ga0451807_1035907 3300041486 Bacteria 5871
169 Ga0451837_1153363 3300041494 Bacteria 4002
170 Ga0451853_0399036 3300041512 Bacteria 3876
171 Ga0450897_030839 3300042128 Bacteria 606
172 Ga0450908_000007 3300042184 Bacteria 55488
173 Ga0466969_0039348 3300044656 Bacteria 2375
174 Ga0466982_0000018 3300044672 Bacteria 113912
175 Ga0466982_0000096 3300044672 Bacteria 21532
176 Ga0466965_0212617 3300044683 Bacteria 1028
177 Ga0466966_0007696 3300044684 Bacteria 7137
178 Ga0466964_0001814 3300044706 Bacteria 7433
179 Ga0466971_0054764 3300044719 Bacteria 1797
180 Ga0466968_0001797 3300044735 Bacteria 7743
181 Ga0466968_0022560 3300044735 Bacteria 2558
182 Ga0466957_0002919 3300044842 Bacteria 9262
183 Ga0466957_0165434 3300044842 Bacteria 1438
184 Ga0466957_0287851 3300044842 Bacteria 1101
185 Ga0466960_0022862 3300044901 Bacteria 2799
186 Ga0466958_0146021 3300045836 Bacteria 1491
187 Ga0495638_0011198 3300046460 Bacteria 6192
188 Ga0495650_0000350 3300046471 Bacteria 81541
189 Ga0495650_0000869 3300046471 Bacteria 35923
190 Ga0495585_0001138 3300046492 Bacteria 21797
191 Ga0495606_0053722 3300046507 Bacteria 2613
192 Ga0495606_0072886 3300046507 Bacteria 2156
193 Ga0495610_0000824 3300046512 Bacteria 29002
194 Ga0495610_0062706 3300046512 Bacteria 1762
195 Ga0495631_0000036 3300046518 Bacteria 81635
196 Ga0495631_0000318 3300046518 Bacteria 33436
197 Ga0495632_0027070 3300046519 Bacteria 3008
198 Ga0495643_0075534 3300046522 Bacteria 1763
199 Ga0495668_0009490 3300046616 Bacteria 5974
200 Ga0495611_0000028 3300046648 Bacteria 116155
201 Ga0495625_0070601 3300046660 Bacteria 2452
202 Ga0495625_0282494 3300046660 Bacteria 1067
203 Ga0495670_0005296 3300046691 Bacteria 6347
204 Ga0495649_0095642 3300046694 Bacteria 1581
205 Ga0495660_0004438 3300046810 Bacteria 8484
206 Ga0495680_0117721 3300047322 Bacteria 1964
207 Ga0495673_0000004 3300047469 Bacteria 1354526
208 Ga0495673_0000041 3300047469 Bacteria 296723
209 Ga0495673_0079993 3300047469 Bacteria 1355
210 Ga0495686_0000117 3300047472 Bacteria 166073
211 Ga0495686_0000229 3300047472 Bacteria 103283
212 Ga0496102_0275134 3300048905 Bacteria 1587
213 Ga0496106_0345603 3300048909 Bacteria 1195
214 Ga0496108_0069552 3300048911 Bacteria 2971
215 Ga0496110_0881874 3300048913 Bacteria 800
216 Ga0496115_0269589 3300048918 Bacteria 1399
217 Ga0496116_0064576 3300048919 Bacteria 2353
218 Ga0496117_0023133 3300048920 Bacteria 4963
219 Ga0496117_0030912 3300048920 Bacteria 4099
220 Ga0496118_0002903 3300048921 Bacteria 22296
221 Ga0496118_0006396 3300048921 Bacteria 12971
222 Ga0496118_0093538 3300048921 Bacteria 2059
223 Ga0496120_0174192 3300048923 Bacteria 1062
224 Ga0496121_0000771 3300048924 Bacteria 58811
225 Ga0496121_0001298 3300048924 Bacteria 42922
226 Ga0496121_0014080 3300048924 Bacteria 8531
227 Ga0496121_0284125 3300048924 Bacteria 1130
228 Ga0496122_0019348 3300048925 Bacteria 6224
229 Ga0496122_0102736 3300048925 Bacteria 1904
230 Ga0496123_0009820 3300048926 Bacteria 8547
231 Ga0496123_0078537 3300048926 Bacteria 2021
232 Ga0496125_0001450 3300048928 Bacteria 34494
233 Ga0496125_0008488 3300048928 Bacteria 10750
234 Ga0496125_0068692 3300048928 Bacteria 2786
235 Ga0496126_0009745 3300048929 Bacteria 10172
236 Ga0496126_0016296 3300048929 Bacteria 7438
237 Ga0496126_0256935 3300048929 Bacteria 1454
238 Ga0496126_0276115 3300048929 Bacteria 1393
239 Ga0495682_0003108 3300049460 Bacteria 7515
