F397180
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 303 | 192 | 280 | 201 |
Family's Representative Sequence
| Representative Sequence | 3300042461|Ga0439460_0025209|Ga0439460_0025209_102_827 |
| Length | 241 |
| Sequence | VGGAGDVALNVAVIGPPGAGKGTQAERFARDHRIPKISTGDILREAVHADTPLGRQVSAVLNRGQLVSDDLMIGIVNERLARPDAARGFVLDGFPRTVPQASALDEMLAARGPLIVVEIHVPDDELVRRVRSRRICKNCGRMVSAFRGEASPAARCENCGGELVPRPDDGESVVRDRLQVYWNETKPVVDFYRARPTYRVVNGAQAPERVREAMVAAVASALGKPAAELAPTNVAQPGSNA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428094 | Herbiconiux sp. YR403 | Isolate | Rhizosphere |
| 2 | 2643221616 | Leifsonia sp. Root227 | Isolate | Unclassified |
| 3 | 2643221632 | Leifsonia sp. Root112D2 | Isolate | Unclassified |
| 4 | 2643221649 | Leifsonia sp. Root4 | Isolate | Unclassified |
| 5 | 2690315906 | Arthrobacter sp. OY3WO11 | Isolate | Unclassified |
| 6 | 2775506735 | Arthrobacter sp. S95 1704 | Isolate | Unclassified |
| 7 | 2808606357 | Arthrobacter sp. SLBN-122 | Isolate | Unclassified |
| 8 | 2808606360 | Arthrobacter sp. SLBN-112 | Isolate | Unclassified |
| 9 | 2808606366 | Arthrobacter sp. SLBN-83 | Isolate | Unclassified |
| 10 | 2808606370 | Arthrobacter sp. SLBN-100 | Isolate | Unclassified |
| 11 | 2808606371 | Arthrobacter sp. SLBN-53 | Isolate | Unclassified |
| 12 | 2811994871 | Arthrobacter sp. SLBN-179 | Isolate | Unclassified |
| 13 | 2848551377 | Brachybacterium saurashtrense DSM 23186 | Isolate | Unclassified |
| 14 | 2870622029 | Conyzicola lurida DSM 105784 | Isolate | Unclassified |
| 15 | 2919055335 | Leifsonia sp. 1010 | Isolate | Rhizosphere |
| 16 | 2919523602 | Leifsonia shinshuensis 3821 | Isolate | Unclassified |
| 17 | 2939598168 | Arthrobacter sp. 754 | Isolate | Rhizosphere |
| 18 | 2945916053 | Arthrobacter ulcerisalmonis W1I2 | Isolate | Rhizosphere |
| 19 | 2945920336 | Pseudarthrobacter siccitolerans W1I3 | Isolate | Rhizosphere |
| 20 | 2945941187 | Arthrobacter pascens W1I14 | Isolate | Rhizosphere |
| 21 | 2946037020 | Arthrobacter sp. W4I7 | Isolate | Rhizosphere |
| 22 | 2946059875 | Arthrobacter sp. SLBN-112 | Isolate | Rhizosphere |
| 23 | 2953998280 | Pseudarthrobacter sp. W1I19 | Isolate | Rhizosphere |
| 24 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 25 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 27 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 34 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 67 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 68 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 69 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 70 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 71 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 72 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 105 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 106 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 107 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 108 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 109 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 110 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 111 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 112 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 113 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 114 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 115 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 116 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 117 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 118 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 119 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 120 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 121 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 122 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 123 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 124 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 125 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 126 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 127 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 128 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 129 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 130 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 131 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 132 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 133 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 134 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 135 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 136 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 137 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 138 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 139 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 140 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 141 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 142 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 143 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 144 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 145 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 146 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 147 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 148 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 149 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 150 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 151 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 153 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 154 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 155 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 156 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 157 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 158 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 159 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 160 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 161 