F397180

General Info

Members Datasets Scaffolds Average Seq Length
303 192 280 201

Family's Representative Sequence

Representative Sequence 3300042461|Ga0439460_0025209|Ga0439460_0025209_102_827
Length 241
Sequence VGGAGDVALNVAVIGPPGAGKGTQAERFARDHRIPKISTGDILREAVHADTPLGRQVSAVLNRGQLVSDDLMIGIVNERLARPDAARGFVLDGFPRTVPQASALDEMLAARGPLIVVEIHVPDDELVRRVRSRRICKNCGRMVSAFRGEASPAARCENCGGELVPRPDDGESVVRDRLQVYWNETKPVVDFYRARPTYRVVNGAQAPERVREAMVAAVASALGKPAAELAPTNVAQPGSNA

Samples

Sample ID Description Type Environment
1 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
2 2643221616 Leifsonia sp. Root227 Isolate Unclassified
3 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
4 2643221649 Leifsonia sp. Root4 Isolate Unclassified
5 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
6 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
7 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
8 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
9 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
10 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
11 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
12 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
13 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
14 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
15 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
16 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
17 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
18 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
19 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
20 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
21 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
22 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
23 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
24 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
25 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
26 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
27 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
28 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
29 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
32 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
69 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
72 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
105 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
106 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
107 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
108 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
109 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
110 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
123 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
124 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
125 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
126 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
127 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
128 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
129 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
130 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
131 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
132 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
133 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
134 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
135 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
136 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
137 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
138 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
139 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
140 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
141 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
142 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
143 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
144 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
145 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
146 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
147 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
148 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
149 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
152 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
153 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
162 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
163 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
164 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
165 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
166 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
167 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
168 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
169 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
182 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
183 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
184 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
186 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
187 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
188 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
189 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
190 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
191 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
192 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.77
Metatranscriptomes 2.64
Isolates 7.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.27
Nodule 0
Rhizoplane 7.26
Rhizosphere 75.58
Stem 0
Stem Tuber 0
Unclassified 10.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10051492 3300001979 Bacteria 1178
2 Ga0055539_1000808 3300003752 Bacteria 7414
3 Ga0055533_1000001 3300003756 Bacteria 1863437
4 Ga0055525_1001846 3300003759 Bacteria 2855
5 Ga0055541_1005771 3300003841 Bacteria 2145
6 Ga0065714_10101761 3300005288 Bacteria 1636
7 Ga0065714_10116072 3300005288 Bacteria 1406
8 Ga0070658_10118077 3300005327 Bacteria 2202
9 Ga0070658_10206547 3300005327 Bacteria 1658
10 Ga0070658_10588036 3300005327 Bacteria 964
11 Ga0070690_100418729 3300005330 Bacteria 987
12 Ga0070682_100133859 3300005337 Bacteria 1681
13 Ga0068868_100239019 3300005338 Bacteria 1525
14 Ga0070660_100843721 3300005339 Bacteria 771
15 Ga0070671_100068328 3300005355 Bacteria 2964