240 Ga0501031_0004820 3300049568 Bacteria 8763
241 Ga0501032_0016091 3300049569 Bacteria 5264
242 Ga0501032_0160696 3300049569 Bacteria 1475
243 Ga0501032_0260715 3300049569 Bacteria 1124
244 Ga0501033_0000375 3300049570 Bacteria 42833
245 Ga0501033_0047050 3300049570 Bacteria 3207
246 Ga0501033_0145005 3300049570 Bacteria 1715
247 Ga0501033_0199236 3300049570 Bacteria 1431
248 Ga0501034_0003104 3300049571 Bacteria 19154
249 Ga0501034_0131738 3300049571 Bacteria 2483
250 Ga0501034_0261517 3300049571 Bacteria 1673
251 Ga0501036_0044118 3300049572 Bacteria 3776
252 Ga0501036_0935986 3300049572 Bacteria 710
253 Ga0501037_0179120 3300049573 Bacteria 1504
254 Ga0501038_0015538 3300049574 Bacteria 6920
255 Ga0501038_0193151 3300049574 Bacteria 1637
256 Ga0501038_0497483 3300049574 Bacteria 932
257 Ga0501043_0093171 3300049579 Bacteria 2368
258 Ga0501043_0323937 3300049579 Bacteria 1174
259 Ga0501043_0446303 3300049579 Bacteria 972
260 Ga0501046_0038064 3300049580 Bacteria 3862
261 Ga0501046_0078807 3300049580 Bacteria 2548
262 Ga0501046_0207957 3300049580 Bacteria 1454
263 Ga0501047_0002093 3300049581 Bacteria 19094
264 Ga0501047_0014043 3300049581 Bacteria 7610
265 Ga0501047_0074727 3300049581 Bacteria 3262
266 Ga0501047_0124605 3300049581 Bacteria 2457
267 Ga0501047_0236464 3300049581 Bacteria 1678
268 Ga0501048_0029769 3300049582 Bacteria 3955
269 Ga0501067_0000583 3300049583 Bacteria 19798
270 Ga0501068_0007857 3300049584 Bacteria 5911
271 Ga0501068_0292634 3300049584 Bacteria 1042
272 Ga0501069_0002178 3300049585 Bacteria 9867
273 Ga0501070_0004339 3300049586 Bacteria 12191
274 Ga0501072_0002507 3300049588 Bacteria 13756
275 Ga0501073_0000954 3300049589 Bacteria 20809
276 Ga0501073_0054262 3300049589 Bacteria 2806
277 Ga0501074_0008549 3300049590 Bacteria 7417
278 Ga0501079_0379399 3300049741 Bacteria 1108
279 Ga0501080_0001893 3300049742 Bacteria 18018
280 Ga0501080_0304533 3300049742 Bacteria 1445
281 Ga0501083_0001929 3300049744 Bacteria 14264
282 Ga0501035_0089863 3300049822 Bacteria 2704
283 Ga0501035_0111649 3300049822 Bacteria 2395
284 Ga0501035_0481465 3300049822 Bacteria 1023
285 Ga0501035_0487857 3300049822 Bacteria 1015
286 Ga0501035_0642210 3300049822 Bacteria 861
287 Ga0501044_0003272 3300049823 Bacteria 18232
288 Ga0501044_0023396 3300049823 Bacteria 6571
289 Ga0501044_0356413 3300049823 Bacteria 1381
290 Ga0500643_008248 3300053087 Bacteria 4110
291 Ga0500646_0028356 3300053090 Bacteria 1528
292 Ga0500651_0020968 3300053093 Bacteria 4071
293 Ga0500597_000016 3300053120 Bacteria 38903
294 Ga0500645_000639 3300053730 Bacteria 22272
295 Ga0501084_0061361 3300054114 Bacteria 3148
296 Ga0501082_0078623 3300060353 Bacteria 2845
297 Ga0466962_0000272 3300061719 Bacteria 21817

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049580 Ga0501046_0038064 Ga0501046_0038064_3418_3831 136
2 3300047472 Ga0495686_0000117 Ga0495686_0000117_53625_54152 143
3 3300049570 Ga0501033_0047050 Ga0501033_0047050_1892_2404 152
4 3300049570 Ga0501033_0145005 Ga0501033_0145005_407_910 152
5 3300049571 Ga0501034_0261517 Ga0501034_0261517_46_558 152
6 3300049572 Ga0501036_0935986 Ga0501036_0935986_172_684 152
7 3300049573 Ga0501037_0179120 Ga0501037_0179120_154_666 152
8 3300049574 Ga0501038_0193151 Ga0501038_0193151_852_1364 152
9 3300049581 Ga0501047_0124605 Ga0501047_0124605_1735_2238 152
10 3300049581 Ga0501047_0236464 Ga0501047_0236464_441_953 152