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 162 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 163 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 164 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 165 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 166 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 167 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 168 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 169 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 172 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 178 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 183 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 184 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 187 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 188 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 189 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 190 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 191 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 192 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.77 |
| Metatranscriptomes | 2.64 |
| Isolates | 7.59 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.27 |
| Nodule | 0 |
| Rhizoplane | 7.26 |
| Rhizosphere | 75.58 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.89 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10051492 | 3300001979 | Bacteria | 1178 |
| 2 | Ga0055539_1000808 | 3300003752 | Bacteria | 7414 |
| 3 | Ga0055533_1000001 | 3300003756 | Bacteria | 1863437 |
| 4 | Ga0055525_1001846 | 3300003759 | Bacteria | 2855 |
| 5 | Ga0055541_1005771 | 3300003841 | Bacteria | 2145 |
| 6 | Ga0065714_10101761 | 3300005288 | Bacteria | 1636 |
| 7 | Ga0065714_10116072 | 3300005288 | Bacteria | 1406 |
| 8 | Ga0070658_10118077 | 3300005327 | Bacteria | 2202 |
| 9 | Ga0070658_10206547 | 3300005327 | Bacteria | 1658 |
| 10 | Ga0070658_10588036 | 3300005327 | Bacteria | 964 |
| 11 | Ga0070690_100418729 | 3300005330 | Bacteria | 987 |
| 12 | Ga0070682_100133859 | 3300005337 | Bacteria | 1681 |
| 13 | Ga0068868_100239019 | 3300005338 | Bacteria | 1525 |
| 14 | Ga0070660_100843721 | 3300005339 | Bacteria | 771 |
| 15 | Ga0070671_100068328 | 3300005355 | Bacteria | 2964 |
| 16 | Ga0070659_100079531 | 3300005366 | Bacteria | 2617 |
| 17 | Ga0070667_100232726 | 3300005367 | Bacteria | 1643 |
| 18 | Ga0070685_10011901 | 3300005466 | Bacteria | 4563 |
| 19 | Ga0068853_100329446 | 3300005539 | Bacteria | 1417 |
| 20 | Ga0068853_101173055 | 3300005539 | Bacteria | 741 |
| 21 | Ga0070672_100090953 | 3300005543 | Bacteria | 2462 |
| 22 | Ga0070693_100452591 | 3300005547 | Bacteria | 901 |
| 23 | Ga0068855_100470608 | 3300005563 | Unclassified | 1369 |
| 24 | Ga0068855_100517692 | 3300005563 | Bacteria | 1294 |
| 25 | Ga0068855_100657970 | 3300005563 | Bacteria | 1124 |
| 26 | Ga0068857_100055804 | 3300005577 | Bacteria | 3505 |
| 27 | Ga0068857_100322682 | 3300005577 | Bacteria | 1426 |
| 28 | Ga0068856_100542209 | 3300005614 | Bacteria | 1184 |
| 29 | Ga0068856_100963288 | 3300005614 | Bacteria | 872 |
| 30 | Ga0068852_100154070 | 3300005616 | Bacteria | 2139 |
| 31 | Ga0068852_101080061 | 3300005616 | Bacteria | 822 |
| 32 | Ga0068851_10000022 | 3300005834 | Bacteria | 129607 |
| 33 | Ga0068858_100001116 | 3300005842 | Bacteria | 27809 |
| 34 | Ga0105244_10026174 | 3300009036 | Bacteria | 3159 |
| 35 | Ga0105240_10055263 | 3300009093 | Bacteria | 4971 |
| 36 | Ga0105240_10270621 | 3300009093 | Bacteria | 1956 |
| 37 | Ga0105245_10612133 | 3300009098 | Bacteria | 1117 |
| 38 | Ga0105247_10172684 | 3300009101 | Bacteria | 1438 |
| 39 | Ga0105243_10017603 | 3300009148 | Bacteria | 5405 |
| 40 | Ga0105241_10025397 | 3300009174 | Bacteria | 4402 |
| 41 | Ga0105248_10052980 | 3300009177 | Bacteria | 4553 |
| 42 | Ga0105248_10094518 | 3300009177 | Bacteria | 3366 |
| 43 | Ga0105237_10027352 | 3300009545 | Bacteria | 5823 |
| 44 | Ga0105237_10207255 | 3300009545 | Bacteria | 1961 |
| 45 | Ga0105237_11104558 | 3300009545 | Bacteria | 800 |
| 46 | Ga0105238_10164693 | 3300009551 | Bacteria | 2193 |
| 47 | Ga0105238_10483062 | 3300009551 | Bacteria | 1238 |
| 48 | Ga0105238_10503327 | 3300009551 | Bacteria | 1212 |
| 49 | Ga0105238_11080400 | 3300009551 | Bacteria | 825 |
| 50 | Ga0105239_10527559 | 3300010375 | Bacteria | 1344 |
| 51 | Ga0105239_11580471 | 3300010375 | Bacteria | 758 |
| 52 | Ga0105239_12132916 | 3300010375 | Bacteria | 651 |
| 53 | Ga0105246_10002007 | 3300011119 | Bacteria | 12291 |
| 54 | Ga0157371_10522428 | 3300013102 | Bacteria | 878 |
| 55 | Ga0157370_10090732 | 3300013104 | Bacteria | 2869 |
| 56 | Ga0157370_10413505 | 3300013104 | Bacteria | 1241 |
| 57 | Ga0157369_10083117 | 3300013105 | Bacteria | 3425 |
| 58 | Ga0157369_10116153 | 3300013105 | Bacteria | 2842 |
| 59 | Ga0157369_10160938 | 3300013105 | Bacteria | 2370 |
| 60 | Ga0157369_10394338 | 3300013105 | Bacteria | 1436 |
| 61 | Ga0157374_10117524 | 3300013296 | Bacteria | 2563 |
| 62 | Ga0157374_10328251 | 3300013296 | Bacteria | 1517 |
| 63 | Ga0157372_10277178 | 3300013307 | Bacteria | 1950 |
| 64 | Ga0157372_10871979 | 3300013307 | Bacteria | 1045 |
| 65 | Ga0163163_10351284 | 3300014325 | Bacteria | 1531 |
| 66 | Ga0157379_10016521 | 3300014968 | Bacteria | 6492 |
| 67 | Ga0197907_10503275 | 3300020069 | Unclassified | 1392 |
| 68 | Ga0206356_11214626 | 3300020070 | Bacteria | 1141 |
| 69 | Ga0206356_11309167 | 3300020070 | Bacteria | 4585 |
| 70 | Ga0206355_1087961 | 3300020076 | Bacteria | 1354 |
| 71 | Ga0206350_10397450 | 3300020080 | Bacteria | 1779 |
| 72 | Ga0206350_11497008 | 3300020080 | Bacteria | 6463 |
| 73 | Ga0206353_10187049 | 3300020082 | Bacteria | 1806 |
| 74 | Ga0206353_11205565 | 3300020082 | Bacteria | 1251 |
| 75 | Ga0213876_10256912 | 3300021384 | Unclassified | 928 |
| 76 | Ga0209566_100066 | 3300025225 | Bacteria | 186951 |
| 77 | Ga0209674_100001 | 3300025226 | Bacteria | 4013750 |
| 78 | Ga0209563_100001 | 3300025230 | Bacteria | 4013775 |
