F397182

General Info

Members Datasets Scaffolds Average Seq Length
303 119 606 127

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0027582|Ga0451577_0027582_2518_2958
Length 146
Sequence MAASSCAPSGPDPILTQEFHMYTLAVRREFIARHFLIGGDWGAENFPNSHHYVLELQLTGNRLNSFGYLVDIVDVEKHLDQIVAYYKDQMLNEKPEFNGLNPSIEHFSRILTTTLNERIHDQNITALKVVLWEHASAWASFEIKRN

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
72 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
73 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
74 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
75 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
76 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
77 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
78 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
79 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
80 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
81 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
82 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
83 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
84 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
85 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
86 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
87 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
88 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
89 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
90 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
91 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
92 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
93 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
94 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
95 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
96 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
97 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
101 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
102 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
103 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
104 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
105 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
106 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
107 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
108 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
109 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
111 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
112 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
113 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
114 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
115 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
116 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
117 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
118 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
119 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.33
Rhizosphere 96.37
Stem 0
Stem Tuber 0
Unclassified 29.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0027582 3300042876 Bacteria 5141
2 SwRhRL3b_contig_1381330 2162886006 Bacteria 1397
3 SwRhRL2b_contig_3148256 2162886007 Bacteria 2772
4 SwRhRL2b_contig_3248750 2162886007 Bacteria 2328
5 MBSR1b_contig_7493962 2162886012 Bacteria 987
6 JGI25406J46586_10007141 3300003203 Bacteria 5114