11 3300049584 Ga0501068_0292634 Ga0501068_0292634_512_1015 152
12 3300049822 Ga0501035_0481465 Ga0501035_0481465_18_521 152
13 3300049822 Ga0501035_0487857 Ga0501035_0487857_84_596 152
14 3300046492 Ga0495585_0001138 Ga0495585_0001138_1926_2426 155
15 3300046518 Ga0495631_0000318 Ga0495631_0000318_13512_14012 155
16 3300049460 Ga0495682_0003108 Ga0495682_0003108_4007_4507 155
17 3300053730 Ga0500645_000639 Ga0500645_000639_2479_2979 155
18 3300005614 Ga0068856_100733794 Ga0068856_1007337942 157
19 3300025981 Ga0207640_10169460 Ga0207640_101694602 157
20 3300037312 Ga0395899_0045161 Ga0395899_0045161_416_922 159
21 3300037418 Ga0395900_0046633 Ga0395900_0046633_2970_3476 159
22 3300037466 Ga0395898_0044330 Ga0395898_0044330_2487_2993 159
23 3300038443 Ga0395901_0175871 Ga0395901_0175871_49_555 159
24 3300014325 Ga0163163_10000112 Ga0163163_1000011237 160
25 3300026095 Ga0207676_11285484 Ga0207676_112854842 160
26 3300005616 Ga0068852_100049027 Ga0068852_1000490275 161
27 3300005834 Ga0068851_10010365 Ga0068851_100103652 161
28 3300005841 Ga0068863_101226554 Ga0068863_1012265542 161
29 3300006173 Ga0070716_100260207 Ga0070716_1002602072 161
30 3300006237 Ga0097621_100001824 Ga0097621_10000182410 161
31 3300013296 Ga0157374_10384425 Ga0157374_103844252 161
32 3300025321 Ga0207656_10003182 Ga0207656_100031822 161
33 3300025913 Ga0207695_10037931 Ga0207695_100379312 161
34 3300026142 Ga0207698_10010564 Ga0207698_100105645 161
35 3300041452 Ga0451793_0152202 Ga0451793_0152202_106_594 161
36 3300048911 Ga0496108_0069552 Ga0496108_0069552_664_1185 161
37 3300048913 Ga0496110_0881874 Ga0496110_0881874_153_674 161
38 3300005335 Ga0070666_10000487 Ga0070666_1000048718 162
39 3300005344 Ga0070661_100231950 Ga0070661_1002319501 162
40 3300005367 Ga0070667_100000072 Ga0070667_10000007212 162
41 3300005455 Ga0070663_100005396 Ga0070663_1000053967 162
42 3300005539 Ga0068853_100001849 Ga0068853_10000184916 162
43 3300005539 Ga0068853_100010111 Ga0068853_1000101113 162
44 3300005563 Ga0068855_100071187 Ga0068855_1000711872 162
45 3300005616 Ga0068852_100006036 Ga0068852_1000060368 162
46 3300005618 Ga0068864_100004209 Ga0068864_1000042098 162
47 3300005841 Ga0068863_100006254 Ga0068863_10000625412 162
48 3300005843 Ga0068860_100017401 Ga0068860_1000174015 162
49 3300006358 Ga0068871_100069663 Ga0068871_1000696632 162
50 3300009098 Ga0105245_10101667 Ga0105245_101016672 162
51 3300009174 Ga0105241_10014588 Ga0105241_100145886 162
52 3300010375 Ga0105239_10002525 Ga0105239_1000252516 162
53 3300010375 Ga0105239_10018126 Ga0105239_100181266 162
54 3300013104 Ga0157370_10638925 Ga0157370_106389253 162
55 3300013307 Ga0157372_10000334 Ga0157372_1000033444 162
56 3300013307 Ga0157372_10124881 Ga0157372_101248812 162
57 3300014325 Ga0163163_10000585 Ga0163163_1000058514 162
58 3300014968 Ga0157379_10007853 Ga0157379_100078537 162
59 3300025303 Ga0209051_1086804 Ga0209051_10868041 162
60 3300025903 Ga0207680_10000598 Ga0207680_100005986 162
61 3300025909 Ga0207705_10307269 Ga0207705_103072692 162
62 3300025911 Ga0207654_10000719 Ga0207654_100007194 162
63 3300025911 Ga0207654_10397228 Ga0207654_103972281 162
64 3300025927 Ga0207687_10197149 Ga0207687_101971492 162
65 3300025941 Ga0207711_10001918 Ga0207711_100019188 162
66 3300025986 Ga0207658_10000997 Ga0207658_1000099711 162
67 3300026041 Ga0207639_10001412 Ga0207639_100014125 162