16 Ga0070659_100079531 3300005366 Bacteria 2617
17 Ga0070667_100232726 3300005367 Bacteria 1643
18 Ga0070685_10011901 3300005466 Bacteria 4563
19 Ga0068853_100329446 3300005539 Bacteria 1417
20 Ga0068853_101173055 3300005539 Bacteria 741
21 Ga0070672_100090953 3300005543 Bacteria 2462
22 Ga0070693_100452591 3300005547 Bacteria 901
23 Ga0068855_100470608 3300005563 Unclassified 1369
24 Ga0068855_100517692 3300005563 Bacteria 1294
25 Ga0068855_100657970 3300005563 Bacteria 1124
26 Ga0068857_100055804 3300005577 Bacteria 3505
27 Ga0068857_100322682 3300005577 Bacteria 1426
28 Ga0068856_100542209 3300005614 Bacteria 1184
29 Ga0068856_100963288 3300005614 Bacteria 872
30 Ga0068852_100154070 3300005616 Bacteria 2139
31 Ga0068852_101080061 3300005616 Bacteria 822
32 Ga0068851_10000022 3300005834 Bacteria 129607
33 Ga0068858_100001116 3300005842 Bacteria 27809
34 Ga0105244_10026174 3300009036 Bacteria 3159
35 Ga0105240_10055263 3300009093 Bacteria 4971
36 Ga0105240_10270621 3300009093 Bacteria 1956
37 Ga0105245_10612133 3300009098 Bacteria 1117
38 Ga0105247_10172684 3300009101 Bacteria 1438
39 Ga0105243_10017603 3300009148 Bacteria 5405
40 Ga0105241_10025397 3300009174 Bacteria 4402
41 Ga0105248_10052980 3300009177 Bacteria 4553
42 Ga0105248_10094518 3300009177 Bacteria 3366
43 Ga0105237_10027352 3300009545 Bacteria 5823
44 Ga0105237_10207255 3300009545 Bacteria 1961
45 Ga0105237_11104558 3300009545 Bacteria 800
46 Ga0105238_10164693 3300009551 Bacteria 2193
47 Ga0105238_10483062 3300009551 Bacteria 1238
48 Ga0105238_10503327 3300009551 Bacteria 1212
49 Ga0105238_11080400 3300009551 Bacteria 825
50 Ga0105239_10527559 3300010375 Bacteria 1344
51 Ga0105239_11580471 3300010375 Bacteria 758
52 Ga0105239_12132916 3300010375 Bacteria 651
53 Ga0105246_10002007 3300011119 Bacteria 12291
54 Ga0157371_10522428 3300013102 Bacteria 878
55 Ga0157370_10090732 3300013104 Bacteria 2869
56 Ga0157370_10413505 3300013104 Bacteria 1241
57 Ga0157369_10083117 3300013105 Bacteria 3425
58 Ga0157369_10116153 3300013105 Bacteria 2842
59 Ga0157369_10160938 3300013105 Bacteria 2370
60 Ga0157369_10394338 3300013105 Bacteria 1436
61 Ga0157374_10117524 3300013296 Bacteria 2563
62 Ga0157374_10328251 3300013296 Bacteria 1517
63 Ga0157372_10277178 3300013307 Bacteria 1950
64 Ga0157372_10871979 3300013307 Bacteria 1045
65 Ga0163163_10351284 3300014325 Bacteria 1531
66 Ga0157379_10016521 3300014968 Bacteria 6492
67 Ga0197907_10503275 3300020069 Unclassified 1392
68 Ga0206356_11214626 3300020070 Bacteria 1141
69 Ga0206356_11309167 3300020070 Bacteria 4585
70 Ga0206355_1087961 3300020076 Bacteria 1354
71 Ga0206350_10397450 3300020080 Bacteria 1779
72 Ga0206350_11497008 3300020080 Bacteria 6463
73 Ga0206353_10187049 3300020082 Bacteria 1806
74 Ga0206353_11205565 3300020082 Bacteria 1251
75 Ga0213876_10256912 3300021384 Unclassified 928
76 Ga0209566_100066 3300025225 Bacteria 186951
77 Ga0209674_100001 3300025226 Bacteria 4013750
78 Ga0209563_100001 3300025230 Bacteria 4013775
79 Ga0209563_109997 3300025230 Bacteria 1410
80 Ga0209677_100001 3300025253 Bacteria 4013787
81 Ga0209677_102161 3300025253 Bacteria 7674
82 Ga0209148_1002588 3300025254 Bacteria 5970
83 Ga0209455_1003952 3300025272 Bacteria 5035
84 Ga0207656_10000005 3300025321 Bacteria 490514
85 Ga0207655_1000386 3300025728 Bacteria 61740
86 Ga0207692_10367626 3300025898 Bacteria 890
87 Ga0207710_10070776 3300025900 Bacteria 1599
88 Ga0207647_10028990 3300025904 Bacteria 3588
89 Ga0207705_10005785 3300025909 Bacteria 9214
90 Ga0207705_10034982 3300025909 Bacteria 3594
91 Ga0207705_10435029 3300025909 Bacteria 1016
92 Ga0207654_10000001 3300025911 Bacteria 1816198
93 Ga0207654_10307076 3300025911 Bacteria 1081
94 Ga0207695_10013731 3300025913 Bacteria 9637
95 Ga0207695_10081594 3300025913 Bacteria 3272
96 Ga0207695_10231820 3300025913 Bacteria 1750
97 Ga0207671_10000016 3300025914 Bacteria 435413
98 Ga0207671_10242614 3300025914 Bacteria 1415
99 Ga0207657_10005997 3300025919 Bacteria 12644
100 Ga0207694_10000057 3300025924 Bacteria 146441
101 Ga0207694_10456787 3300025924 Bacteria 1067
102 Ga0207694_10630589 3300025924 Bacteria 902
103 Ga0207687_10061516 3300025927 Bacteria 2652
104 Ga0207644_10296308 3300025931 Bacteria 1302
105 Ga0207690_10000329 3300025932 Bacteria 31684
106 Ga0207709_10010829 3300025935 Bacteria 5023
107 Ga0207709_10389649 3300025935 Bacteria 1062
108 Ga0207691_10090205 3300025940 Bacteria 2748
109 Ga0207711_10018074 3300025941 Bacteria 5862
110 Ga0207711_10380922 3300025941 Bacteria 1309
111 Ga0207667_10028406 3300025949 Bacteria 6076
112 Ga0207667_10230161 3300025949 Bacteria 1898
113 Ga0207658_10110808 3300025986 Bacteria 2169
114 Ga0207677_10030685 3300026023 Bacteria 3434
115 Ga0207677_10086414 3300026023 Bacteria 2267
116 Ga0207703_10001453 3300026035 Bacteria 21613
117 Ga0207639_10194414 3300026041 Bacteria 1735
118 Ga0207639_10213660 3300026041 Bacteria 1662
119 Ga0207702_10269240 3300026078 Bacteria 1606
120 Ga0207641_10311261 3300026088 Bacteria 1490
121 Ga0207676_10015408 3300026095 Bacteria 5514
122 Ga0207698_10131841 3300026142 Bacteria 2137
123 Ga0207698_10333325 3300026142 Bacteria 1426
124 Ga0207698_10976140 3300026142 Bacteria 857
125 Ga0307408_100069303 3300031548 Bacteria 2600
126 Ga0307514_10106689 3300031649 Bacteria 1996
127 Ga0307405_10046840 3300031731 Bacteria 2659
128 Ga0307405_10107019 3300031731 Bacteria 1887
129 Ga0307405_10111109 3300031731 Bacteria 1857
130 Ga0307413_10049815 3300031824 Bacteria 2512
131 Ga0307413_10197089 3300031824 Bacteria 1451
132 Ga0307413_10522175 3300031824 Bacteria 958
133 Ga0307410_10031490 3300031852 Bacteria 3404
134 Ga0307410_10063513 3300031852 Bacteria 2533
135 Ga0307410_10097955 3300031852 Bacteria 2096
136 Ga0307410_10254276 3300031852 Bacteria 1367
137 Ga0307410_10342209 3300031852 Bacteria 1193
138 Ga0307406_10066681 3300031901 Bacteria 2344
139 Ga0307406_10084562 3300031901 Bacteria 2119
140 Ga0307406_10457564 3300031901 Bacteria 1025
141 Ga0307406_10698219 3300031901 Bacteria 847
142 Ga0307406_10807649 3300031901 Bacteria 792
143 Ga0307407_10038847 3300031903 Bacteria 2641
144 Ga0307407_10074187 3300031903 Bacteria 2035
145 Ga0307407_10252362 3300031903 Bacteria 1209
146 Ga0307407_10380336 3300031903 Bacteria 1008
147 Ga0307407_10395137 3300031903 Bacteria 990