7 rootH2_10263851 3300003320 Bacteria 2743
8 rootH1_10049766 3300003323 Bacteria 24566
9 Ga0065704_10000323 3300005289 Bacteria 40015
10 Ga0065704_10094097 3300005289 Bacteria 2561
11 Ga0065704_10232878 3300005289 Unclassified 1038
12 Ga0065704_10256756 3300005289 Unclassified 975
13 Ga0065715_10329301 3300005293 Bacteria 987
14 Ga0065707_10000508 3300005295 Bacteria 28121
15 Ga0065707_10083604 3300005295 Bacteria 8648
16 Ga0065707_10139365 3300005295 Bacteria 1794
17 Ga0065707_10145463 3300005295 Bacteria 1720
18 Ga0070689_100089048 3300005340 Bacteria 2431
19 Ga0070689_101683075 3300005340 Unclassified 577
20 Ga0070687_100220210 3300005343 Bacteria 1162
21 Ga0070692_10711052 3300005345 Unclassified 677
22 Ga0070667_100622389 3300005367 Unclassified 995
23 Ga0070701_10729942 3300005438 Unclassified 669
24 Ga0070705_101153648 3300005440 Unclassified 636
25 Ga0070694_101461423 3300005444 Unclassified 578
26 Ga0070706_100507699 3300005467 Unclassified 1122
27 Ga0070707_100351427 3300005468 Bacteria 1432
28 Ga0070707_100737715 3300005468 Bacteria 948
29 Ga0070698_100049639 3300005471 Unclassified 4281
30 Ga0070698_100078570 3300005471 Bacteria 3298
31 Ga0070698_100377971 3300005471 Unclassified 1349
32 Ga0070698_100467561 3300005471 Bacteria 1197
33 Ga0070699_100000765 3300005518 Bacteria 29681
34 Ga0070699_100150312 3300005518 Bacteria 2059
35 Ga0070699_100914501 3300005518 Bacteria 804
36 Ga0070697_101275984 3300005536 Bacteria 655
37 Ga0070686_100318167 3300005544 Bacteria 1159
38 Ga0070695_100175382 3300005545 Bacteria 1515
39 Ga0070695_100392558 3300005545 Bacteria 1050
40 Ga0070696_100363529 3300005546 Bacteria 1124
41 Ga0070704_100134952 3300005549 Bacteria 1918
42 Ga0070704_100456502 3300005549 Bacteria 1101
43 Ga0070704_100954336 3300005549 Bacteria 774
44 Ga0070704_101358879 3300005549 Unclassified 651
45 Ga0068857_100265632 3300005577 Bacteria 1576
46 Ga0068857_101360337 3300005577 Unclassified 690
47 Ga0068859_100139138 3300005617 Bacteria 2501
48 Ga0068859_100473632 3300005617 Bacteria 1348
49 Ga0068859_101648850 3300005617 Bacteria 708
50 Ga0068864_100694125 3300005618 Bacteria 994
51 Ga0068864_101629872 3300005618 Bacteria 649
52 Ga0068864_101665819 3300005618 Unclassified 642
53 Ga0068870_10099282 3300005840 Bacteria 1642
54 Ga0068858_100481068 3300005842 Bacteria 1198
55 Ga0068860_102248018 3300005843 Unclassified 566
56 Ga0068862_100045796 3300005844 Bacteria 3733
57 Ga0068862_100674515 3300005844 Unclassified 999
58 Ga0068862_101817692 3300005844 Unclassified 619
59 Ga0081539_10003780 3300005985 Bacteria 17895
60 Ga0075427_10000888 3300006194 Bacteria 3679
61 Ga0075428_100008657 3300006844 Bacteria 11287
62 Ga0075428_100040205 3300006844 Bacteria 5147
63 Ga0075428_100087274 3300006844 Bacteria 3403
64 Ga0075428_101072301 3300006844 Bacteria 851
65 Ga0075428_101381403 3300006844 Bacteria 739
66 Ga0075428_101739322 3300006844 Unclassified 650
67 Ga0075430_100351470 3300006846 Bacteria 1217
68 Ga0075430_100463303 3300006846 Bacteria 1046
69 Ga0075431_100348224 3300006847 Bacteria 1490
70 Ga0075431_100405360 3300006847 Unclassified 1364
71 Ga0075431_100781391 3300006847 Unclassified 929
72 Ga0075433_10195707 3300006852 Bacteria 1798
73 Ga0075433_10571686 3300006852 Unclassified 993
74 Ga0075434_100346016 3300006871 Bacteria 1508
75 Ga0075434_100385619 3300006871 Bacteria 1422