68 3300026041 Ga0207639_10007087 Ga0207639_100070875 162
69 3300026067 Ga0207678_10002665 Ga0207678_1000266512 162
70 3300026078 Ga0207702_10956320 Ga0207702_109563202 162
71 3300026088 Ga0207641_10025217 Ga0207641_100252174 162
72 3300026095 Ga0207676_10038682 Ga0207676_100386822 162
73 3300026142 Ga0207698_10225080 Ga0207698_102250802 162
74 3300028381 Ga0268264_10003031 Ga0268264_1000303114 162
75 3300041451 Ga0451791_1129347 Ga0451791_1129347_7575_8066 162
76 3300041452 Ga0451793_0561099 Ga0451793_0561099_160_651 162
77 3300041460 Ga0451802_0459958 Ga0451802_0459958_350_841 162
78 3300041494 Ga0451837_1153363 Ga0451837_1153363_1901_2392 162
79 3300041512 Ga0451853_0399036 Ga0451853_0399036_402_893 162
80 3300048923 Ga0496120_0174192 Ga0496120_0174192_416_907 162
81 3300048929 Ga0496126_0276115 Ga0496126_0276115_434_925 162
82 3300049568 Ga0501031_0004820 Ga0501031_0004820_6627_7118 162
83 3300049569 Ga0501032_0160696 Ga0501032_0160696_763_1254 162
84 3300049571 Ga0501034_0131738 Ga0501034_0131738_1008_1499 162
85 3300049579 Ga0501043_0446303 Ga0501043_0446303_220_711 162
86 3300049581 Ga0501047_0074727 Ga0501047_0074727_2498_2989 162
87 3300049589 Ga0501073_0054262 Ga0501073_0054262_1296_1787 162
88 3300049742 Ga0501080_0304533 Ga0501080_0304533_122_613 162
89 3300049822 Ga0501035_0089863 Ga0501035_0089863_2181_2672 162
90 3300049823 Ga0501044_0356413 Ga0501044_0356413_829_1320 162
91 3300053087 Ga0500643_008248 Ga0500643_008248_2558_3049 162
92 3300053093 Ga0500651_0020968 Ga0500651_0020968_2773_3264 162
93 3300053120 Ga0500597_000016 Ga0500597_000016_8111_8602 162
94 iso_pu_bacteria 2842914999 2842918670 162
95 iso_pu_bacteria 2842918807 2842922145 162
96 iso_pu_bacteria 2953994433 2953997263 162
97 3300005344 Ga0070661_100095657 Ga0070661_1000956572 163
98 3300005548 Ga0070665_100007039 Ga0070665_1000070398 163
99 3300009093 Ga0105240_10023678 Ga0105240_100236782 163
100 3300009098 Ga0105245_10459777 Ga0105245_104597772 163
101 3300009545 Ga0105237_10589687 Ga0105237_105896872 163
102 3300010375 Ga0105239_10029526 Ga0105239_100295266 163
103 3300025913 Ga0207695_10129186 Ga0207695_101291862 163
104 3300025920 Ga0207649_10103192 Ga0207649_101031922 163
105 3300025927 Ga0207687_10255264 Ga0207687_102552642 163
106 3300028379 Ga0268266_10002665 Ga0268266_100026658 163
107 3300041486 Ga0451807_1035907 Ga0451807_1035907_5342_5842 163
108 3300047322 Ga0495680_0117721 Ga0495680_0117721_1005_1502 163
109 3300048921 Ga0496118_0093538 Ga0496118_0093538_582_1073 163
110 3300048929 Ga0496126_0256935 Ga0496126_0256935_710_1270 163
111 3300049569 Ga0501032_0016091 Ga0501032_0016091_1798_2301 163
112 3300049571 Ga0501034_0003104 Ga0501034_0003104_12737_13240 163
113 3300049572 Ga0501036_0044118 Ga0501036_0044118_946_1449 163
114 3300049574 Ga0501038_0015538 Ga0501038_0015538_1637_2140 163
115 3300049579 Ga0501043_0323937 Ga0501043_0323937_280_783 163
116 3300049580 Ga0501046_0078807 Ga0501046_0078807_1209_1712 163
117 3300049581 Ga0501047_0002093 Ga0501047_0002093_12686_13189 163
118 3300049583 Ga0501067_0000583 Ga0501067_0000583_10413_10916 163
119 3300049584 Ga0501068_0007857 Ga0501068_0007857_3885_4388 163
120 3300049585 Ga0501069_0002178 Ga0501069_0002178_6773_7276 163
121 3300049586 Ga0501070_0004339 Ga0501070_0004339_10742_11245 163
122 3300049588 Ga0501072_0002507 Ga0501072_0002507_10850_11353 163