148 Ga0307412_10042269 3300031911 Bacteria 2960
149 Ga0307412_10125069 3300031911 Bacteria 1858
150 Ga0307412_10227420 3300031911 Bacteria 1434
151 Ga0307412_10260555 3300031911 Bacteria 1351
152 Ga0307412_10269084 3300031911 Bacteria 1332
153 Ga0307412_10425800 3300031911 Bacteria 1087
154 Ga0307412_10646815 3300031911 Bacteria 901
155 Ga0307409_100005722 3300031995 Bacteria 7205
156 Ga0307409_100117221 3300031995 Bacteria 2247
157 Ga0307409_100144718 3300031995 Bacteria 2053
158 Ga0307409_100538724 3300031995 Bacteria 1144
159 Ga0307416_100054566 3300032002 Bacteria 3213
160 Ga0307416_100169901 3300032002 Bacteria 2028
161 Ga0307416_100217653 3300032002 Bacteria 1828
162 Ga0307416_100571484 3300032002 Bacteria 1206
163 Ga0307414_10067984 3300032004 Bacteria 2555
164 Ga0307411_10576228 3300032005 Bacteria 964
165 Ga0307415_100015937 3300032126 Bacteria 4464
166 Ga0307415_100053225 3300032126 Bacteria 2757
167 Ga0373925_0711734 3300037068 Bacteria 828
168 Ga0395899_0043105 3300037312 Bacteria 3366
169 Ga0395899_0047194 3300037312 Bacteria 3207
170 Ga0395900_0061899 3300037418 Bacteria 3847
171 Ga0395900_0101088 3300037418 Bacteria 2961
172 Ga0395900_0126712 3300037418 Bacteria 2619
173 Ga0395898_0000381 3300037466 Bacteria 97274
174 Ga0395898_0023120 3300037466 Bacteria 6285
175 Ga0395898_0047876 3300037466 Bacteria 4193
176 Ga0395901_0082768 3300038443 Bacteria 3353
177 Ga0395901_0153740 3300038443 Bacteria 2416
178 Ga0436365_1436184 3300039437 Bacteria 5972
179 Ga0439436_0010849 3300041404 Bacteria 2775
180 Ga0439436_0027153 3300041404 Bacteria 1676
181 Ga0439438_066177 3300041405 Bacteria 899
182 Ga0439439_0059259 3300041406 Bacteria 1014
183 Ga0439447_047536 3300041407 Bacteria 1031
184 Ga0451789_1130871 3300041443 Bacteria 768
185 Ga0451793_1912529 3300041452 Bacteria 1260
186 Ga0439442_000191 3300042002 Bacteria 15596
187 Ga0439442_004990 3300042002 Bacteria 2648
188 Ga0439449_0177152 3300042007 Bacteria 797
189 Ga0439457_025548 3300042014 Bacteria 1307
190 Ga0450911_017832 3300042115 Bacteria 933
191 Ga0450920_000997 3300042122 Bacteria 4633
192 Ga0450920_032923 3300042122 Bacteria 1024
193 Ga0450907_000443 3300042146 Bacteria 12009
194 Ga0450909_048010 3300042185 Bacteria 664
195 Ga0439434_0001494 3300042435 Bacteria 6722
196 Ga0439460_0025209 3300042461 Bacteria 1654
197 Ga0450918_009768 3300042531 Bacteria 1678
198 Ga0466969_0065278 3300044656 Bacteria 1760
199 Ga0466972_0005615 3300044658 Bacteria 6284
200 Ga0466972_0231586 3300044658 Bacteria 864
201 Ga0466965_0006167 3300044683 Bacteria 5423
202 Ga0466965_0086320 3300044683 Bacteria 1592
203 Ga0466965_0119157 3300044683 Bacteria 1362
204 Ga0466966_0010977 3300044684 Bacteria 6011
205 Ga0466961_0037059 3300044693 Bacteria 3130
206 Ga0466961_0420082 3300044693 Bacteria 810
207 Ga0466971_0033506 3300044719 Bacteria 2302
208 Ga0466968_0049508 3300044735 Bacteria 1790
209 Ga0466970_0011934 3300044765 Bacteria 4434
210 Ga0466960_0009426 3300044901 Bacteria 4024
211 Ga0466960_0071660 3300044901 Bacteria 1726
212 Ga0466959_0039513 3300045049 Bacteria 3486
213 Ga0466959_0108901 3300045049 Bacteria 1978
214 Ga0466958_0018252 3300045836 Bacteria 4068
215 Ga0466967_1408682 3300045976 Bacteria 694
216 Ga0495686_0225367 3300047472 Bacteria 1064
217 Ga0496100_0049474 3300048903 Bacteria 2719
218 Ga0496100_0065174 3300048903 Bacteria 2412
219 Ga0496101_0006142 3300048904 Bacteria 7710
220 Ga0496101_0043034 3300048904 Bacteria 3225
221 Ga0496102_0054704 3300048905 Bacteria 3640
222 Ga0496102_0146097 3300048905 Bacteria 2220
223 Ga0496102_0357896 3300048905 Bacteria 1374
224 Ga0496103_0197804 3300048906 Bacteria 1292
225 Ga0496103_0251925 3300048906 Bacteria 1136
226 Ga0496104_0125224 3300048907 Bacteria 2467
227 Ga0496104_0794723 3300048907 Bacteria 852
228 Ga0496105_0353374 3300048908 Bacteria 1173
229 Ga0496112_0254272 3300048915 Bacteria 1707
230 Ga0496113_0084205 3300048916 Bacteria 2441
231 Ga0496113_0245126 3300048916 Bacteria 1430
232 Ga0496114_0004840 3300048917 Bacteria 10491
233 Ga0496114_0062991 3300048917 Bacteria 3104
234 Ga0496115_0000847 3300048918 Bacteria 22314
235 Ga0496115_0021807 3300048918 Bacteria 4951
236 Ga0496115_0049042 3300048918 Bacteria 3379
237 Ga0496117_0170449 3300048920 Bacteria 1264
238 Ga0496118_0005764 3300048921 Bacteria 13915
239 Ga0496118_0221872 3300048921 Bacteria 1099
240 Ga0496118_0271374 3300048921 Bacteria 950
241 Ga0496119_0012846 3300048922 Bacteria 6753
242 Ga0496119_0026752 3300048922 Bacteria 3989
243 Ga0496119_0200990 3300048922 Bacteria 1031
244 Ga0496120_0004152 3300048923 Bacteria 12451
245 Ga0496120_0030182 3300048923 Bacteria 3300
246 Ga0496120_0035091 3300048923 Bacteria 2999
247 Ga0496120_0072478 3300048923 Bacteria 1887
248 Ga0496120_0111370 3300048923 Bacteria 1430
249 Ga0496121_0272397 3300048924 Bacteria 1163
250 Ga0496125_0132034 3300048928 Bacteria 1756
251 Ga0496126_0090337 3300048929 Bacteria 2695
252 Ga0496126_0258487 3300048929 Bacteria 1449
253 Ga0501031_0002050 3300049568 Bacteria 12672
254 Ga0501032_0000470 3300049569 Bacteria 32512
255 Ga0501032_0014751 3300049569 Bacteria 5530
256 Ga0501033_0002214 3300049570 Bacteria 16754
257 Ga0501034_0000066 3300049571 Bacteria 184727
258 Ga0501034_0011202 3300049571 Bacteria 9310
259 Ga0501036_0005365 3300049572 Bacteria 10380
260 Ga0501037_0001422 3300049573 Bacteria 17565
261 Ga0501037_0029355 3300049573 Bacteria 4063
262 Ga0501038_0003511 3300049574 Bacteria 14597
263 Ga0501039_0021748 3300049575 Bacteria 4921
264 Ga0501043_0007553 3300049579 Bacteria 8624
265 Ga0501046_0003203 3300049580 Bacteria 15062
266 Ga0501047_0016213 3300049581 Bacteria 7109
267 Ga0501048_0026066 3300049582 Bacteria 4258
268 Ga0501068_0123838 3300049584 Bacteria 1613
269 Ga0501070_0007064 3300049586 Bacteria 9552
270 Ga0501073_0045898 3300049589 Bacteria 3076
271 Ga0501035_0037104 3300049822 Bacteria 4414
272 Ga0501044_0001531 3300049823 Bacteria 27116
273 Ga0500635_0061528 3300053080 Bacteria 1311
274 Ga0500651_0000251 3300053093 Bacteria 32614
275 Ga0500559_0000164 3300053136 Bacteria 52626
276 Ga0500559_0019464 3300053136 Bacteria 2868
277 Ga0500573_0200488 3300053140 Bacteria 1059
278 Ga0500577_0027692 3300053142 Bacteria 1944
279 Ga0500590_003646 3300053148 Bacteria 7148
280 Ga0466962_0044293 3300061719 Bacteria 2128