76 Ga0075429_100004833 3300006880 Bacteria 11608
77 Ga0075429_100014914 3300006880 Bacteria 6740
78 Ga0075429_100072337 3300006880 Unclassified 3003
79 Ga0075429_100085167 3300006880 Bacteria 2755
80 Ga0075429_100185349 3300006880 Bacteria 1823
81 Ga0075429_100222297 3300006880 Bacteria 1654
82 Ga0075429_100379493 3300006880 Bacteria 1238
83 Ga0075429_101510834 3300006880 Unclassified 584
84 Ga0097620_100139131 3300006931 Bacteria 2501
85 Ga0097620_100473599 3300006931 Bacteria 1348
86 Ga0097620_101648096 3300006931 Bacteria 708
87 Ga0105240_10706775 3300009093 Bacteria 1100
88 Ga0111539_10681453 3300009094 Unclassified 1197
89 Ga0105245_11059267 3300009098 Unclassified 856
90 Ga0114129_10004393 3300009147 Bacteria 19883
91 Ga0114129_10006821 3300009147 Bacteria 16219
92 Ga0114129_10063541 3300009147 Bacteria 5154
93 Ga0105243_10027209 3300009148 Bacteria 4380
94 Ga0105243_10071716 3300009148 Bacteria 2802
95 Ga0105241_11638251 3300009174 Bacteria 623
96 Ga0105242_10133702 3300009176 Bacteria 2144
97 Ga0105242_10889849 3300009176 Bacteria 889
98 Ga0105237_11049692 3300009545 Unclassified 822
99 Ga0105249_10029833 3300009553 Unclassified 4927
100 Ga0105249_10504766 3300009553 Bacteria 1255
101 Ga0105239_10380871 3300010375 Bacteria 1595
102 Ga0105246_10040979 3300011119 Bacteria 3128
103 Ga0163162_10318102 3300013306 Bacteria 1689
104 Ga0207643_10296018 3300025908 Unclassified 1006
105 Ga0207684_10041731 3300025910 Bacteria 3889
106 Ga0207695_10469955 3300025913 Bacteria 1140
107 Ga0207662_10169762 3300025918 Bacteria 1398
108 Ga0207646_10681622 3300025922 Bacteria 920
109 Ga0207686_10255731 3300025934 Bacteria 1282
110 Ga0207709_10213800 3300025935 Bacteria 1386
111 Ga0207709_10215386 3300025935 Bacteria 1381
112 Ga0207670_10528586 3300025936 Bacteria 961
113 Ga0207670_10932770 3300025936 Bacteria 728
114 Ga0207712_10123558 3300025961 Bacteria 1962
115 Ga0207703_10660216 3300026035 Bacteria 992
116 Ga0207708_10569351 3300026075 Unclassified 957
117 Ga0207648_11390391 3300026089 Bacteria 660
118 Ga0207676_10930781 3300026095 Bacteria 854
119 Ga0207676_11673335 3300026095 Unclassified 634
120 Ga0207676_11919882 3300026095 Unclassified 591
121 Ga0207674_10316090 3300026116 Unclassified 1511
122 Ga0207674_11303759 3300026116 Unclassified 696
123 Ga0209999_1008290 3300027543 Bacteria 1872
124 Ga0268265_10359992 3300028380 Unclassified 1331
125 Ga0268265_10732951 3300028380 Bacteria 958
126 Ga0268265_11594929 3300028380 Unclassified 657
127 Ga0265318_10091997 3300028577 Unclassified 1117
128 Ga0265320_10167353 3300031240 Unclassified 988
129 Ga0316575_10000463 3300031665 Bacteria 11637
130 Ga0316575_10024700 3300031665 Bacteria 2328
131 Ga0316575_10103565 3300031665 Bacteria 1158
132 Ga0316575_10355516 3300031665 Unclassified 624
133 Ga0316579_10084157 3300031691 Unclassified 1517
134 Ga0316579_10292159 3300031691 Unclassified 788
135 Ga0265314_10018379 3300031711 Bacteria 5451
136 Ga0265342_10209559 3300031712 Bacteria 1055
137 Ga0316576_10004137 3300031727 Bacteria 8661
138 Ga0316576_10257110 3300031727 Bacteria 1310
139 Ga0316576_10500649 3300031727 Unclassified 893
140 Ga0316578_10038523 3300031728 Bacteria 2757
141 Ga0316578_10160580 3300031728 Bacteria 1354
142 Ga0316578_10277782 3300031728 Unclassified 1003
143 Ga0316578_10453601 3300031728 Unclassified 757