123 3300049589 Ga0501073_0000954 Ga0501073_0000954_947_1450 163
124 3300049590 Ga0501074_0008549 Ga0501074_0008549_5734_6237 163
125 3300049741 Ga0501079_0379399 Ga0501079_0379399_531_1034 163
126 3300049742 Ga0501080_0001893 Ga0501080_0001893_11444_11947 163
127 3300049744 Ga0501083_0001929 Ga0501083_0001929_1715_2218 163
128 3300049823 Ga0501044_0003272 Ga0501044_0003272_12270_12773 163
129 3300054114 Ga0501084_0061361 Ga0501084_0061361_1531_2034 163
130 3300060353 Ga0501082_0078623 Ga0501082_0078623_1449_1952 163
131 iso_pu_bacteria 2884338543 2884341932 163
132 iso_pu_bacteria 2941471342 2941474338 163
133 3300001979 JGI24740J21852_10002486 JGI24740J21852_100024862 164
134 3300001989 JGI24739J22299_10007591 JGI24739J22299_100075914 164
135 3300001990 JGI24737J22298_10012310 JGI24737J22298_100123102 164
136 3300003316 rootH1_10075932 rootH1_100759321 164
137 3300003322 rootL2_10199438 rootL2_101994382 164
138 3300003323 rootH1_10256663 rootH1_102566632 164
139 3300003578 Ga0006562J51391_1042664 Ga0006562J51391_10426645 164
140 3300003578 Ga0006562J51391_1042666 Ga0006562J51391_10426663 164
141 3300003759 Ga0055525_1000055 Ga0055525_100005520 164
142 3300003760 Ga0055527_1000210 Ga0055527_100021014 164
143 3300003761 Ga0055535_1000454 Ga0055535_100045421 164
144 3300003762 Ga0055542_1000468 Ga0055542_100046821 164
145 3300003763 Ga0055529_1000479 Ga0055529_100047914 164
146 3300005262 Ga0065165_1005817 Ga0065165_10058173 164
147 3300005455 Ga0070663_100128248 Ga0070663_1001282483 164
148 3300005547 Ga0070693_100325362 Ga0070693_1003253622 164
149 3300005563 Ga0068855_100042790 Ga0068855_1000427905 164
150 3300005564 Ga0070664_100664193 Ga0070664_1006641932 164
151 3300005577 Ga0068857_100013283 Ga0068857_1000132837 164
152 3300005578 Ga0068854_100002865 Ga0068854_1000028655 164
153 3300005614 Ga0068856_100942343 Ga0068856_1009423432 164
154 3300005616 Ga0068852_100058443 Ga0068852_1000584435 164
155 3300005617 Ga0068859_100373175 Ga0068859_1003731752 164
156 3300005834 Ga0068851_10000908 Ga0068851_100009085 164
157 3300006931 Ga0097620_100373206 Ga0097620_1003732062 164
158 3300009093 Ga0105240_10011172 Ga0105240_100111728 164
159 3300009093 Ga0105240_10032548 Ga0105240_100325486 164
160 3300009093 Ga0105240_10143630 Ga0105240_101436303 164
161 3300009545 Ga0105237_10000084 Ga0105237_1000008488 164
162 3300009553 Ga0105249_10680199 Ga0105249_106801992 164
163 3300010375 Ga0105239_10117030 Ga0105239_101170303 164
164 3300012500 Ga0157314_1000507 Ga0157314_10005075 164
165 3300013105 Ga0157369_10065473 Ga0157369_100654734 164
166 3300013307 Ga0157372_11052393 Ga0157372_110523932 164
167 3300025228 Ga0209672_100004 Ga0209672_1000041144 164
168 3300025230 Ga0209563_100076 Ga0209563_10007621 164
169 3300025242 Ga0209258_100003 Ga0209258_1000031144 164
170 3300025254 Ga0209148_1000025 Ga0209148_1000025448 164
171 3300025258 Ga0209129_1001515 Ga0209129_100151512 164
172 3300025272 Ga0209455_1000004 Ga0209455_10000041144 164
173 3300025297 Ga0209758_1000301 Ga0209758_100030116 164
174 3300025321 Ga0207656_10002307 Ga0207656_100023072 164
175 3300025904 Ga0207647_10002308 Ga0207647_100023088 164
176 3300025913 Ga0207695_10004205 Ga0207695_1000420512 164
177 3300025913 Ga0207695_10058752 Ga0207695_100587526 164
178 3300025913 Ga0207695_10128550 Ga0207695_101285502 164
179 3300025914 Ga0207671_10000011 Ga0207671_10000011383 164
180 3300025949 Ga0207667_10000219 Ga0207667_1000021919 164