| 79 | Ga0209563_109997 | 3300025230 | Bacteria | 1410 |
| 80 | Ga0209677_100001 | 3300025253 | Bacteria | 4013787 |
| 81 | Ga0209677_102161 | 3300025253 | Bacteria | 7674 |
| 82 | Ga0209148_1002588 | 3300025254 | Bacteria | 5970 |
| 83 | Ga0209455_1003952 | 3300025272 | Bacteria | 5035 |
| 84 | Ga0207656_10000005 | 3300025321 | Bacteria | 490514 |
| 85 | Ga0207655_1000386 | 3300025728 | Bacteria | 61740 |
| 86 | Ga0207692_10367626 | 3300025898 | Bacteria | 890 |
| 87 | Ga0207710_10070776 | 3300025900 | Bacteria | 1599 |
| 88 | Ga0207647_10028990 | 3300025904 | Bacteria | 3588 |
| 89 | Ga0207705_10005785 | 3300025909 | Bacteria | 9214 |
| 90 | Ga0207705_10034982 | 3300025909 | Bacteria | 3594 |
| 91 | Ga0207705_10435029 | 3300025909 | Bacteria | 1016 |
| 92 | Ga0207654_10000001 | 3300025911 | Bacteria | 1816198 |
| 93 | Ga0207654_10307076 | 3300025911 | Bacteria | 1081 |
| 94 | Ga0207695_10013731 | 3300025913 | Bacteria | 9637 |
| 95 | Ga0207695_10081594 | 3300025913 | Bacteria | 3272 |
| 96 | Ga0207695_10231820 | 3300025913 | Bacteria | 1750 |
| 97 | Ga0207671_10000016 | 3300025914 | Bacteria | 435413 |
| 98 | Ga0207671_10242614 | 3300025914 | Bacteria | 1415 |
| 99 | Ga0207657_10005997 | 3300025919 | Bacteria | 12644 |
| 100 | Ga0207694_10000057 | 3300025924 | Bacteria | 146441 |
| 101 | Ga0207694_10456787 | 3300025924 | Bacteria | 1067 |
| 102 | Ga0207694_10630589 | 3300025924 | Bacteria | 902 |
| 103 | Ga0207687_10061516 | 3300025927 | Bacteria | 2652 |
| 104 | Ga0207644_10296308 | 3300025931 | Bacteria | 1302 |
| 105 | Ga0207690_10000329 | 3300025932 | Bacteria | 31684 |
| 106 | Ga0207709_10010829 | 3300025935 | Bacteria | 5023 |
| 107 | Ga0207709_10389649 | 3300025935 | Bacteria | 1062 |
| 108 | Ga0207691_10090205 | 3300025940 | Bacteria | 2748 |
| 109 | Ga0207711_10018074 | 3300025941 | Bacteria | 5862 |
| 110 | Ga0207711_10380922 | 3300025941 | Bacteria | 1309 |
| 111 | Ga0207667_10028406 | 3300025949 | Bacteria | 6076 |
| 112 | Ga0207667_10230161 | 3300025949 | Bacteria | 1898 |
| 113 | Ga0207658_10110808 | 3300025986 | Bacteria | 2169 |
| 114 | Ga0207677_10030685 | 3300026023 | Bacteria | 3434 |
| 115 | Ga0207677_10086414 | 3300026023 | Bacteria | 2267 |
| 116 | Ga0207703_10001453 | 3300026035 | Bacteria | 21613 |
| 117 | Ga0207639_10194414 | 3300026041 | Bacteria | 1735 |
| 118 | Ga0207639_10213660 | 3300026041 | Bacteria | 1662 |
| 119 | Ga0207702_10269240 | 3300026078 | Bacteria | 1606 |
| 120 | Ga0207641_10311261 | 3300026088 | Bacteria | 1490 |
| 121 | Ga0207676_10015408 | 3300026095 | Bacteria | 5514 |
| 122 | Ga0207698_10131841 | 3300026142 | Bacteria | 2137 |
| 123 | Ga0207698_10333325 | 3300026142 | Bacteria | 1426 |
| 124 | Ga0207698_10976140 | 3300026142 | Bacteria | 857 |
| 125 | Ga0307408_100069303 | 3300031548 | Bacteria | 2600 |
| 126 | Ga0307514_10106689 | 3300031649 | Bacteria | 1996 |
| 127 | Ga0307405_10046840 | 3300031731 | Bacteria | 2659 |
| 128 | Ga0307405_10107019 | 3300031731 | Bacteria | 1887 |
| 129 | Ga0307405_10111109 | 3300031731 | Bacteria | 1857 |
| 130 | Ga0307413_10049815 | 3300031824 | Bacteria | 2512 |
| 131 | Ga0307413_10197089 | 3300031824 | Bacteria | 1451 |
| 132 | Ga0307413_10522175 | 3300031824 | Bacteria | 958 |
| 133 | Ga0307410_10031490 | 3300031852 | Bacteria | 3404 |
| 134 | Ga0307410_10063513 | 3300031852 | Bacteria | 2533 |
| 135 | Ga0307410_10097955 | 3300031852 | Bacteria | 2096 |
| 136 | Ga0307410_10254276 | 3300031852 | Bacteria | 1367 |
| 137 | Ga0307410_10342209 | 3300031852 | Bacteria | 1193 |
| 138 | Ga0307406_10066681 | 3300031901 | Bacteria | 2344 |
| 139 | Ga0307406_10084562 | 3300031901 | Bacteria | 2119 |
| 140 | Ga0307406_10457564 | 3300031901 | Bacteria | 1025 |
| 141 | Ga0307406_10698219 | 3300031901 | Bacteria | 847 |
| 142 | Ga0307406_10807649 | 3300031901 | Bacteria | 792 |
| 143 | Ga0307407_10038847 | 3300031903 | Bacteria | 2641 |
| 144 | Ga0307407_10074187 | 3300031903 | Bacteria | 2035 |
| 145 | Ga0307407_10252362 | 3300031903 | Bacteria | 1209 |
| 146 | Ga0307407_10380336 | 3300031903 | Bacteria | 1008 |
| 147 | Ga0307407_10395137 | 3300031903 | Bacteria | 990 |
| 148 | Ga0307412_10042269 | 3300031911 | Bacteria | 2960 |
| 149 | Ga0307412_10125069 | 3300031911 | Bacteria | 1858 |
| 150 | Ga0307412_10227420 | 3300031911 | Bacteria | 1434 |
| 151 | Ga0307412_10260555 | 3300031911 | Bacteria | 1351 |
| 152 | Ga0307412_10269084 | 3300031911 | Bacteria | 1332 |
| 153 | Ga0307412_10425800 | 3300031911 | Bacteria | 1087 |
| 154 | Ga0307412_10646815 | 3300031911 | Bacteria | 901 |
| 155 | Ga0307409_100005722 | 3300031995 | Bacteria | 7205 |
| 156 | Ga0307409_100117221 | 3300031995 | Bacteria | 2247 |
| 157 | Ga0307409_100144718 | 3300031995 | Bacteria | 2053 |
| 158 | Ga0307409_100538724 | 3300031995 | Bacteria | 1144 |
| 159 | Ga0307416_100054566 | 3300032002 | Bacteria | 3213 |
| 160 | Ga0307416_100169901 | 3300032002 | Bacteria | 2028 |
| 161 | Ga0307416_100217653 | 3300032002 | Bacteria | 1828 |
| 162 | Ga0307416_100571484 | 3300032002 | Bacteria | 1206 |
| 163 | Ga0307414_10067984 | 3300032004 | Bacteria | 2555 |
| 164 | Ga0307411_10576228 | 3300032005 | Bacteria | 964 |
| 165 | Ga0307415_100015937 | 3300032126 | Bacteria | 4464 |
| 166 | Ga0307415_100053225 | 3300032126 | Bacteria | 2757 |
| 167 | Ga0373925_0711734 | 3300037068 | Bacteria | 828 |
| 168 | Ga0395899_0043105 | 3300037312 | Bacteria | 3366 |
| 169 | Ga0395899_0047194 | 3300037312 | Bacteria | 3207 |
| 170 | Ga0395900_0061899 | 3300037418 | Bacteria | 3847 |
| 171 | Ga0395900_0101088 | 3300037418 | Bacteria | 2961 |
| 172 | Ga0395900_0126712 | 3300037418 | Bacteria | 2619 |
| 173 | Ga0395898_0000381 | 3300037466 | Bacteria | 97274 |
| 174 | Ga0395898_0023120 | 3300037466 | Bacteria | 6285 |
| 175 | Ga0395898_0047876 | 3300037466 | Bacteria | 4193 |
| 176 | Ga0395901_0082768 | 3300038443 | Bacteria | 3353 |
| 177 | Ga0395901_0153740 | 3300038443 | Bacteria | 2416 |