144 Ga0316578_10844995 3300031728 Unclassified 530
145 Ga0316577_10022678 3300031733 Bacteria 3486
146 Ga0316577_10107529 3300031733 Bacteria 1565
147 Ga0316577_10124242 3300031733 Bacteria 1451
148 Ga0316577_10516070 3300031733 Unclassified 679
149 Ga0307410_12113272 3300031852 Unclassified 504
150 Ga0316583_10000757 3300032133 Bacteria 10120
151 Ga0373928_0213757 3300035084 Unclassified 561
152 Ga0316574_0001168 3300035398 Bacteria 12132
153 Ga0316574_0079915 3300035398 Bacteria 2074
154 Ga0316574_0139585 3300035398 Bacteria 1561
155 Ga0316574_0206918 3300035398 Bacteria 1260
156 Ga0316582_0061029 3300036647 Bacteria 2418
157 Ga0316582_0155273 3300036647 Bacteria 1548
158 Ga0316582_0477447 3300036647 Unclassified 859
159 Ga0316582_0658060 3300036647 Unclassified 720
160 Ga0316582_0748972 3300036647 Unclassified 670
161 Ga0316582_0943846 3300036647 Unclassified 589
162 Ga0316584_0005675 3300036712 Bacteria 8399
163 Ga0316584_0044923 3300036712 Unclassified 3296
164 Ga0316584_0050977 3300036712 Bacteria 3095
165 Ga0316584_0261972 3300036712 Bacteria 1260
166 Ga0316584_0536014 3300036712 Unclassified 819
167 Ga0316584_1110998 3300036712 Unclassified 524
168 Ga0400490_19740 3300038726 Bacteria 2091
169 Ga0400491_28528 3300038727 Unclassified 4281
170 Ga0400485_03829 3300038735 Bacteria 9800
171 Ga0400485_08079 3300038735 Bacteria 8462
172 Ga0400486_26644 3300038742 Bacteria 5310
173 Ga0400486_26832 3300038742 Bacteria 10192
174 Ga0400489_68717 3300039093 Bacteria 25244
175 Ga0400487_27093 3300039110 Bacteria 17813
176 Ga0451791_1324087 3300041451 Unclassified 566
177 Ga0439433_0093847 3300041999 Unclassified 740
178 Ga0451577_0001152 3300042876 Bacteria 37382
179 Ga0451577_0029314 3300042876 Unclassified 4974
180 Ga0451577_0049829 3300042876 Bacteria 3738
181 Ga0451577_0060327 3300042876 Bacteria 3381
182 Ga0451577_0105673 3300042876 Unclassified 2516
183 Ga0451577_0172116 3300042876 Bacteria 1951
184 Ga0451577_0233499 3300042876 Bacteria 1663
185 Ga0451577_0241283 3300042876 Bacteria 1635
186 Ga0451577_0346190 3300042876 Bacteria 1348
187 Ga0451577_0860361 3300042876 Bacteria 817
188 Ga0451577_1002621 3300042876 Unclassified 750
189 Ga0451577_1127646 3300042876 Unclassified 701
190 Ga0451577_1610503 3300042876 Bacteria 573
191 Ga0453683_0006723 3300044673 Bacteria 7862
192 Ga0453683_0007784 3300044673 Bacteria 7246
193 Ga0453683_0019310 3300044673 Bacteria 4367
194 Ga0453683_0021544 3300044673 Bacteria 4114
195 Ga0453683_0040315 3300044673 Bacteria 2933
196 Ga0453683_0056722 3300044673 Unclassified 2451
197 Ga0453683_0174606 3300044673 Unclassified 1361
198 Ga0453683_0196538 3300044673 Unclassified 1280
199 Ga0453683_0320082 3300044673 Bacteria 994
200 Ga0453683_0422083 3300044673 Bacteria 861
201 Ga0453683_0526713 3300044673 Unclassified 768
202 Ga0453684_0000271 3300044712 Bacteria 223654
203 Ga0453684_0000435 3300044712 Bacteria 170233
204 Ga0453684_0000918 3300044712 Bacteria 97926
205 Ga0453684_0002410 3300044712 Bacteria 45577
206 Ga0453684_0002474 3300044712 Bacteria 44668
207 Ga0453684_0006959 3300044712 Bacteria 21165
208 Ga0453684_0015293 3300044712 Bacteria 12163
209 Ga0453684_0037720 3300044712 Bacteria 6628
210 Ga0453684_0043739 3300044712 Bacteria 6012
211 Ga0453684_0072033 3300044712 Unclassified 4365
212 Ga0453684_0074102 3300044712 Bacteria 4288