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037418 Ga0395900_0126712 Ga0395900_0126712_542_1171 184
2 3300037466 Ga0395898_0047876 Ga0395898_0047876_1234_1863 184
3 3300038443 Ga0395901_0082768 Ga0395901_0082768_1516_2145 184
4 3300037312 Ga0395899_0043105 Ga0395899_0043105_2445_3098 186
5 3300037418 Ga0395900_0101088 Ga0395900_0101088_448_1101 186
6 3300037466 Ga0395898_0023120 Ga0395898_0023120_2391_3044 186
7 iso_pu_bacteria 2848551377 2848553246 186
8 3300005563 Ga0068855_100470608 Ga0068855_1004706082 187
9 3300020069 Ga0197907_10503275 Ga0197907_105032752 187
10 3300020070 Ga0206356_11309167 Ga0206356_113091677 187
11 3300020080 Ga0206350_11497008 Ga0206350_1149700810 187
12 3300021384 Ga0213876_10256912 Ga0213876_102569121 187
13 3300039437 Ga0436365_1436184 Ga0436365_1436184_1612_2262 187
14 3300048918 Ga0496115_0000847 Ga0496115_0000847_13434_14090 187
15 iso_pu_bacteria 2945941187 2945941614 188
16 3300011119 Ga0105246_10002007 Ga0105246_100020075 189
17 3300031731 Ga0307405_10107019 Ga0307405_101070191 189
18 3300031824 Ga0307413_10197089 Ga0307413_101970892 189
19 3300031852 Ga0307410_10031490 Ga0307410_100314903 189
20 3300031903 Ga0307407_10395137 Ga0307407_103951372 189
21 3300031911 Ga0307412_10260555 Ga0307412_102605552 189
22 3300032005 Ga0307411_10576228 Ga0307411_105762281 189
23 3300041404 Ga0439436_0010849 Ga0439436_0010849_2030_2608 189
24 3300041404 Ga0439436_0027153 Ga0439436_0027153_358_936 189
25 3300041405 Ga0439438_066177 Ga0439438_066177_124_702 189
26 3300041406 Ga0439439_0059259 Ga0439439_0059259_217_795 189
27 3300041407 Ga0439447_047536 Ga0439447_047536_438_1016 189
28 3300042002 Ga0439442_000191 Ga0439442_000191_13465_14043 189
29 3300042002 Ga0439442_004990 Ga0439442_004990_903_1553 189
30 3300042007 Ga0439449_0177152 Ga0439449_0177152_169_747 189
31 3300042014 Ga0439457_025548 Ga0439457_025548_603_1181 189
32 3300042115 Ga0450911_017832 Ga0450911_017832_112_690 189
33 3300042122 Ga0450920_000997 Ga0450920_000997_2436_3014 189
34 3300042122 Ga0450920_032923 Ga0450920_032923_57_707 189
35 3300042146 Ga0450907_000443 Ga0450907_000443_1443_2021 189
36 3300042185 Ga0450909_048010 Ga0450909_048010_70_648 189
37 3300042435 Ga0439434_0001494 Ga0439434_0001494_3403_3981 189
38 3300042531 Ga0450918_009768 Ga0450918_009768_764_1342 189
39 3300049569 Ga0501032_0000470 Ga0501032_0000470_21301_21921 189
40 3300049571 Ga0501034_0000066 Ga0501034_0000066_147483_148103 189
41 3300037068 Ga0373925_0711734 Ga0373925_0711734_162_740 190
42 3300009036 Ga0105244_10026174 Ga0105244_100261742 191
43 3300009148 Ga0105243_10017603 Ga0105243_100176033 191
44 3300025728 Ga0207655_1000386 Ga0207655_100038619 191
45 3300025935 Ga0207709_10010829 Ga0207709_100108294 191
46 iso_pu_bacteria 2643221632 2644182411 191
47 3300031911 Ga0307412_10125069 Ga0307412_101250692 192
48 iso_pu_bacteria 2939598168 2939601956 192
49 3300005288 Ga0065714_10101761 Ga0065714_101017612 193
50 3300013105 Ga0157369_10083117 Ga0157369_100831172 193
51 3300020082 Ga0206353_11205565 Ga0206353_112055652 193
52 3300025935 Ga0207709_10389649 Ga0207709_103896492 193
53 3300031901 Ga0307406_10698219 Ga0307406_106982191 193
54 3300031911 Ga0307412_10646815 Ga0307412_106468151 193
55 3300031995 Ga0307409_100538724 Ga0307409_1005387242 193
56 3300041443 Ga0451789_1130871 Ga0451789_1130871_127_717 193
57 3300053136 Ga0500559_0019464 Ga0500559_0019464_1119_1709 193
58 3300053140 Ga0500573_0200488 Ga0500573_0200488_445_1035 193
59 iso_pu_bacteria 2690315906 2691515356 193
60 iso_pu_bacteria 2775506735 2775658190 193
61 iso_pu_bacteria 2808606357 2808828547 193
62 iso_pu_bacteria 2808606360 2808849792 193
63 iso_pu_bacteria 2808606366 2808877617 193
64 iso_pu_bacteria 2808606370 2808892761 193
65 iso_pu_bacteria 2808606371 2808899074 193
66 iso_pu_bacteria 2811994871 2812319747 193
67 iso_pu_bacteria 2945916053 2945917493 193
68 iso_pu_bacteria 2945920336 2945922218 193
69 iso_pu_bacteria 2946037020 2946037521 193
70 iso_pu_bacteria 2946059875 2946061318 193
71 iso_pu_bacteria 2953998280 2953998790 193
72 3300013105 Ga0157369_10160938 Ga0157369_101609382 194
73 3300013105 Ga0157369_10394338 Ga0157369_103943381 194
74 3300031548 Ga0307408_100069303 Ga0307408_1000693032 194
75 3300031731 Ga0307405_10046840 Ga0307405_100468402 194
76 3300031731 Ga0307405_10111109 Ga0307405_101111092 194
77 3300031824 Ga0307413_10049815 Ga0307413_100498151 194
78 3300031852 Ga0307410_10063513 Ga0307410_100635133 194
79 3300031852 Ga0307410_10097955 Ga0307410_100979552 194