| 178 | Ga0436365_1436184 | 3300039437 | Bacteria | 5972 |
| 179 | Ga0439436_0010849 | 3300041404 | Bacteria | 2775 |
| 180 | Ga0439436_0027153 | 3300041404 | Bacteria | 1676 |
| 181 | Ga0439438_066177 | 3300041405 | Bacteria | 899 |
| 182 | Ga0439439_0059259 | 3300041406 | Bacteria | 1014 |
| 183 | Ga0439447_047536 | 3300041407 | Bacteria | 1031 |
| 184 | Ga0451789_1130871 | 3300041443 | Bacteria | 768 |
| 185 | Ga0451793_1912529 | 3300041452 | Bacteria | 1260 |
| 186 | Ga0439442_000191 | 3300042002 | Bacteria | 15596 |
| 187 | Ga0439442_004990 | 3300042002 | Bacteria | 2648 |
| 188 | Ga0439449_0177152 | 3300042007 | Bacteria | 797 |
| 189 | Ga0439457_025548 | 3300042014 | Bacteria | 1307 |
| 190 | Ga0450911_017832 | 3300042115 | Bacteria | 933 |
| 191 | Ga0450920_000997 | 3300042122 | Bacteria | 4633 |
| 192 | Ga0450920_032923 | 3300042122 | Bacteria | 1024 |
| 193 | Ga0450907_000443 | 3300042146 | Bacteria | 12009 |
| 194 | Ga0450909_048010 | 3300042185 | Bacteria | 664 |
| 195 | Ga0439434_0001494 | 3300042435 | Bacteria | 6722 |
| 196 | Ga0439460_0025209 | 3300042461 | Bacteria | 1654 |
| 197 | Ga0450918_009768 | 3300042531 | Bacteria | 1678 |
| 198 | Ga0466969_0065278 | 3300044656 | Bacteria | 1760 |
| 199 | Ga0466972_0005615 | 3300044658 | Bacteria | 6284 |
| 200 | Ga0466972_0231586 | 3300044658 | Bacteria | 864 |
| 201 | Ga0466965_0006167 | 3300044683 | Bacteria | 5423 |
| 202 | Ga0466965_0086320 | 3300044683 | Bacteria | 1592 |
| 203 | Ga0466965_0119157 | 3300044683 | Bacteria | 1362 |
| 204 | Ga0466966_0010977 | 3300044684 | Bacteria | 6011 |
| 205 | Ga0466961_0037059 | 3300044693 | Bacteria | 3130 |
| 206 | Ga0466961_0420082 | 3300044693 | Bacteria | 810 |
| 207 | Ga0466971_0033506 | 3300044719 | Bacteria | 2302 |
| 208 | Ga0466968_0049508 | 3300044735 | Bacteria | 1790 |
| 209 | Ga0466970_0011934 | 3300044765 | Bacteria | 4434 |
| 210 | Ga0466960_0009426 | 3300044901 | Bacteria | 4024 |
| 211 | Ga0466960_0071660 | 3300044901 | Bacteria | 1726 |
| 212 | Ga0466959_0039513 | 3300045049 | Bacteria | 3486 |
| 213 | Ga0466959_0108901 | 3300045049 | Bacteria | 1978 |
| 214 | Ga0466958_0018252 | 3300045836 | Bacteria | 4068 |
| 215 | Ga0466967_1408682 | 3300045976 | Bacteria | 694 |
| 216 | Ga0495686_0225367 | 3300047472 | Bacteria | 1064 |
| 217 | Ga0496100_0049474 | 3300048903 | Bacteria | 2719 |
| 218 | Ga0496100_0065174 | 3300048903 | Bacteria | 2412 |
| 219 | Ga0496101_0006142 | 3300048904 | Bacteria | 7710 |
| 220 | Ga0496101_0043034 | 3300048904 | Bacteria | 3225 |
| 221 | Ga0496102_0054704 | 3300048905 | Bacteria | 3640 |
| 222 | Ga0496102_0146097 | 3300048905 | Bacteria | 2220 |
| 223 | Ga0496102_0357896 | 3300048905 | Bacteria | 1374 |
| 224 | Ga0496103_0197804 | 3300048906 | Bacteria | 1292 |
| 225 | Ga0496103_0251925 | 3300048906 | Bacteria | 1136 |
| 226 | Ga0496104_0125224 | 3300048907 | Bacteria | 2467 |
| 227 | Ga0496104_0794723 | 3300048907 | Bacteria | 852 |
| 228 | Ga0496105_0353374 | 3300048908 | Bacteria | 1173 |
| 229 | Ga0496112_0254272 | 3300048915 | Bacteria | 1707 |
| 230 | Ga0496113_0084205 | 3300048916 | Bacteria | 2441 |
| 231 | Ga0496113_0245126 | 3300048916 | Bacteria | 1430 |
| 232 | Ga0496114_0004840 | 3300048917 | Bacteria | 10491 |
| 233 | Ga0496114_0062991 | 3300048917 | Bacteria | 3104 |
| 234 | Ga0496115_0000847 | 3300048918 | Bacteria | 22314 |
| 235 | Ga0496115_0021807 | 3300048918 | Bacteria | 4951 |
| 236 | Ga0496115_0049042 | 3300048918 | Bacteria | 3379 |
| 237 | Ga0496117_0170449 | 3300048920 | Bacteria | 1264 |
| 238 | Ga0496118_0005764 | 3300048921 | Bacteria | 13915 |
| 239 | Ga0496118_0221872 | 3300048921 | Bacteria | 1099 |
| 240 | Ga0496118_0271374 | 3300048921 | Bacteria | 950 |
| 241 | Ga0496119_0012846 | 3300048922 | Bacteria | 6753 |
| 242 | Ga0496119_0026752 | 3300048922 | Bacteria | 3989 |
| 243 | Ga0496119_0200990 | 3300048922 | Bacteria | 1031 |
| 244 | Ga0496120_0004152 | 3300048923 | Bacteria | 12451 |
| 245 | Ga0496120_0030182 | 3300048923 | Bacteria | 3300 |
| 246 | Ga0496120_0035091 | 3300048923 | Bacteria | 2999 |
| 247 | Ga0496120_0072478 | 3300048923 | Bacteria | 1887 |
| 248 | Ga0496120_0111370 | 3300048923 | Bacteria | 1430 |
| 249 | Ga0496121_0272397 | 3300048924 | Bacteria | 1163 |
| 250 | Ga0496125_0132034 | 3300048928 | Bacteria | 1756 |
| 251 | Ga0496126_0090337 | 3300048929 | Bacteria | 2695 |
| 252 | Ga0496126_0258487 | 3300048929 | Bacteria | 1449 |
| 253 | Ga0501031_0002050 | 3300049568 | Bacteria | 12672 |
| 254 | Ga0501032_0000470 | 3300049569 | Bacteria | 32512 |
| 255 | Ga0501032_0014751 | 3300049569 | Bacteria | 5530 |
| 256 | Ga0501033_0002214 | 3300049570 | Bacteria | 16754 |
| 257 | Ga0501034_0000066 | 3300049571 | Bacteria | 184727 |
| 258 | Ga0501034_0011202 | 3300049571 | Bacteria | 9310 |
| 259 | Ga0501036_0005365 | 3300049572 | Bacteria | 10380 |
| 260 | Ga0501037_0001422 | 3300049573 | Bacteria | 17565 |
| 261 | Ga0501037_0029355 | 3300049573 | Bacteria | 4063 |
| 262 | Ga0501038_0003511 | 3300049574 | Bacteria | 14597 |
| 263 | Ga0501039_0021748 | 3300049575 | Bacteria | 4921 |
| 264 | Ga0501043_0007553 | 3300049579 | Bacteria | 8624 |
| 265 | Ga0501046_0003203 | 3300049580 | Bacteria | 15062 |
| 266 | Ga0501047_0016213 | 3300049581 | Bacteria | 7109 |
| 267 | Ga0501048_0026066 | 3300049582 | Bacteria | 4258 |
| 268 | Ga0501068_0123838 | 3300049584 | Bacteria | 1613 |
| 269 | Ga0501070_0007064 | 3300049586 | Bacteria | 9552 |
| 270 | Ga0501073_0045898 | 3300049589 | Bacteria | 3076 |
| 271 | Ga0501035_0037104 | 3300049822 | Bacteria | 4414 |
| 272 | Ga0501044_0001531 | 3300049823 | Bacteria | 27116 |
| 273 | Ga0500635_0061528 | 3300053080 | Bacteria | 1311 |
| 274 | Ga0500651_0000251 | 3300053093 | Bacteria | 32614 |
| 275 | Ga0500559_0000164 | 3300053136 | Bacteria | 52626 |
| 276 | Ga0500559_0019464 | 3300053136 | Bacteria | 2868 |
| 277 | Ga0500573_0200488 | 3300053140 | Bacteria | 1059 |
| 278 | Ga0500577_0027692 | 3300053142 | Bacteria | 1944 |