213 Ga0453684_0085452 3300044712 Unclassified 3920
214 Ga0453684_0089877 3300044712 Bacteria 3796
215 Ga0453684_0096921 3300044712 Bacteria 3621
216 Ga0453684_0098883 3300044712 Bacteria 3575
217 Ga0453684_0120172 3300044712 Bacteria 3174
218 Ga0453684_0137607 3300044712 Bacteria 2921
219 Ga0453684_0151214 3300044712 Bacteria 2758
220 Ga0453684_0215324 3300044712 Bacteria 2229
221 Ga0453684_0241802 3300044712 Unclassified 2078
222 Ga0453684_0276928 3300044712 Bacteria 1915
223 Ga0453684_0313953 3300044712 Unclassified 1777
224 Ga0453684_0337799 3300044712 Bacteria 1702
225 Ga0453684_0366853 3300044712 Bacteria 1620
226 Ga0453684_0424835 3300044712 Bacteria 1484
227 Ga0453684_0435417 3300044712 Bacteria 1462
228 Ga0453684_0496632 3300044712 Bacteria 1352
229 Ga0453684_0532074 3300044712 Bacteria 1297
230 Ga0453684_0571856 3300044712 Unclassified 1242
231 Ga0453684_0584633 3300044712 Bacteria 1226
232 Ga0453684_0691233 3300044712 Viruses 1109
233 Ga0453684_0714159 3300044712 Bacteria 1088
234 Ga0453684_0727075 3300044712 Unclassified 1076
235 Ga0453684_0802388 3300044712 Bacteria 1015
236 Ga0453684_0863002 3300044712 Unclassified 972
237 Ga0453684_1180087 3300044712 Bacteria 805
238 Ga0453684_1252630 3300044712 Unclassified 776
239 Ga0453684_1308131 3300044712 Unclassified 756
240 Ga0453684_2112367 3300044712 Unclassified 565
241 Ga0451576_0000046 3300045051 Bacteria 334064
242 Ga0451576_0008776 3300045051 Bacteria 11825
243 Ga0451576_0008891 3300045051 Bacteria 11722
244 Ga0451576_0061442 3300045051 Unclassified 3917
245 Ga0451576_0234028 3300045051 Unclassified 1918
246 Ga0451576_0281213 3300045051 Bacteria 1740
247 Ga0451576_0536335 3300045051 Bacteria 1229
248 Ga0451576_0714872 3300045051 Bacteria 1052
249 Ga0451576_0739815 3300045051 Bacteria 1033
250 Ga0451576_1127598 3300045051 Bacteria 820
251 Ga0451576_1214533 3300045051 Unclassified 787
252 Ga0451576_1248792 3300045051 Bacteria 775
253 Ga0451576_1342680 3300045051 Bacteria 745
254 Ga0451576_2333857 3300045051 Unclassified 548
255 Ga0501031_0432850 3300049568 Bacteria 850
256 Ga0501040_0341201 3300049576 Bacteria 1073
257 Ga0501041_0077581 3300049577 Unclassified 2044
258 Ga0501041_0708356 3300049577 Unclassified 644
259 Ga0501071_0634732 3300049587 Bacteria 822
260 Ga0501072_1399692 3300049588 Unclassified 541
261 Ga0501074_0286523 3300049590 Bacteria 1171
262 Ga0501074_0449491 3300049590 Unclassified 914
263 Ga0501075_0002677 3300049591 Bacteria 11903
264 Ga0501076_0016371 3300049592 Bacteria 5623
265 Ga0501076_0227210 3300049592 Bacteria 1526
266 Ga0501198_055142 3300049649 Bacteria 716
267 Ga0501230_015140 3300049667 Bacteria 1276
268 Ga0501079_0025535 3300049741 Bacteria 4530
269 Ga0501081_0820607 3300049743 Bacteria 700
270 Ga0501081_1108522 3300049743 Bacteria 599
271 Ga0501081_1415387 3300049743 Unclassified 528
272 Ga0501035_0478979 3300049822 Unclassified 1027
273 Ga0501045_0795051 3300049824 Bacteria 697
274 nmdc:mga05p37_15587_c1 3300050507 Bacteria 9134
275 nmdc:mga05p37_172552_c1 3300050507 Bacteria 2637
276 nmdc:mga05p37_5206_c1 3300050507 Bacteria 15263
277 nmdc:mga05p37_59748_c1 3300050507 Bacteria 4694
278 nmdc:mga05p37_69864_c1 3300050507 Bacteria 4320
279 nmdc:mga05p37_9077_c1 3300050507 Bacteria 11753
280 nmdc:mga09592_1432057_c1 3300050508 Bacteria 564