80 3300031852 Ga0307410_10254276 Ga0307410_102542762 194
81 3300031852 Ga0307410_10342209 Ga0307410_103422091 194
82 3300031901 Ga0307406_10066681 Ga0307406_100666812 194
83 3300031901 Ga0307406_10084562 Ga0307406_100845622 194
84 3300031901 Ga0307406_10457564 Ga0307406_104575642 194
85 3300031901 Ga0307406_10807649 Ga0307406_108076492 194
86 3300031903 Ga0307407_10038847 Ga0307407_100388473 194
87 3300031903 Ga0307407_10074187 Ga0307407_100741872 194
88 3300031903 Ga0307407_10252362 Ga0307407_102523622 194
89 3300031903 Ga0307407_10380336 Ga0307407_103803362 194
90 3300031911 Ga0307412_10042269 Ga0307412_100422693 194
91 3300031911 Ga0307412_10227420 Ga0307412_102274201 194
92 3300031911 Ga0307412_10269084 Ga0307412_102690841 194
93 3300031911 Ga0307412_10425800 Ga0307412_104258001 194
94 3300031995 Ga0307409_100005722 Ga0307409_1000057227 194
95 3300031995 Ga0307409_100117221 Ga0307409_1001172212 194
96 3300031995 Ga0307409_100144718 Ga0307409_1001447182 194
97 3300032002 Ga0307416_100054566 Ga0307416_1000545662 194
98 3300032002 Ga0307416_100169901 Ga0307416_1001699012 194
99 3300032002 Ga0307416_100217653 Ga0307416_1002176532 194
100 3300032002 Ga0307416_100571484 Ga0307416_1005714841 194
101 3300032004 Ga0307414_10067984 Ga0307414_100679842 194
102 3300032126 Ga0307415_100015937 Ga0307415_1000159374 194
103 3300032126 Ga0307415_100053225 Ga0307415_1000532252 194
104 3300044683 Ga0466965_0086320 Ga0466965_0086320_568_1161 194
105 3300048915 Ga0496112_0254272 Ga0496112_0254272_564_1157 194
106 3300048916 Ga0496113_0084205 Ga0496113_0084205_866_1465 194
107 3300048916 Ga0496113_0245126 Ga0496113_0245126_302_895 194
108 3300049573 Ga0501037_0029355 Ga0501037_0029355_2724_3317 194
109 3300031824 Ga0307413_10522175 Ga0307413_105221752 195
110 3300048922 Ga0496119_0200990 Ga0496119_0200990_44_643 195
111 3300048923 Ga0496120_0035091 Ga0496120_0035091_2369_2968 195
112 iso_pu_bacteria 2643221616 2644096422 195
113 3300005327 Ga0070658_10118077 Ga0070658_101180772 196
114 3300005327 Ga0070658_10588036 Ga0070658_105880361 196
115 3300005330 Ga0070690_100418729 Ga0070690_1004187292 196
116 3300005338 Ga0068868_100239019 Ga0068868_1002390192 196
117 3300005339 Ga0070660_100843721 Ga0070660_1008437211 196
118 3300005355 Ga0070671_100068328 Ga0070671_1000683285 196
119 3300005366 Ga0070659_100079531 Ga0070659_1000795312 196
120 3300005367 Ga0070667_100232726 Ga0070667_1002327263 196
121 3300005466 Ga0070685_10011901 Ga0070685_100119012 196
122 3300005539 Ga0068853_100329446 Ga0068853_1003294462 196
123 3300005543 Ga0070672_100090953 Ga0070672_1000909535 196
124 3300005547 Ga0070693_100452591 Ga0070693_1004525911 196
125 3300005563 Ga0068855_100657970 Ga0068855_1006579702 196
126 3300005577 Ga0068857_100055804 Ga0068857_1000558045 196
127 3300005577 Ga0068857_100322682 Ga0068857_1003226822 196
128 3300005614 Ga0068856_100542209 Ga0068856_1005422092 196
129 3300005614 Ga0068856_100963288 Ga0068856_1009632882 196
130 3300005616 Ga0068852_100154070 Ga0068852_1001540702 196
131 3300005616 Ga0068852_101080061 Ga0068852_1010800612 196
132 3300005834 Ga0068851_10000022 Ga0068851_1000002248 196
133 3300005842 Ga0068858_100001116 Ga0068858_10000111614 196
134 3300009093 Ga0105240_10055263 Ga0105240_100552634 196
135 3300009093 Ga0105240_10270621 Ga0105240_102706212 196
136 3300009098 Ga0105245_10612133 Ga0105245_106121332 196
137 3300009101 Ga0105247_10172684 Ga0105247_101726842 196
138 3300009174 Ga0105241_10025397 Ga0105241_100253971 196
139 3300009177 Ga0105248_10052980 Ga0105248_100529807 196
140 3300009177 Ga0105248_10094518 Ga0105248_100945184 196
141 3300009545 Ga0105237_10027352 Ga0105237_100273524 196
142 3300009545 Ga0105237_10207255 Ga0105237_102072552 196
143 3300009545 Ga0105237_11104558 Ga0105237_111045581 196
144 3300009551 Ga0105238_10164693 Ga0105238_101646932 196
145 3300009551 Ga0105238_10483062 Ga0105238_104830622 196
146 3300010375 Ga0105239_10527559 Ga0105239_105275592 196
147 3300010375 Ga0105239_11580471 Ga0105239_115804711 196
148 3300010375 Ga0105239_12132916 Ga0105239_121329161 196
149 3300013104 Ga0157370_10413505 Ga0157370_104135052 196
150 3300013296 Ga0157374_10117524 Ga0157374_101175242 196
151 3300013296 Ga0157374_10328251 Ga0157374_103282512 196
152 3300013307 Ga0157372_10871979 Ga0157372_108719792 196
153 3300014325 Ga0163163_10351284 Ga0163163_103512843 196
154 3300014968 Ga0157379_10016521 Ga0157379_100165215 196
155 3300025230 Ga0209563_109997 Ga0209563_1099971 196
156 3300025254 Ga0209148_1002588 Ga0209148_10025883 196
157 3300025321 Ga0207656_10000005 Ga0207656_10000005310 196
158 3300025900 Ga0207710_10070776 Ga0207710_100707762 196
159 3300025909 Ga0207705_10005785 Ga0207705_1000578510 196
160 3300025909 Ga0207705_10034982 Ga0207705_100349825 196
161 3300025911 Ga0207654_10000001 Ga0207654_10000001859 196
162 3300025911 Ga0207654_10307076 Ga0207654_103070761 196
163 3300025913 Ga0207695_10013731 Ga0207695_100137317 196
164 3300025913 Ga0207695_10081594 Ga0207695_100815942 196
165 3300025913 Ga0207695_10231820 Ga0207695_102318203 196
166 3300025914 Ga0207671_10000016 Ga0207671_10000016150 196
167 3300025914 Ga0207671_10242614 Ga0207671_102426142 196
168 3300025919 Ga0207657_10005997 Ga0207657_1000599722 196
169 3300025924 Ga0207694_10000057 Ga0207694_1000005790 196
170 3300025924 Ga0207694_10630589 Ga0207694_106305892 196
171 3300025927 Ga0207687_10061516 Ga0207687_100615163 196
172 3300025931 Ga0207644_10296308 Ga0207644_102963083 196
173 3300025932 Ga0207690_10000329 Ga0207690_1000032933 196
174 3300025940 Ga0207691_10090205 Ga0207691_100902056 196
175 3300025941 Ga0207711_10018074 Ga0207711_100180746 196
176 3300025941 Ga0207711_10380922 Ga0207711_103809221 196
177 3300025949 Ga0207667_10028406 Ga0207667_100284065 196
178 3300025949 Ga0207667_10230161 Ga0207667_102301612 196
179 3300025986 Ga0207658_10110808 Ga0207658_101108082 196
180 3300026023 Ga0207677_10030685 Ga0207677_100306852 196
181 3300026023 Ga0207677_10086414 Ga0207677_100864142 196
182 3300026035 Ga0207703_10001453 Ga0207703_1000145326 196
183 3300026041 Ga0207639_10194414 Ga0207639_101944142 196
184 3300026041 Ga0207639_10213660 Ga0207639_102136602 196
185 3300026078 Ga0207702_10269240 Ga0207702_102692402 196
186 3300026088 Ga0207641_10311261 Ga0207641_103112612 196
187 3300026095 Ga0207676_10015408 Ga0207676_100154089 196
188 3300026142 Ga0207698_10131841 Ga0207698_101318412 196
189 3300026142 Ga0207698_10333325 Ga0207698_103333251 196
190 3300026142 Ga0207698_10976140 Ga0207698_109761402 196
191 3300031649 Ga0307514_10106689 Ga0307514_101066892 196
192 3300041452 Ga0451793_1912529 Ga0451793_1912529_370_969 196
193 3300048920 Ga0496117_0170449 Ga0496117_0170449_59_658 196
194 3300048921 Ga0496118_0221872 Ga0496118_0221872_160_762 196
195 3300048921 Ga0496118_0271374 Ga0496118_0271374_80_679 196
196 3300048922 Ga0496119_0026752 Ga0496119_0026752_889_1491 196
197 3300048923 Ga0496120_0004152 Ga0496120_0004152_7844_8446 196
198 3300048923 Ga0496120_0030182 Ga0496120_0030182_129_743 196
199 3300048923 Ga0496120_0072478 Ga0496120_0072478_211_810 196
200 3300048928 Ga0496125_0132034 Ga0496125_0132034_473_1087 196
201 3300048929 Ga0496126_0258487 Ga0496126_0258487_495_1094 196
202 3300053080 Ga0500635_0061528 Ga0500635_0061528_129_728 196
203 3300053093 Ga0500651_0000251 Ga0500651_0000251_28863_29462 196
204 3300053136 Ga0500559_0000164 Ga0500559_0000164_31240_31830 196
205 3300053148 Ga0500590_003646 Ga0500590_003646_4166_4765 196
206 3300009551 Ga0105238_11080400 Ga0105238_110804002 197
207 3300042461 Ga0439460_0025209 Ga0439460_0025209_102_827 197
208 iso_pu_bacteria 2870622029 2870622194 197
209 iso_pu_bacteria 2919523602 2919525409 197
210 3300003752 Ga0055539_1000808 Ga0055539_10008087 198
211 3300003756 Ga0055533_1000001 Ga0055533_10000011669 198
212 3300003759 Ga0055525_1001846 Ga0055525_10018462 198
213 3300003841 Ga0055541_1005771 Ga0055541_10057713 198
214 3300005288 Ga0065714_10116072 Ga0065714_101160722 198
215 3300005327 Ga0070658_10206547 Ga0070658_102065472 198
216 3300013104 Ga0157370_10090732 Ga0157370_100907324 198
217 3300013307 Ga0157372_10277178 Ga0157372_102771782 198
218 3300020070 Ga0206356_11214626 Ga0206356_112146262 198
219 3300020076 Ga0206355_1087961 Ga0206355_10879612 198
220 3300020080 Ga0206350_10397450 Ga0206350_103974502 198
221 3300020082 Ga0206353_10187049 Ga0206353_101870493 198
222 3300025225 Ga0209566_100066 Ga0209566_100066158 198
223 3300025226 Ga0209674_100001 Ga0209674_1000011672 198
224 3300025230 Ga0209563_100001 Ga0209563_1000011672 198
225 3300025253 Ga0209677_100001 Ga0209677_1000011672 198
226 3300025253 Ga0209677_102161 Ga0209677_1021612 198
227 3300025272 Ga0209455_1003952 Ga0209455_10039525 198
228 3300025898 Ga0207692_10367626 Ga0207692_103676262 198
229 3300025909 Ga0207705_10435029 Ga0207705_104350291 198
230 3300037312 Ga0395899_0047194 Ga0395899_0047194_1243_1848 198
231 3300038443 Ga0395901_0153740 Ga0395901_0153740_427_1032 198
232 3300044656 Ga0466969_0065278 Ga0466969_0065278_46_651 198
233 3300044658 Ga0466972_0005615 Ga0466972_0005615_4289_4894 198
234 3300044658 Ga0466972_0231586 Ga0466972_0231586_95_700 198
235 3300044683 Ga0466965_0006167 Ga0466965_0006167_1398_2003 198
236 3300044683 Ga0466965_0119157 Ga0466965_0119157_668_1273 198
237 3300044684 Ga0466966_0010977 Ga0466966_0010977_1385_1990 198
238 3300044693 Ga0466961_0037059 Ga0466961_0037059_1125_1730 198
239 3300044693 Ga0466961_0420082 Ga0466961_0420082_137_742 198
240 3300044719 Ga0466971_0033506 Ga0466971_0033506_1136_1741 198
241 3300044735 Ga0466968_0049508 Ga0466968_0049508_370_975 198
242 3300044765 Ga0466970_0011934 Ga0466970_0011934_2705_3310 198
243 3300044901 Ga0466960_0009426 Ga0466960_0009426_2643_3248 198
244 3300044901 Ga0466960_0071660 Ga0466960_0071660_318_923 198
245 3300045049 Ga0466959_0039513 Ga0466959_0039513_111_716 198
246 3300045049 Ga0466959_0108901 Ga0466959_0108901_542_1147 198
247 3300045836 Ga0466958_0018252 Ga0466958_0018252_199_804 198
248 3300045976 Ga0466967_1408682 Ga0466967_1408682_52_657 198
249 3300047472 Ga0495686_0225367 Ga0495686_0225367_223_828 198
250 3300053142 Ga0500577_0027692 Ga0500577_0027692_367_972 198
251 3300061719 Ga0466962_0044293 Ga0466962_0044293_141_746 198
252 iso_pu_bacteria 2643221649 2644277771 198
253 iso_pu_bacteria 2919055335 2919058834 198
254 3300001979 JGI24740J21852_10051492 JGI24740J21852_100514922 199
255 3300005337 Ga0070682_100133859 Ga0070682_1001338592 199
256 3300005539 Ga0068853_101173055 Ga0068853_1011730551 199
257 3300005563 Ga0068855_100517692 Ga0068855_1005176922 199
258 3300009551 Ga0105238_10503327 Ga0105238_105033272 199
259 3300013102 Ga0157371_10522428 Ga0157371_105224282 199
260 3300013105 Ga0157369_10116153 Ga0157369_101161532 199
261 3300025904 Ga0207647_10028990 Ga0207647_100289906 199
262 3300025924 Ga0207694_10456787 Ga0207694_104567872 199
263 3300037418 Ga0395900_0061899 Ga0395900_0061899_319_918 199
264 3300037466 Ga0395898_0000381 Ga0395898_0000381_91059_91658 199
265 3300048903 Ga0496100_0049474 Ga0496100_0049474_1417_2064 199
266 3300048903 Ga0496100_0065174 Ga0496100_0065174_246_845 199
267 3300048904 Ga0496101_0006142 Ga0496101_0006142_372_1019 199
268 3300048904 Ga0496101_0043034 Ga0496101_0043034_854_1453 199
269 3300048905 Ga0496102_0054704 Ga0496102_0054704_355_954 199
270 3300048905 Ga0496102_0146097 Ga0496102_0146097_1245_1856 199
271 3300048905 Ga0496102_0357896 Ga0496102_0357896_281_928 199
272 3300048906 Ga0496103_0197804 Ga0496103_0197804_584_1183 199
273 3300048906 Ga0496103_0251925 Ga0496103_0251925_329_976 199
274 3300048907 Ga0496104_0125224 Ga0496104_0125224_935_1534 199
275 3300048907 Ga0496104_0794723 Ga0496104_0794723_41_688 199
276 3300048908 Ga0496105_0353374 Ga0496105_0353374_362_1009 199
277 3300048917 Ga0496114_0004840 Ga0496114_0004840_4039_4686 199
278 3300048917 Ga0496114_0062991 Ga0496114_0062991_519_1118 199
279 3300048918 Ga0496115_0021807 Ga0496115_0021807_1210_1857 199
280 3300048918 Ga0496115_0049042 Ga0496115_0049042_1614_2261 199
281 3300048921 Ga0496118_0005764 Ga0496118_0005764_1379_1990 199
282 3300048922 Ga0496119_0012846 Ga0496119_0012846_395_994 199
283 3300048923 Ga0496120_0111370 Ga0496120_0111370_469_1068 199
284 3300048924 Ga0496121_0272397 Ga0496121_0272397_30_629 199
285 3300048929 Ga0496126_0090337 Ga0496126_0090337_1593_2240 199
286 3300049568 Ga0501031_0002050 Ga0501031_0002050_1240_1863 199
287 3300049569 Ga0501032_0014751 Ga0501032_0014751_2104_2727 199
288 3300049570 Ga0501033_0002214 Ga0501033_0002214_5475_6098 199
289 3300049571 Ga0501034_0011202 Ga0501034_0011202_5197_5820 199
290 3300049572 Ga0501036_0005365 Ga0501036_0005365_4561_5184 199
291 3300049573 Ga0501037_0001422 Ga0501037_0001422_12538_13161 199
292 3300049574 Ga0501038_0003511 Ga0501038_0003511_10362_10985 199
293 3300049575 Ga0501039_0021748 Ga0501039_0021748_1660_2283 199
294 3300049579 Ga0501043_0007553 Ga0501043_0007553_4511_5134 199
295 3300049580 Ga0501046_0003203 Ga0501046_0003203_4175_4798 199
296 3300049581 Ga0501047_0016213 Ga0501047_0016213_4511_5134 199
297 3300049582 Ga0501048_0026066 Ga0501048_0026066_205_828 199
298 3300049584 Ga0501068_0123838 Ga0501068_0123838_568_1191 199
299 3300049586 Ga0501070_0007064 Ga0501070_0007064_6697_7320 199
300 3300049589 Ga0501073_0045898 Ga0501073_0045898_1071_1694 199
301 3300049822 Ga0501035_0037104 Ga0501035_0037104_1976_2599 199
302 3300049823 Ga0501044_0001531 Ga0501044_0001531_5143_5766 199
303 iso_pu_bacteria 2585428094 2587863678 199

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00406

ADK

Adenylate kinase

13

197

0.97

PF13207

AAA_17

AAA domain

14

141

0.89

PF13671

AAA_33

AAA domain

11

138

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3adk-assembly1.cif.gz_A refined structure of porcine cytosolic adenylate kinase at 2.1 angstroms resolution 0.8956 1 184
2cdn-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis adenylate kinase complexed with two molecules of adp and mg 0.8831 2 184
2ak2-assembly1.cif.gz_A adenylate kinase isoenzyme-2 0.8777 2 187
2c9y-assembly1.cif.gz_A structure of human adenylate kinase 2 0.876 2 187
1dvr-assembly1.cif.gz_B structure of a mutant adenylate kinase ligated with an atp-analogue showing domain closure over atp 0.8616 1 189
ID Description Score Start End Superfamily
af_A0A1D6H6N6_28_186_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9383 2 123 3.40.50.300
af_P9WKF5_1_180_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8794 2 183 3.40.50.300
1ak2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8772 2 187 3.40.50.300
af_A0A1D6MYG3_1_117_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8625 132 184 3.40.50.300
1tevA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8584 2 187 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A6L5F1D8-F1-model_v4 Adenylate kinase (EC 2.7.4.3) 0.9944 2 114 GO:0004017
GO:0005524
GO:0005737
AF-A0A499UYH4-F1-model_v4 Adenylate kinase (AK) (EC 2.7.4.3) (ATP-AMP transphosphorylase) (ATP:AMP phosphotransferase) (Adenylate monophosphate kinase) 0.9894 2 114 GO:0004017
GO:0005524
GO:0005737
GO:0044209
AF-A0A0H4T6H9-F1-model_v4 Adenylate kinase (EC 2.7.4.3) 0.9754 2 123 GO:0004017
GO:0005524
GO:0005737
GO:0043231
AF-A0A7Z9L6Z8-F1-model_v4 Adenylate kinase (AK) (EC 2.7.4.3) (ATP-AMP transphosphorylase) (ATP:AMP phosphotransferase) (Adenylate monophosphate kinase) 0.9747 2 187 GO:0004017
GO:0005524
GO:0005737
GO:0044209
AF-A0A3D5AS70-F1-model_v4 Adenylate kinase (EC 2.7.4.3) 0.9746 2 123 GO:0004017
GO:0005524
GO:0005737

Feature Viewer

pLDDT pTM Quality
91.3 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map