| 279 | Ga0500590_003646 | 3300053148 | Bacteria | 7148 |
| 280 | Ga0466962_0044293 | 3300061719 | Bacteria | 2128 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037418 | Ga0395900_0126712 | Ga0395900_0126712_542_1171 | 184 |
| 2 | 3300037466 | Ga0395898_0047876 | Ga0395898_0047876_1234_1863 | 184 |
| 3 | 3300038443 | Ga0395901_0082768 | Ga0395901_0082768_1516_2145 | 184 |
| 4 | 3300037312 | Ga0395899_0043105 | Ga0395899_0043105_2445_3098 | 186 |
| 5 | 3300037418 | Ga0395900_0101088 | Ga0395900_0101088_448_1101 | 186 |
| 6 | 3300037466 | Ga0395898_0023120 | Ga0395898_0023120_2391_3044 | 186 |
| 7 | iso_pu_bacteria | 2848551377 | 2848553246 | 186 |
| 8 | 3300005563 | Ga0068855_100470608 | Ga0068855_1004706082 | 187 |
| 9 | 3300020069 | Ga0197907_10503275 | Ga0197907_105032752 | 187 |
| 10 | 3300020070 | Ga0206356_11309167 | Ga0206356_113091677 | 187 |
| 11 | 3300020080 | Ga0206350_11497008 | Ga0206350_1149700810 | 187 |
| 12 | 3300021384 | Ga0213876_10256912 | Ga0213876_102569121 | 187 |
| 13 | 3300039437 | Ga0436365_1436184 | Ga0436365_1436184_1612_2262 | 187 |
| 14 | 3300048918 | Ga0496115_0000847 | Ga0496115_0000847_13434_14090 | 187 |
| 15 | iso_pu_bacteria | 2945941187 | 2945941614 | 188 |
| 16 | 3300011119 | Ga0105246_10002007 | Ga0105246_100020075 | 189 |
| 17 | 3300031731 | Ga0307405_10107019 | Ga0307405_101070191 | 189 |
| 18 | 3300031824 | Ga0307413_10197089 | Ga0307413_101970892 | 189 |
| 19 | 3300031852 | Ga0307410_10031490 | Ga0307410_100314903 | 189 |
| 20 | 3300031903 | Ga0307407_10395137 | Ga0307407_103951372 | 189 |
| 21 | 3300031911 | Ga0307412_10260555 | Ga0307412_102605552 | 189 |
| 22 | 3300032005 | Ga0307411_10576228 | Ga0307411_105762281 | 189 |
| 23 | 3300041404 | Ga0439436_0010849 | Ga0439436_0010849_2030_2608 | 189 |
| 24 | 3300041404 | Ga0439436_0027153 | Ga0439436_0027153_358_936 | 189 |
| 25 | 3300041405 | Ga0439438_066177 | Ga0439438_066177_124_702 | 189 |
| 26 | 3300041406 | Ga0439439_0059259 | Ga0439439_0059259_217_795 | 189 |
| 27 | 3300041407 | Ga0439447_047536 | Ga0439447_047536_438_1016 | 189 |
| 28 | 3300042002 | Ga0439442_000191 | Ga0439442_000191_13465_14043 | 189 |
| 29 | 3300042002 | Ga0439442_004990 | Ga0439442_004990_903_1553 | 189 |
| 30 | 3300042007 | Ga0439449_0177152 | Ga0439449_0177152_169_747 | 189 |
| 31 | 3300042014 | Ga0439457_025548 | Ga0439457_025548_603_1181 | 189 |
| 32 | 3300042115 | Ga0450911_017832 | Ga0450911_017832_112_690 | 189 |
| 33 | 3300042122 | Ga0450920_000997 | Ga0450920_000997_2436_3014 | 189 |
| 34 | 3300042122 | Ga0450920_032923 | Ga0450920_032923_57_707 | 189 |
| 35 | 3300042146 | Ga0450907_000443 | Ga0450907_000443_1443_2021 | 189 |
| 36 | 3300042185 | Ga0450909_048010 | Ga0450909_048010_70_648 | 189 |
| 37 | 3300042435 | Ga0439434_0001494 | Ga0439434_0001494_3403_3981 | 189 |
| 38 | 3300042531 | Ga0450918_009768 | Ga0450918_009768_764_1342 | 189 |
| 39 | 3300049569 | Ga0501032_0000470 | Ga0501032_0000470_21301_21921 | 189 |
| 40 | 3300049571 | Ga0501034_0000066 | Ga0501034_0000066_147483_148103 | 189 |
| 41 | 3300037068 | Ga0373925_0711734 | Ga0373925_0711734_162_740 | 190 |
| 42 | 3300009036 | Ga0105244_10026174 | Ga0105244_100261742 | 191 |
| 43 | 3300009148 | Ga0105243_10017603 | Ga0105243_100176033 | 191 |
| 44 | 3300025728 | Ga0207655_1000386 | Ga0207655_100038619 | 191 |
| 45 | 3300025935 | Ga0207709_10010829 | Ga0207709_100108294 | 191 |
| 46 | iso_pu_bacteria | 2643221632 | 2644182411 | 191 |
| 47 | 3300031911 | Ga0307412_10125069 | Ga0307412_101250692 | 192 |
| 48 | iso_pu_bacteria | 2939598168 | 2939601956 | 192 |
| 49 | 3300005288 | Ga0065714_10101761 | Ga0065714_101017612 | 193 |
| 50 | 3300013105 | Ga0157369_10083117 | Ga0157369_100831172 | 193 |
| 51 | 3300020082 | Ga0206353_11205565 | Ga0206353_112055652 | 193 |
| 52 | 3300025935 | Ga0207709_10389649 | Ga0207709_103896492 | 193 |
| 53 | 3300031901 | Ga0307406_10698219 | Ga0307406_106982191 | 193 |
| 54 | 3300031911 | Ga0307412_10646815 | Ga0307412_106468151 | 193 |
| 55 | 3300031995 | Ga0307409_100538724 | Ga0307409_1005387242 | 193 |
| 56 | 3300041443 | Ga0451789_1130871 | Ga0451789_1130871_127_717 | 193 |
| 57 | 3300053136 | Ga0500559_0019464 | Ga0500559_0019464_1119_1709 | 193 |
| 58 | 3300053140 | Ga0500573_0200488 | Ga0500573_0200488_445_1035 | 193 |
| 59 | iso_pu_bacteria | 2690315906 | 2691515356 | 193 |
| 60 | iso_pu_bacteria | 2775506735 | 2775658190 | 193 |
| 61 | iso_pu_bacteria | 2808606357 | 2808828547 | 193 |
| 62 | iso_pu_bacteria | 2808606360 | 2808849792 | 193 |
| 63 | iso_pu_bacteria | 2808606366 | 2808877617 | 193 |
| 64 | iso_pu_bacteria | 2808606370 | 2808892761 | 193 |
| 65 | iso_pu_bacteria | 2808606371 | 2808899074 | 193 |
| 66 | iso_pu_bacteria | 2811994871 | 2812319747 | 193 |
| 67 | iso_pu_bacteria | 2945916053 | 2945917493 | 193 |
| 68 | iso_pu_bacteria | 2945920336 | 2945922218 | 193 |
| 69 | iso_pu_bacteria | 2946037020 | 2946037521 | 193 |
| 70 | iso_pu_bacteria | 2946059875 | 2946061318 | 193 |
| 71 | iso_pu_bacteria | 2953998280 | 2953998790 | 193 |
| 72 | 3300013105 | Ga0157369_10160938 | Ga0157369_101609382 | 194 |
| 73 | 3300013105 | Ga0157369_10394338 | Ga0157369_103943381 | 194 |
| 74 | 3300031548 | Ga0307408_100069303 | Ga0307408_1000693032 | 194 |
| 75 | 3300031731 | Ga0307405_10046840 | Ga0307405_100468402 | 194 |
| 76 | 3300031731 | Ga0307405_10111109 | Ga0307405_101111092 | 194 |
| 77 | 3300031824 | Ga0307413_10049815 | Ga0307413_100498151 | 194 |
| 78 | 3300031852 | Ga0307410_10063513 | Ga0307410_100635133 | 194 |
| 79 | 3300031852 | Ga0307410_10097955 | Ga0307410_100979552 | 194 |
| 80 | 3300031852 | Ga0307410_10254276 | Ga0307410_102542762 | 194 |
| 81 | 3300031852 | Ga0307410_10342209 | Ga0307410_103422091 | 194 |
| 82 | 3300031901 | Ga0307406_10066681 | Ga0307406_100666812 | 194 |
| 83 | 3300031901 | Ga0307406_10084562 | Ga0307406_100845622 | 194 |
| 84 | 3300031901 | Ga0307406_10457564 | Ga0307406_104575642 | 194 |
| 85 | 3300031901 | Ga0307406_10807649 | Ga0307406_108076492 | 194 |