281 nmdc:mga09592_169572_c1 3300050508 Bacteria 1887
282 nmdc:mga09592_18674_c1 3300050508 Bacteria 5687
283 nmdc:mga09592_1986_c1 3300050508 Bacteria 16501
284 nmdc:mga09592_28033_c1 3300050508 Bacteria 4676
285 nmdc:mga09592_306850_c1 3300050508 Bacteria 1376
286 nmdc:mga09592_804912_c1 3300050508 Unclassified 795
287 nmdc:mga09592_8247_c1 3300050508 Bacteria 8473
288 nmdc:mga0qj67_140742_c1 3300050509 Bacteria 1956
289 nmdc:mga0qj67_710801_c1 3300050509 Bacteria 799
290 nmdc:mga0qj67_72757_c1 3300050509 Bacteria 2745
291 nmdc:mga06r32_125626_c1 3300050510 Bacteria 2533
292 nmdc:mga06r32_1928907_c1 3300050510 Bacteria 525
293 nmdc:mga06r32_36340_c1 3300050510 Bacteria 4653
294 nmdc:mga06r32_499926_c1 3300050510 Unclassified 1193
295 nmdc:mga08y16_304288_c1 3300050511 Bacteria 1643
296 nmdc:mga0n895_307310_c1 3300050512 Bacteria 1607
297 nmdc:mga0n895_581049_c1 3300050512 Bacteria 1124
298 nmdc:mga0a205_600663_c1 3300050515 Bacteria 954
299 Ga0501084_0037162 3300054114 Bacteria 4069
300 Ga0501084_0413709 3300054114 Bacteria 1140
301 Ga0501084_0449331 3300054114 Unclassified 1090
302 Ga0501084_1116329 3300054114 Unclassified 662
303 Ga0501082_0255973 3300060353 Bacteria 1523
304 Ga0451577_0027582
305 SwRhRL3b_contig_1381330
306 SwRhRL2b_contig_3148256
307 SwRhRL2b_contig_3248750
308 MBSR1b_contig_7493962
309 JGI25406J46586_10007141
310 rootH2_10263851
311 rootH1_10049766
312 Ga0065704_10000323
313 Ga0065704_10094097
314 Ga0065704_10232878
315 Ga0065704_10256756
316 Ga0065715_10329301
317 Ga0065707_10000508
318 Ga0065707_10083604
319 Ga0065707_10139365
320 Ga0065707_10145463
321 Ga0070689_100089048
322 Ga0070689_101683075
323 Ga0070687_100220210
324 Ga0070692_10711052
325 Ga0070667_100622389
326 Ga0070701_10729942
327 Ga0070705_101153648
328 Ga0070694_101461423
329 Ga0070706_100507699
330 Ga0070707_100351427
331 Ga0070707_100737715
332 Ga0070698_100049639
333 Ga0070698_100078570
334 Ga0070698_100377971
335 Ga0070698_100467561
336 Ga0070699_100000765
337 Ga0070699_100150312
338 Ga0070699_100914501
339 Ga0070697_101275984
340 Ga0070686_100318167
341 Ga0070695_100175382
342 Ga0070695_100392558
343 Ga0070696_100363529
344 Ga0070704_100134952
345 Ga0070704_100456502
346 Ga0070704_100954336
347 Ga0070704_101358879
348 Ga0068857_100265632
349 Ga0068857_101360337
350 Ga0068859_100139138
351 Ga0068859_100473632
352 Ga0068859_101648850
353 Ga0068864_100694125
354 Ga0068864_101629872
355 Ga0068864_101665819
356 Ga0068870_10099282
357 Ga0068858_100481068
358 Ga0068860_102248018
359 Ga0068862_100045796
360 Ga0068862_100674515
361 Ga0068862_101817692
362 Ga0081539_10003780
363 Ga0075427_10000888
364 Ga0075428_100008657
365 Ga0075428_100040205
366 Ga0075428_100087274
367 Ga0075428_101072301
368 Ga0075428_101381403
369 Ga0075428_101739322
370 Ga0075430_100351470
371 Ga0075430_100463303
372 Ga0075431_100348224
373 Ga0075431_100405360
374 Ga0075431_100781391
375 Ga0075433_10195707
376 Ga0075433_10571686
377 Ga0075434_100346016
378 Ga0075434_100385619
379 Ga0075429_100004833
380 Ga0075429_100014914
381 Ga0075429_100072337
382 Ga0075429_100085167
383 Ga0075429_100185349
384 Ga0075429_100222297
385 Ga0075429_100379493
386 Ga0075429_101510834
387 Ga0097620_100139131
388 Ga0097620_100473599
389 Ga0097620_101648096
390 Ga0105240_10706775
391 Ga0111539_10681453
392 Ga0105245_11059267
393 Ga0114129_10004393