181 3300025949 Ga0207667_10000446 Ga0207667_1000044618 164
182 3300025981 Ga0207640_10000280 Ga0207640_1000028015 164
183 3300025981 Ga0207640_10010303 Ga0207640_100103035 164
184 3300026067 Ga0207678_10044550 Ga0207678_100445504 164
185 3300026116 Ga0207674_10001145 Ga0207674_1000114511 164
186 3300026142 Ga0207698_10037112 Ga0207698_100371125 164
187 3300044656 Ga0466969_0039348 Ga0466969_0039348_1352_1852 164
188 3300044672 Ga0466982_0000018 Ga0466982_0000018_62958_63458 164
189 3300044683 Ga0466965_0212617 Ga0466965_0212617_266_766 164
190 3300044684 Ga0466966_0007696 Ga0466966_0007696_1818_2318 164
191 3300044706 Ga0466964_0001814 Ga0466964_0001814_4772_5272 164
192 3300044719 Ga0466971_0054764 Ga0466971_0054764_1080_1580 164
193 3300044735 Ga0466968_0022560 Ga0466968_0022560_1742_2242 164
194 3300044842 Ga0466957_0165434 Ga0466957_0165434_170_670 164
195 3300044842 Ga0466957_0287851 Ga0466957_0287851_390_908 164
196 3300044901 Ga0466960_0022862 Ga0466960_0022862_75_575 164
197 3300045836 Ga0466958_0146021 Ga0466958_0146021_172_672 164
198 3300048924 Ga0496121_0014080 Ga0496121_0014080_5331_5831 164
199 3300048928 Ga0496125_0001450 Ga0496125_0001450_25424_25924 164
200 3300049570 Ga0501033_0000375 Ga0501033_0000375_33335_33844 164
201 3300061719 Ga0466962_0000272 Ga0466962_0000272_18996_19496 164
202 iso_pu_bacteria 2687453130 2687584291 164
203 3300002067 JGI24735J21928_10047970 JGI24735J21928_100479702 165
204 3300005327 Ga0070658_10014704 Ga0070658_100147042 165
205 3300005335 Ga0070666_10000013 Ga0070666_10000013217 165
206 3300005344 Ga0070661_100007367 Ga0070661_1000073679 165
207 3300005347 Ga0070668_100014083 Ga0070668_1000140837 165
208 3300005844 Ga0068862_100453617 Ga0068862_1004536172 165
209 3300009092 Ga0105250_10412687 Ga0105250_104126871 165
210 3300009551 Ga0105238_10000131 Ga0105238_1000013160 165
211 3300013306 Ga0163162_10000221 Ga0163162_1000022135 165
212 3300013308 Ga0157375_11830008 Ga0157375_118300082 165
213 3300014969 Ga0157376_11297484 Ga0157376_112974842 165
214 3300025903 Ga0207680_10000001 Ga0207680_10000001303 165
215 3300025909 Ga0207705_10023786 Ga0207705_100237866 165
216 3300025920 Ga0207649_10006569 Ga0207649_100065698 165
217 3300025924 Ga0207694_10000654 Ga0207694_1000065422 165
218 3300025972 Ga0207668_10008877 Ga0207668_100088777 165
219 3300025986 Ga0207658_10085292 Ga0207658_100852922 165
220 3300028379 Ga0268266_10000075 Ga0268266_1000007544 165
221 3300028381 Ga0268264_11639370 Ga0268264_116393701 165
222 3300044672 Ga0466982_0000096 Ga0466982_0000096_13338_13835 165
223 3300044842 Ga0466957_0002919 Ga0466957_0002919_973_1470 165
224 3300046471 Ga0495650_0000350 Ga0495650_0000350_46613_47110 165
225 3300046507 Ga0495606_0072886 Ga0495606_0072886_651_1148 165
226 3300046660 Ga0495625_0070601 Ga0495625_0070601_1083_1580 165
227 3300048918 Ga0496115_0269589 Ga0496115_0269589_258_755 165
228 3300048928 Ga0496125_0068692 Ga0496125_0068692_15_554 165
229 3300048929 Ga0496126_0009745 Ga0496126_0009745_6090_6587 165
230 3300049569 Ga0501032_0260715 Ga0501032_0260715_216_725 165
231 3300049574 Ga0501038_0497483 Ga0501038_0497483_378_887 165
232 3300049579 Ga0501043_0093171 Ga0501043_0093171_98_607 165
233 3300049581 Ga0501047_0014043 Ga0501047_0014043_141_650 165
234 3300049822 Ga0501035_0111649 Ga0501035_0111649_94_603 165
235 3300049823 Ga0501044_0023396 Ga0501044_0023396_1076_1585 165