| 86 | 3300031903 | Ga0307407_10038847 | Ga0307407_100388473 | 194 |
| 87 | 3300031903 | Ga0307407_10074187 | Ga0307407_100741872 | 194 |
| 88 | 3300031903 | Ga0307407_10252362 | Ga0307407_102523622 | 194 |
| 89 | 3300031903 | Ga0307407_10380336 | Ga0307407_103803362 | 194 |
| 90 | 3300031911 | Ga0307412_10042269 | Ga0307412_100422693 | 194 |
| 91 | 3300031911 | Ga0307412_10227420 | Ga0307412_102274201 | 194 |
| 92 | 3300031911 | Ga0307412_10269084 | Ga0307412_102690841 | 194 |
| 93 | 3300031911 | Ga0307412_10425800 | Ga0307412_104258001 | 194 |
| 94 | 3300031995 | Ga0307409_100005722 | Ga0307409_1000057227 | 194 |
| 95 | 3300031995 | Ga0307409_100117221 | Ga0307409_1001172212 | 194 |
| 96 | 3300031995 | Ga0307409_100144718 | Ga0307409_1001447182 | 194 |
| 97 | 3300032002 | Ga0307416_100054566 | Ga0307416_1000545662 | 194 |
| 98 | 3300032002 | Ga0307416_100169901 | Ga0307416_1001699012 | 194 |
| 99 | 3300032002 | Ga0307416_100217653 | Ga0307416_1002176532 | 194 |
| 100 | 3300032002 | Ga0307416_100571484 | Ga0307416_1005714841 | 194 |
| 101 | 3300032004 | Ga0307414_10067984 | Ga0307414_100679842 | 194 |
| 102 | 3300032126 | Ga0307415_100015937 | Ga0307415_1000159374 | 194 |
| 103 | 3300032126 | Ga0307415_100053225 | Ga0307415_1000532252 | 194 |
| 104 | 3300044683 | Ga0466965_0086320 | Ga0466965_0086320_568_1161 | 194 |
| 105 | 3300048915 | Ga0496112_0254272 | Ga0496112_0254272_564_1157 | 194 |
| 106 | 3300048916 | Ga0496113_0084205 | Ga0496113_0084205_866_1465 | 194 |
| 107 | 3300048916 | Ga0496113_0245126 | Ga0496113_0245126_302_895 | 194 |
| 108 | 3300049573 | Ga0501037_0029355 | Ga0501037_0029355_2724_3317 | 194 |
| 109 | 3300031824 | Ga0307413_10522175 | Ga0307413_105221752 | 195 |
| 110 | 3300048922 | Ga0496119_0200990 | Ga0496119_0200990_44_643 | 195 |
| 111 | 3300048923 | Ga0496120_0035091 | Ga0496120_0035091_2369_2968 | 195 |
| 112 | iso_pu_bacteria | 2643221616 | 2644096422 | 195 |
| 113 | 3300005327 | Ga0070658_10118077 | Ga0070658_101180772 | 196 |
| 114 | 3300005327 | Ga0070658_10588036 | Ga0070658_105880361 | 196 |
| 115 | 3300005330 | Ga0070690_100418729 | Ga0070690_1004187292 | 196 |
| 116 | 3300005338 | Ga0068868_100239019 | Ga0068868_1002390192 | 196 |
| 117 | 3300005339 | Ga0070660_100843721 | Ga0070660_1008437211 | 196 |
| 118 | 3300005355 | Ga0070671_100068328 | Ga0070671_1000683285 | 196 |
| 119 | 3300005366 | Ga0070659_100079531 | Ga0070659_1000795312 | 196 |
| 120 | 3300005367 | Ga0070667_100232726 | Ga0070667_1002327263 | 196 |
| 121 | 3300005466 | Ga0070685_10011901 | Ga0070685_100119012 | 196 |
| 122 | 3300005539 | Ga0068853_100329446 | Ga0068853_1003294462 | 196 |
| 123 | 3300005543 | Ga0070672_100090953 | Ga0070672_1000909535 | 196 |
| 124 | 3300005547 | Ga0070693_100452591 | Ga0070693_1004525911 | 196 |
| 125 | 3300005563 | Ga0068855_100657970 | Ga0068855_1006579702 | 196 |
| 126 | 3300005577 | Ga0068857_100055804 | Ga0068857_1000558045 | 196 |
| 127 | 3300005577 | Ga0068857_100322682 | Ga0068857_1003226822 | 196 |
| 128 | 3300005614 | Ga0068856_100542209 | Ga0068856_1005422092 | 196 |
| 129 | 3300005614 | Ga0068856_100963288 | Ga0068856_1009632882 | 196 |
| 130 | 3300005616 | Ga0068852_100154070 | Ga0068852_1001540702 | 196 |
| 131 | 3300005616 | Ga0068852_101080061 | Ga0068852_1010800612 | 196 |
| 132 | 3300005834 | Ga0068851_10000022 | Ga0068851_1000002248 | 196 |
| 133 | 3300005842 | Ga0068858_100001116 | Ga0068858_10000111614 | 196 |
| 134 | 3300009093 | Ga0105240_10055263 | Ga0105240_100552634 | 196 |
| 135 | 3300009093 | Ga0105240_10270621 | Ga0105240_102706212 | 196 |
| 136 | 3300009098 | Ga0105245_10612133 | Ga0105245_106121332 | 196 |
| 137 | 3300009101 | Ga0105247_10172684 | Ga0105247_101726842 | 196 |
| 138 | 3300009174 | Ga0105241_10025397 | Ga0105241_100253971 | 196 |
| 139 | 3300009177 | Ga0105248_10052980 | Ga0105248_100529807 | 196 |
| 140 | 3300009177 | Ga0105248_10094518 | Ga0105248_100945184 | 196 |
| 141 | 3300009545 | Ga0105237_10027352 | Ga0105237_100273524 | 196 |
| 142 | 3300009545 | Ga0105237_10207255 | Ga0105237_102072552 | 196 |
| 143 | 3300009545 | Ga0105237_11104558 | Ga0105237_111045581 | 196 |
| 144 | 3300009551 | Ga0105238_10164693 | Ga0105238_101646932 | 196 |
| 145 | 3300009551 | Ga0105238_10483062 | Ga0105238_104830622 | 196 |
| 146 | 3300010375 | Ga0105239_10527559 | Ga0105239_105275592 | 196 |
| 147 | 3300010375 | Ga0105239_11580471 | Ga0105239_115804711 | 196 |
| 148 | 3300010375 | Ga0105239_12132916 | Ga0105239_121329161 | 196 |
| 149 | 3300013104 | Ga0157370_10413505 | Ga0157370_104135052 | 196 |
| 150 | 3300013296 | Ga0157374_10117524 | Ga0157374_101175242 | 196 |
| 151 | 3300013296 | Ga0157374_10328251 | Ga0157374_103282512 | 196 |
| 152 | 3300013307 | Ga0157372_10871979 | Ga0157372_108719792 | 196 |
| 153 | 3300014325 | Ga0163163_10351284 | Ga0163163_103512843 | 196 |
| 154 | 3300014968 | Ga0157379_10016521 | Ga0157379_100165215 | 196 |
| 155 | 3300025230 | Ga0209563_109997 | Ga0209563_1099971 | 196 |
| 156 | 3300025254 | Ga0209148_1002588 | Ga0209148_10025883 | 196 |
| 157 | 3300025321 | Ga0207656_10000005 | Ga0207656_10000005310 | 196 |
| 158 | 3300025900 | Ga0207710_10070776 | Ga0207710_100707762 | 196 |
| 159 | 3300025909 | Ga0207705_10005785 | Ga0207705_1000578510 | 196 |
| 160 | 3300025909 | Ga0207705_10034982 | Ga0207705_100349825 | 196 |
| 161 | 3300025911 | Ga0207654_10000001 | Ga0207654_10000001859 | 196 |
| 162 | 3300025911 | Ga0207654_10307076 | Ga0207654_103070761 | 196 |
| 163 | 3300025913 | Ga0207695_10013731 | Ga0207695_100137317 | 196 |
| 164 | 3300025913 | Ga0207695_10081594 | Ga0207695_100815942 | 196 |
| 165 | 3300025913 | Ga0207695_10231820 | Ga0207695_102318203 | 196 |
| 166 | 3300025914 | Ga0207671_10000016 | Ga0207671_10000016150 | 196 |
| 167 | 3300025914 | Ga0207671_10242614 | Ga0207671_102426142 | 196 |
| 168 | 3300025919 | Ga0207657_10005997 | Ga0207657_1000599722 | 196 |
| 169 | 3300025924 | Ga0207694_10000057 | Ga0207694_1000005790 | 196 |