394 Ga0114129_10006821
395 Ga0114129_10063541
396 Ga0105243_10027209
397 Ga0105243_10071716
398 Ga0105241_11638251
399 Ga0105242_10133702
400 Ga0105242_10889849
401 Ga0105237_11049692
402 Ga0105249_10029833
403 Ga0105249_10504766
404 Ga0105239_10380871
405 Ga0105246_10040979
406 Ga0163162_10318102
407 Ga0207643_10296018
408 Ga0207684_10041731
409 Ga0207695_10469955
410 Ga0207662_10169762
411 Ga0207646_10681622
412 Ga0207686_10255731
413 Ga0207709_10213800
414 Ga0207709_10215386
415 Ga0207670_10528586
416 Ga0207670_10932770
417 Ga0207712_10123558
418 Ga0207703_10660216
419 Ga0207708_10569351
420 Ga0207648_11390391
421 Ga0207676_10930781
422 Ga0207676_11673335
423 Ga0207676_11919882
424 Ga0207674_10316090
425 Ga0207674_11303759
426 Ga0209999_1008290
427 Ga0268265_10359992
428 Ga0268265_10732951
429 Ga0268265_11594929
430 Ga0265318_10091997
431 Ga0265320_10167353
432 Ga0316575_10000463
433 Ga0316575_10024700
434 Ga0316575_10103565
435 Ga0316575_10355516
436 Ga0316579_10084157
437 Ga0316579_10292159
438 Ga0265314_10018379
439 Ga0265342_10209559
440 Ga0316576_10004137
441 Ga0316576_10257110
442 Ga0316576_10500649
443 Ga0316578_10038523
444 Ga0316578_10160580
445 Ga0316578_10277782
446 Ga0316578_10453601
447 Ga0316578_10844995
448 Ga0316577_10022678
449 Ga0316577_10107529
450 Ga0316577_10124242
451 Ga0316577_10516070
452 Ga0307410_12113272
453 Ga0316583_10000757
454 Ga0373928_0213757
455 Ga0316574_0001168
456 Ga0316574_0079915
457 Ga0316574_0139585
458 Ga0316574_0206918
459 Ga0316582_0061029
460 Ga0316582_0155273
461 Ga0316582_0477447
462 Ga0316582_0658060
463 Ga0316582_0748972
464 Ga0316582_0943846
465 Ga0316584_0005675
466 Ga0316584_0044923
467 Ga0316584_0050977
468 Ga0316584_0261972
469 Ga0316584_0536014
470 Ga0316584_1110998
471 Ga0400490_19740
472 Ga0400491_28528
473 Ga0400485_03829
474 Ga0400485_08079
475 Ga0400486_26644
476 Ga0400486_26832
477 Ga0400489_68717
478 Ga0400487_27093
479 Ga0451791_1324087
480 Ga0439433_0093847
481 Ga0451577_0001152
482 Ga0451577_0029314
483 Ga0451577_0049829
484 Ga0451577_0060327
485 Ga0451577_0105673
486 Ga0451577_0172116
487 Ga0451577_0233499
488 Ga0451577_0241283
489 Ga0451577_0346190
490 Ga0451577_0860361
491 Ga0451577_1002621
492 Ga0451577_1127646
493 Ga0451577_1610503
494 Ga0453683_0006723
495 Ga0453683_0007784
496 Ga0453683_0019310
497 Ga0453683_0021544
498 Ga0453683_0040315
499 Ga0453683_0056722
500 Ga0453683_0174606
501 Ga0453683_0196538
502 Ga0453683_0320082
503 Ga0453683_0422083
504 Ga0453683_0526713
505 Ga0453684_0000271
506 Ga0453684_0000435
507 Ga0453684_0000918
508 Ga0453684_0002410
509 Ga0453684_0002474
510 Ga0453684_0006959
511 Ga0453684_0015293
512 Ga0453684_0037720
513 Ga0453684_0043739
514 Ga0453684_0072033
515 Ga0453684_0074102
516 Ga0453684_0085452
517 Ga0453684_0089877
518 Ga0453684_0096921
519 Ga0453684_0098883
520 Ga0453684_0120172
521 Ga0453684_0137607
522 Ga0453684_0151214
523 Ga0453684_0215324
524 Ga0453684_0241802
525 Ga0453684_0276928
526 Ga0453684_0313953
527 Ga0453684_0337799
528 Ga0453684_0366853
529 Ga0453684_0424835
530 Ga0453684_0435417
531 Ga0453684_0496632
532 Ga0453684_0532074
533 Ga0453684_0571856
534 Ga0453684_0584633
535 Ga0453684_0691233
536 Ga0453684_0714159
537 Ga0453684_0727075
538 Ga0453684_0802388
539 Ga0453684_0863002
540 Ga0453684_1180087
541 Ga0453684_1252630
542 Ga0453684_1308131
543 Ga0453684_2112367
544 Ga0451576_0000046
545 Ga0451576_0008776
546 Ga0451576_0008891
547 Ga0451576_0061442
548 Ga0451576_0234028
549 Ga0451576_0281213
550 Ga0451576_0536335
551 Ga0451576_0714872
552 Ga0451576_0739815
553 Ga0451576_1127598
554 Ga0451576_1214533
555 Ga0451576_1248792
556 Ga0451576_1342680
557 Ga0451576_2333857
558 Ga0501031_0432850
559 Ga0501040_0341201
560 Ga0501041_0077581
561 Ga0501041_0708356
562 Ga0501071_0634732
563 Ga0501072_1399692
564 Ga0501074_0286523
565 Ga0501074_0449491
566 Ga0501075_0002677
567 Ga0501076_0016371
568 Ga0501076_0227210
569 Ga0501198_055142
570 Ga0501230_015140
571 Ga0501079_0025535
572 Ga0501081_0820607
573 Ga0501081_1108522
574 Ga0501081_1415387
575 Ga0501035_0478979
576 Ga0501045_0795051
577 nmdc:mga05p37_15587_c1
578 nmdc:mga05p37_172552_c1
579 nmdc:mga05p37_5206_c1
580 nmdc:mga05p37_59748_c1
581 nmdc:mga05p37_69864_c1
582 nmdc:mga05p37_9077_c1
583 nmdc:mga09592_1432057_c1
584 nmdc:mga09592_169572_c1
585 nmdc:mga09592_18674_c1
586 nmdc:mga09592_1986_c1
587 nmdc:mga09592_28033_c1
588 nmdc:mga09592_306850_c1
589 nmdc:mga09592_804912_c1
590 nmdc:mga09592_8247_c1
591 nmdc:mga0qj67_140742_c1
592 nmdc:mga0qj67_710801_c1
593 nmdc:mga0qj67_72757_c1
594 nmdc:mga06r32_125626_c1
595 nmdc:mga06r32_1928907_c1
596 nmdc:mga06r32_36340_c1
597 nmdc:mga06r32_499926_c1
598 nmdc:mga08y16_304288_c1
599 nmdc:mga0n895_307310_c1
600 nmdc:mga0n895_581049_c1
601 nmdc:mga0a205_600663_c1
602 Ga0501084_0037162
603 Ga0501084_0413709
604 Ga0501084_0449331
605 Ga0501084_1116329
606 Ga0501082_0255973

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01242

PTPS

6-pyruvoyl tetrahydropterin synthase

23

144

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d7j-assembly1.cif.gz_D sco6650, a 6-pyruvoyltetrahydropterin synthase homolog from streptomyces coelicolor 0.9249 2 125
3d7j-assembly1.cif.gz_D sco6650, a 6-pyruvoyltetrahydropterin synthase homolog from streptomyces coelicolor 0.911 2 125
4ntm-assembly1.cif.gz_C qued soaked with sepiapterin (selenomethionine substituted protein) 0.9035 1 121
4ntm-assembly1.cif.gz_C qued soaked with sepiapterin (selenomethionine substituted protein) 0.8889 1 121
2dtt-assembly1.cif.gz_A crystal structure of 6-pyruvoyl tetrahydrobiopterin synthase from pyrococcus horikoshii ot3 complexed with (1'r,2's)-biopterin 0.8832 2 125
ID Description Score Start End Superfamily
3d7jC00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.923 2 125 3.30.479.10
3d7jC00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9091 2 125 3.30.479.10
4ntmA00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.8697 1 123 3.30.479.10
4ntmA00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.8624 1 123 3.30.479.10
af_Q2G1X5_11_135_3.30.479.10 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.8444 2 123 3.30.479.10
ID Description Score Start End GO Terms
AF-A0A6N6L4Y1-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9932 1 125 GO:0046872
GO:0070497
AF-A0A7C4QFN2-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9932 2 125 GO:0046872
GO:0070497
AF-A0A0S8FQ22-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9917 1 125 GO:0070497
AF-A0A1J4S240-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9917 41 125 GO:0070497
AF-A0A523E6G9-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9863 2 125 GO:0046872
GO:0070497

Map