236 3300053090 Ga0500646_0028356 Ga0500646_0028356_348_845 165
237 3300002075 JGI24738J21930_10016457 JGI24738J21930_100164571 166
238 3300004625 Ga0055543_1007681 Ga0055543_10076814 166
239 3300005262 Ga0065165_1000108 Ga0065165_100010873 166
240 3300009101 Ga0105247_10002916 Ga0105247_1000291611 166
241 3300010375 Ga0105239_10182761 Ga0105239_101827612 166
242 3300014497 Ga0182008_10006516 Ga0182008_100065168 166
243 3300015261 Ga0182006_1000031 Ga0182006_100003196 166
244 3300015261 Ga0182006_1000496 Ga0182006_100049612 166
245 3300015262 Ga0182007_10003787 Ga0182007_100037877 166
246 3300015262 Ga0182007_10046249 Ga0182007_100462492 166
247 3300015265 Ga0182005_1001001 Ga0182005_10010019 166
248 3300015265 Ga0182005_1002650 Ga0182005_10026507 166
249 3300015685 Ga0183369_1013 Ga0183369_101397 166
250 3300025226 Ga0209674_100785 Ga0209674_10078511 166
251 3300025233 Ga0209437_100782 Ga0209437_10078212 166
252 3300031731 Ga0307405_10666438 Ga0307405_106664382 166
253 3300031911 Ga0307412_10001016 Ga0307412_100010162 166
254 3300041404 Ga0439436_0000032 Ga0439436_0000032_37488_37988 166
255 3300041413 Ga0439465_0010578 Ga0439465_0010578_1022_1522 166
256 3300042128 Ga0450897_030839 Ga0450897_030839_84_584 166
257 3300042184 Ga0450908_000007 Ga0450908_000007_41133_41633 166
258 3300044735 Ga0466968_0001797 Ga0466968_0001797_4355_4855 166
259 3300046460 Ga0495638_0011198 Ga0495638_0011198_2035_2535 166
260 3300046471 Ga0495650_0000869 Ga0495650_0000869_15660_16160 166
261 3300046507 Ga0495606_0053722 Ga0495606_0053722_1083_1583 166
262 3300046512 Ga0495610_0000824 Ga0495610_0000824_27466_27966 166
263 3300046512 Ga0495610_0062706 Ga0495610_0062706_24_524 166
264 3300046518 Ga0495631_0000036 Ga0495631_0000036_46986_47486 166
265 3300046519 Ga0495632_0027070 Ga0495632_0027070_648_1148 166
266 3300046522 Ga0495643_0075534 Ga0495643_0075534_205_705 166
267 3300046616 Ga0495668_0009490 Ga0495668_0009490_189_749 166
268 3300046648 Ga0495611_0000028 Ga0495611_0000028_26133_26633 166
269 3300046660 Ga0495625_0282494 Ga0495625_0282494_193_693 166
270 3300046691 Ga0495670_0005296 Ga0495670_0005296_1035_1535 166
271 3300046694 Ga0495649_0095642 Ga0495649_0095642_34_534 166
272 3300046810 Ga0495660_0004438 Ga0495660_0004438_3774_4334 166
273 3300047469 Ga0495673_0000004 Ga0495673_0000004_580787_581347 166
274 3300047469 Ga0495673_0000041 Ga0495673_0000041_192629_193129 166
275 3300047469 Ga0495673_0079993 Ga0495673_0079993_581_1081 166
276 3300048924 Ga0496121_0000771 Ga0496121_0000771_45252_45812 166
277 3300048924 Ga0496121_0284125 Ga0496121_0284125_36_554 166
278 3300048925 Ga0496122_0019348 Ga0496122_0019348_2875_3375 166
279 3300048926 Ga0496123_0009820 Ga0496123_0009820_7976_8476 166
280 3300049570 Ga0501033_0199236 Ga0501033_0199236_208_726 166
281 3300049580 Ga0501046_0207957 Ga0501046_0207957_442_960 166
282 3300049582 Ga0501048_0029769 Ga0501048_0029769_415_942 166
283 3300049822 Ga0501035_0642210 Ga0501035_0642210_197_715 166
284 3300001904 JGI24736J21556_1001729 JGI24736J21556_10017292 167
285 3300003792 Ga0055540_1053095 Ga0055540_10530951 167
286 3300013104 Ga0157370_10045998 Ga0157370_100459986 167
287 3300013105 Ga0157369_10169698 Ga0157369_101696982 167
288 3300025229 Ga0209147_110118 Ga0209147_1101182 167
289 3300025303 Ga0209051_1007151 Ga0209051_10071516 167
290 3300025904 Ga0207647_10000034 Ga0207647_1000003423 167
291 3300047472 Ga0495686_0000229 Ga0495686_0000229_66545_67105 167
292 3300048905 Ga0496102_0275134 Ga0496102_0275134_982_1509 167
293 3300048909 Ga0496106_0345603 Ga0496106_0345603_422_925 167
294 3300048919 Ga0496116_0064576 Ga0496116_0064576_1014_1517 167
295 3300048920 Ga0496117_0023133 Ga0496117_0023133_2155_2682 167
296 3300048920 Ga0496117_0030912 Ga0496117_0030912_2342_2845 167
297 3300048921 Ga0496118_0002903 Ga0496118_0002903_12447_12950 167
298 3300048921 Ga0496118_0006396 Ga0496118_0006396_4228_4755 167
299 3300048924 Ga0496121_0001298 Ga0496121_0001298_32551_33054 167
300 3300048925 Ga0496122_0102736 Ga0496122_0102736_1346_1849 167
301 3300048926 Ga0496123_0078537 Ga0496123_0078537_35_538 167
302 3300048928 Ga0496125_0008488 Ga0496125_0008488_2169_2672 167
303 3300048929 Ga0496126_0016296 Ga0496126_0016296_1871_2374 167

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04608

PgpA

Phosphatidylglycerophosphatase A

22

163

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hfb-assembly4.cif.gz_D outward-facing conformation of a multidrug resistance mate family transporter of the mop superfamily. 0.4204 11 165
1rfz-assembly1.cif.gz_C structure of protein of unknown function from bacillus stearothermophilus 0.4081 3 164
1rfz-assembly1.cif.gz_C structure of protein of unknown function from bacillus stearothermophilus 0.4015 3 164
6hfb-assembly4.cif.gz_D outward-facing conformation of a multidrug resistance mate family transporter of the mop superfamily. 0.3974 11 165
1rfz-assembly1.cif.gz_D structure of protein of unknown function from bacillus stearothermophilus 0.3649 9 164
ID Description Score Start End Superfamily
af_A4IAG3_1915_2027_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.3791 42 164 1.25.10.10
af_H8W3Z0_1_170_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.3713 35 166 1.20.140.150
af_O02108_146_277_1.20.58.610 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Cdc37, Hsp90 binding domain 0.3695 1 166 1.20.58.610
af_O02108_146_277_1.20.58.610 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Cdc37, Hsp90 binding domain 0.3653 1 166 1.20.58.610
1knzI01 Special;Helix non-globular;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Rotavirus non-structural protein NSP3, N-terminal domain 0.3622 55 136 6.10.280.20
ID Description Score Start End GO Terms
AF-A0A7X5UA05-F1-model_v4 Phosphatidylglycerophosphatase A (EC 3.1.3.27) (Phosphatidylglycerolphosphate phosphatase A) 0.9865 2 167 GO:0005886
GO:0006655
GO:0008962
GO:0009395
GO:0046872
AF-L0GUN8-F1-model_v4 Phosphatidylglycerophosphatase A (EC 3.1.3.27) (Phosphatidylglycerolphosphate phosphatase A) 0.9825 17 166 GO:0005886
GO:0006655
GO:0008962
GO:0009395
GO:0046872
AF-A0A7X5TRP0-F1-model_v4 Phosphatidylglycerophosphatase A (EC 3.1.3.27) (Phosphatidylglycerolphosphate phosphatase A) 0.9807 1 162 GO:0005886
GO:0006655
GO:0008962
GO:0009395
GO:0046872
AF-A0A328P945-F1-model_v4 Phosphatidylglycerophosphatase A (EC 3.1.3.27) (Phosphatidylglycerolphosphate phosphatase A) 0.9806 4 162 GO:0005886
GO:0006655
GO:0008962
GO:0009395
GO:0046872
AF-A0A154QMI7-F1-model_v4 Phosphatidylglycerophosphatase A (EC 3.1.3.27) (Phosphatidylglycerolphosphate phosphatase A) 0.9789 1 167 GO:0005886
GO:0006655
GO:0008962
GO:0009395
GO:0046872

Feature Viewer

pLDDT pTM Quality
89.15 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map