| 170 | 3300025924 | Ga0207694_10630589 | Ga0207694_106305892 | 196 |
| 171 | 3300025927 | Ga0207687_10061516 | Ga0207687_100615163 | 196 |
| 172 | 3300025931 | Ga0207644_10296308 | Ga0207644_102963083 | 196 |
| 173 | 3300025932 | Ga0207690_10000329 | Ga0207690_1000032933 | 196 |
| 174 | 3300025940 | Ga0207691_10090205 | Ga0207691_100902056 | 196 |
| 175 | 3300025941 | Ga0207711_10018074 | Ga0207711_100180746 | 196 |
| 176 | 3300025941 | Ga0207711_10380922 | Ga0207711_103809221 | 196 |
| 177 | 3300025949 | Ga0207667_10028406 | Ga0207667_100284065 | 196 |
| 178 | 3300025949 | Ga0207667_10230161 | Ga0207667_102301612 | 196 |
| 179 | 3300025986 | Ga0207658_10110808 | Ga0207658_101108082 | 196 |
| 180 | 3300026023 | Ga0207677_10030685 | Ga0207677_100306852 | 196 |
| 181 | 3300026023 | Ga0207677_10086414 | Ga0207677_100864142 | 196 |
| 182 | 3300026035 | Ga0207703_10001453 | Ga0207703_1000145326 | 196 |
| 183 | 3300026041 | Ga0207639_10194414 | Ga0207639_101944142 | 196 |
| 184 | 3300026041 | Ga0207639_10213660 | Ga0207639_102136602 | 196 |
| 185 | 3300026078 | Ga0207702_10269240 | Ga0207702_102692402 | 196 |
| 186 | 3300026088 | Ga0207641_10311261 | Ga0207641_103112612 | 196 |
| 187 | 3300026095 | Ga0207676_10015408 | Ga0207676_100154089 | 196 |
| 188 | 3300026142 | Ga0207698_10131841 | Ga0207698_101318412 | 196 |
| 189 | 3300026142 | Ga0207698_10333325 | Ga0207698_103333251 | 196 |
| 190 | 3300026142 | Ga0207698_10976140 | Ga0207698_109761402 | 196 |
| 191 | 3300031649 | Ga0307514_10106689 | Ga0307514_101066892 | 196 |
| 192 | 3300041452 | Ga0451793_1912529 | Ga0451793_1912529_370_969 | 196 |
| 193 | 3300048920 | Ga0496117_0170449 | Ga0496117_0170449_59_658 | 196 |
| 194 | 3300048921 | Ga0496118_0221872 | Ga0496118_0221872_160_762 | 196 |
| 195 | 3300048921 | Ga0496118_0271374 | Ga0496118_0271374_80_679 | 196 |
| 196 | 3300048922 | Ga0496119_0026752 | Ga0496119_0026752_889_1491 | 196 |
| 197 | 3300048923 | Ga0496120_0004152 | Ga0496120_0004152_7844_8446 | 196 |
| 198 | 3300048923 | Ga0496120_0030182 | Ga0496120_0030182_129_743 | 196 |
| 199 | 3300048923 | Ga0496120_0072478 | Ga0496120_0072478_211_810 | 196 |
| 200 | 3300048928 | Ga0496125_0132034 | Ga0496125_0132034_473_1087 | 196 |
| 201 | 3300048929 | Ga0496126_0258487 | Ga0496126_0258487_495_1094 | 196 |
| 202 | 3300053080 | Ga0500635_0061528 | Ga0500635_0061528_129_728 | 196 |
| 203 | 3300053093 | Ga0500651_0000251 | Ga0500651_0000251_28863_29462 | 196 |
| 204 | 3300053136 | Ga0500559_0000164 | Ga0500559_0000164_31240_31830 | 196 |
| 205 | 3300053148 | Ga0500590_003646 | Ga0500590_003646_4166_4765 | 196 |
| 206 | 3300009551 | Ga0105238_11080400 | Ga0105238_110804002 | 197 |
| 207 | 3300042461 | Ga0439460_0025209 | Ga0439460_0025209_102_827 | 197 |
| 208 | iso_pu_bacteria | 2870622029 | 2870622194 | 197 |
| 209 | iso_pu_bacteria | 2919523602 | 2919525409 | 197 |
| 210 | 3300003752 | Ga0055539_1000808 | Ga0055539_10008087 | 198 |
| 211 | 3300003756 | Ga0055533_1000001 | Ga0055533_10000011669 | 198 |
| 212 | 3300003759 | Ga0055525_1001846 | Ga0055525_10018462 | 198 |
| 213 | 3300003841 | Ga0055541_1005771 | Ga0055541_10057713 | 198 |
| 214 | 3300005288 | Ga0065714_10116072 | Ga0065714_101160722 | 198 |
| 215 | 3300005327 | Ga0070658_10206547 | Ga0070658_102065472 | 198 |
| 216 | 3300013104 | Ga0157370_10090732 | Ga0157370_100907324 | 198 |
| 217 | 3300013307 | Ga0157372_10277178 | Ga0157372_102771782 | 198 |
| 218 | 3300020070 | Ga0206356_11214626 | Ga0206356_112146262 | 198 |
| 219 | 3300020076 | Ga0206355_1087961 | Ga0206355_10879612 | 198 |
| 220 | 3300020080 | Ga0206350_10397450 | Ga0206350_103974502 | 198 |
| 221 | 3300020082 | Ga0206353_10187049 | Ga0206353_101870493 | 198 |
| 222 | 3300025225 | Ga0209566_100066 | Ga0209566_100066158 | 198 |
| 223 | 3300025226 | Ga0209674_100001 | Ga0209674_1000011672 | 198 |
| 224 | 3300025230 | Ga0209563_100001 | Ga0209563_1000011672 | 198 |
| 225 | 3300025253 | Ga0209677_100001 | Ga0209677_1000011672 | 198 |
| 226 | 3300025253 | Ga0209677_102161 | Ga0209677_1021612 | 198 |
| 227 | 3300025272 | Ga0209455_1003952 | Ga0209455_10039525 | 198 |
| 228 | 3300025898 | Ga0207692_10367626 | Ga0207692_103676262 | 198 |
| 229 | 3300025909 | Ga0207705_10435029 | Ga0207705_104350291 | 198 |
| 230 | 3300037312 | Ga0395899_0047194 | Ga0395899_0047194_1243_1848 | 198 |
| 231 | 3300038443 | Ga0395901_0153740 | Ga0395901_0153740_427_1032 | 198 |
| 232 | 3300044656 | Ga0466969_0065278 | Ga0466969_0065278_46_651 | 198 |
| 233 | 3300044658 | Ga0466972_0005615 | Ga0466972_0005615_4289_4894 | 198 |
| 234 | 3300044658 | Ga0466972_0231586 | Ga0466972_0231586_95_700 | 198 |
| 235 | 3300044683 | Ga0466965_0006167 | Ga0466965_0006167_1398_2003 | 198 |
| 236 | 3300044683 | Ga0466965_0119157 | Ga0466965_0119157_668_1273 | 198 |
| 237 | 3300044684 | Ga0466966_0010977 | Ga0466966_0010977_1385_1990 | 198 |
| 238 | 3300044693 | Ga0466961_0037059 | Ga0466961_0037059_1125_1730 | 198 |
| 239 | 3300044693 | Ga0466961_0420082 | Ga0466961_0420082_137_742 | 198 |
| 240 | 3300044719 | Ga0466971_0033506 | Ga0466971_0033506_1136_1741 | 198 |
| 241 | 3300044735 | Ga0466968_0049508 | Ga0466968_0049508_370_975 | 198 |
| 242 | 3300044765 | Ga0466970_0011934 | Ga0466970_0011934_2705_3310 | 198 |
| 243 | 3300044901 | Ga0466960_0009426 | Ga0466960_0009426_2643_3248 | 198 |
| 244 | 3300044901 | Ga0466960_0071660 | Ga0466960_0071660_318_923 | 198 |
| 245 | 3300045049 | Ga0466959_0039513 | Ga0466959_0039513_111_716 | 198 |
| 246 | 3300045049 | Ga0466959_0108901 | Ga0466959_0108901_542_1147 | 198 |
| 247 | 3300045836 | Ga0466958_0018252 | Ga0466958_0018252_199_804 | 198 |
| 248 | 3300045976 | Ga0466967_1408682 | Ga0466967_1408682_52_657 | 198 |
| 249 | 3300047472 | Ga0495686_0225367 | Ga0495686_0225367_223_828 | 198 |
| 250 | 3300053142 | Ga0500577_0027692 | Ga0500577_0027692_367_972 | 198 |
| 251 | 3300061719 | Ga0466962_0044293 | Ga0466962_0044293_141_746 | 198 |
| 252 | iso_pu_bacteria | 2643221649 | 2644277771 | 198 |
| 253 | iso_pu_bacteria | 2919055335 | 2919058834 | 198 |
| 254 | 3300001979 | JGI24740J21852_10051492 | JGI24740J21852_100514922 | 199 |
| 255 | 3300005337 | Ga0070682_100133859 | Ga0070682_1001338592 | 199 |
| 256 | 3300005539 | Ga0068853_101173055 | Ga0068853_1011730551 | 199 |
| 257 | 3300005563 | Ga0068855_100517692 | Ga0068855_1005176922 | 199 |
| 258 | 3300009551 | Ga0105238_10503327 | Ga0105238_105033272 | 199 |
| 259 | 3300013102 | Ga0157371_10522428 | Ga0157371_105224282 | 199 |
| 260 | 3300013105 | Ga0157369_10116153 | Ga0157369_101161532 | 199 |
| 261 | 3300025904 | Ga0207647_10028990 | Ga0207647_100289906 | 199 |
| 262 | 3300025924 | Ga0207694_10456787 | Ga0207694_104567872 | 199 |
| 263 | 3300037418 | Ga0395900_0061899 | Ga0395900_0061899_319_918 | 199 |
| 264 | 3300037466 | Ga0395898_0000381 | Ga0395898_0000381_91059_91658 | 199 |
| 265 | 3300048903 | Ga0496100_0049474 | Ga0496100_0049474_1417_2064 | 199 |
| 266 | 3300048903 | Ga0496100_0065174 | Ga0496100_0065174_246_845 | 199 |
| 267 | 3300048904 | Ga0496101_0006142 | Ga0496101_0006142_372_1019 | 199 |
| 268 | 3300048904 | Ga0496101_0043034 | Ga0496101_0043034_854_1453 | 199 |
| 269 | 3300048905 | Ga0496102_0054704 | Ga0496102_0054704_355_954 | 199 |
| 270 | 3300048905 | Ga0496102_0146097 | Ga0496102_0146097_1245_1856 | 199 |
| 271 | 3300048905 | Ga0496102_0357896 | Ga0496102_0357896_281_928 | 199 |
| 272 | 3300048906 | Ga0496103_0197804 | Ga0496103_0197804_584_1183 | 199 |
| 273 | 3300048906 | Ga0496103_0251925 | Ga0496103_0251925_329_976 | 199 |
| 274 | 3300048907 | Ga0496104_0125224 | Ga0496104_0125224_935_1534 | 199 |
| 275 | 3300048907 | Ga0496104_0794723 | Ga0496104_0794723_41_688 | 199 |
| 276 | 3300048908 | Ga0496105_0353374 | Ga0496105_0353374_362_1009 | 199 |
| 277 | 3300048917 | Ga0496114_0004840 | Ga0496114_0004840_4039_4686 | 199 |
| 278 | 3300048917 | Ga0496114_0062991 | Ga0496114_0062991_519_1118 | 199 |
| 279 | 3300048918 | Ga0496115_0021807 | Ga0496115_0021807_1210_1857 | 199 |
| 280 | 3300048918 | Ga0496115_0049042 | Ga0496115_0049042_1614_2261 | 199 |
| 281 | 3300048921 | Ga0496118_0005764 | Ga0496118_0005764_1379_1990 | 199 |
| 282 | 3300048922 | Ga0496119_0012846 | Ga0496119_0012846_395_994 | 199 |
| 283 | 3300048923 | Ga0496120_0111370 | Ga0496120_0111370_469_1068 | 199 |
| 284 | 3300048924 | Ga0496121_0272397 | Ga0496121_0272397_30_629 | 199 |
| 285 | 3300048929 | Ga0496126_0090337 | Ga0496126_0090337_1593_2240 | 199 |
| 286 | 3300049568 | Ga0501031_0002050 | Ga0501031_0002050_1240_1863 | 199 |
| 287 | 3300049569 | Ga0501032_0014751 | Ga0501032_0014751_2104_2727 | 199 |
| 288 | 3300049570 | Ga0501033_0002214 | Ga0501033_0002214_5475_6098 | 199 |
| 289 | 3300049571 | Ga0501034_0011202 | Ga0501034_0011202_5197_5820 | 199 |
| 290 | 3300049572 | Ga0501036_0005365 | Ga0501036_0005365_4561_5184 | 199 |
| 291 | 3300049573 | Ga0501037_0001422 | Ga0501037_0001422_12538_13161 | 199 |
| 292 | 3300049574 | Ga0501038_0003511 | Ga0501038_0003511_10362_10985 | 199 |
| 293 | 3300049575 | Ga0501039_0021748 | Ga0501039_0021748_1660_2283 | 199 |
| 294 | 3300049579 | Ga0501043_0007553 | Ga0501043_0007553_4511_5134 | 199 |
| 295 | 3300049580 | Ga0501046_0003203 | Ga0501046_0003203_4175_4798 | 199 |
| 296 | 3300049581 | Ga0501047_0016213 | Ga0501047_0016213_4511_5134 | 199 |
| 297 | 3300049582 | Ga0501048_0026066 | Ga0501048_0026066_205_828 | 199 |
| 298 | 3300049584 | Ga0501068_0123838 | Ga0501068_0123838_568_1191 | 199 |
| 299 | 3300049586 | Ga0501070_0007064 | Ga0501070_0007064_6697_7320 | 199 |
| 300 | 3300049589 | Ga0501073_0045898 | Ga0501073_0045898_1071_1694 | 199 |
| 301 | 3300049822 | Ga0501035_0037104 | Ga0501035_0037104_1976_2599 | 199 |
| 302 | 3300049823 | Ga0501044_0001531 | Ga0501044_0001531_5143_5766 | 199 |
| 303 | iso_pu_bacteria | 2585428094 | 2587863678 | 199 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3adk-assembly1.cif.gz_A | refined structure of porcine cytosolic adenylate kinase at 2.1 angstroms resolution | 0.8956 | 1 | 184 |
| 2cdn-assembly1.cif.gz_A | crystal structure of mycobacterium tuberculosis adenylate kinase complexed with two molecules of adp and mg | 0.8831 | 2 | 184 |
| 2ak2-assembly1.cif.gz_A | adenylate kinase isoenzyme-2 | 0.8777 | 2 | 187 |
| 2c9y-assembly1.cif.gz_A | structure of human adenylate kinase 2 | 0.876 | 2 | 187 |
| 1dvr-assembly1.cif.gz_B | structure of a mutant adenylate kinase ligated with an atp-analogue showing domain closure over atp | 0.8616 | 1 | 189 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6H6N6_28_186_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9383 | 2 | 123 | 3.40.50.300 |
| af_P9WKF5_1_180_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8794 | 2 | 183 | 3.40.50.300 |
| 1ak2A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8772 | 2 | 187 | 3.40.50.300 |
| af_A0A1D6MYG3_1_117_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8625 | 132 | 184 | 3.40.50.300 |
| 1tevA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8584 | 2 | 187 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6L5F1D8-F1-model_v4 | Adenylate kinase (EC 2.7.4.3) | 0.9944 | 2 | 114 |
GO:0004017
GO:0005524 GO:0005737 |
| AF-A0A499UYH4-F1-model_v4 | Adenylate kinase (AK) (EC 2.7.4.3) (ATP-AMP transphosphorylase) (ATP:AMP phosphotransferase) (Adenylate monophosphate kinase) | 0.9894 | 2 | 114 |
GO:0004017
GO:0005524 GO:0005737 GO:0044209 |
| AF-A0A0H4T6H9-F1-model_v4 | Adenylate kinase (EC 2.7.4.3) | 0.9754 | 2 | 123 |
GO:0004017
GO:0005524 GO:0005737 GO:0043231 |
| AF-A0A7Z9L6Z8-F1-model_v4 | Adenylate kinase (AK) (EC 2.7.4.3) (ATP-AMP transphosphorylase) (ATP:AMP phosphotransferase) (Adenylate monophosphate kinase) | 0.9747 | 2 | 187 |
GO:0004017
GO:0005524 GO:0005737 GO:0044209 |
| AF-A0A3D5AS70-F1-model_v4 | Adenylate kinase (EC 2.7.4.3) | 0.9746 | 2 | 123 |
GO:0004017
GO:0005524 GO:0005737 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar