F397115

General Info

Members Datasets Scaffolds Average Seq Length
303 156 303 161

Family's Representative Sequence

Representative Sequence 3300031852|Ga0307410_10363422|Ga0307410_103634222
Length 173
Sequence MISASDEIRTERLLLRRASMDDAAAMHVIMSDPRAMRYWSTPPHADLNETKKWMASMVEAHPAGSDDFIVTLDGKLIGKLGAWKLPEVGFLIDPAHWGHGYAMEAMAAFVDRRRSLGSTELNADVDPRNAASLSLLKRHGFVETGRATDTWQVGDELCDSIYLQLRLQTSNQP

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
7 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
8 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
9 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
116 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
117 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
118 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
119 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
120 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
124 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
125 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
126 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
131 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
132 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
133 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
134 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
135 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
136 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
137 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
138 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
139 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
140 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
141 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
142 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
143 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
146 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
147 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
148 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
149 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
150 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
151 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
152 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
153 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
154 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
155 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
156 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.32
Nodule 0
Rhizoplane 0.66
Rhizosphere 97.69
Stem 0
Stem Tuber 0
Unclassified 0.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_11398603 2162886012 Bacteria 840
2 MBSR1b_contig_3336001 2162886012 Bacteria 813
3 JGI24741J21665_1007285 3300001915 Bacteria 2154
4 JGI24739J22299_10010060 3300001989 Bacteria 3516
5 JGI24737J22298_10013141 3300001990 Bacteria 2697
6 JGI24735J21928_10004503 3300002067 Bacteria 4686
7 JGI24749J21850_1000582 3300002076 Bacteria 5320
8 JGI24033J26618_1033390 3300002155 Unclassified 699
9 JGI24034J26672_10031962 3300002239 Unclassified 861
10 JGI24751J29686_10067196 3300002459 Bacteria 738
11 Ga0065715_10008756 3300005293 Bacteria 3294
12 Ga0065715_10110693 3300005293 Bacteria 2607
13 Ga0070658_10012333 3300005327 Bacteria 6863
14 Ga0070658_10029736 3300005327 Bacteria 4390
15 Ga0070658_10307408 3300005327 Bacteria 1353
16 Ga0070658_10752110 3300005327 Bacteria 846
17 Ga0070676_10001868 3300005328 Bacteria 10722
18 Ga0070683_100005317 3300005329 Bacteria 10729
19 Ga0070670_100007934 3300005331 Bacteria 9032
20 Ga0070670_100028640 3300005331 Bacteria 4794
21 Ga0070670_100218350 3300005331 Bacteria 1658
22 Ga0070677_10009393 3300005333 Bacteria 3314
23 Ga0070666_10335530 3300005335 Bacteria 1080
24 Ga0070682_100092069 3300005337 Bacteria 1986
25 Ga0070660_100055586 3300005339 Bacteria 3059
26 Ga0070660_100245676 3300005339 Bacteria 1458
27 Ga0070660_100328017 3300005339 Bacteria 1258
28 Ga0070660_100615336 3300005339 Bacteria 909
29 Ga0070660_100813722 3300005339 Unclassified 786
30 Ga0070689_101759035 3300005340 Bacteria 565
31 Ga0070687_100054300 3300005343 Bacteria 2087
32 Ga0070661_100018486 3300005344 Bacteria 4955
33 Ga0070661_100224620 3300005344 Bacteria 1441
34 Ga0070668_100009036 3300005347 Bacteria 7401
35 Ga0070668_100109332 3300005347 Bacteria 2199
36 Ga0070668_100569959 3300005347 Bacteria 987
37 Ga0070669_100026150 3300005353 Bacteria 4198
38 Ga0070675_100011940 3300005354 Bacteria 6807
39 Ga0070675_100033838 3300005354 Bacteria 4144
40 Ga0070671_100002390 3300005355 Bacteria 14507
41 Ga0070671_100005519 3300005355 Bacteria 10075
42 Ga0070674_100001014 3300005356 Bacteria 14649
43 Ga0070673_100049559 3300005364 Bacteria 3279
44 Ga0070673_100106848 3300005364 Bacteria 2315
45 Ga0070673_101041433 3300005364 Bacteria 763
46 Ga0070659_100199442 3300005366 Bacteria 1647
47 Ga0070659_100514502 3300005366 Bacteria 1021
48 Ga0070659_100579936 3300005366 Bacteria 962
49 Ga0070667_100034546 3300005367 Bacteria 4231
50 Ga0070667_100248868 3300005367 Bacteria 1589
51 Ga0070701_10060277 3300005438 Bacteria 1998
52 Ga0070700_100035412 3300005441 Bacteria 3021
53 Ga0070663_100000647 3300005455 Bacteria 18662
54 Ga0070663_100037935 3300005455 Bacteria 3357
55 Ga0070663_100051739 3300005455 Bacteria 2927
56 Ga0070663_100148134 3300005455 Bacteria 1797
57 Ga0070663_100171172 3300005455 Bacteria 1679
58 Ga0070678_100387975 3300005456 Bacteria 1210
59 Ga0070678_101507091 3300005456 Unclassified 630
60 Ga0070662_100120229 3300005457 Bacteria 2012
61 Ga0070662_100227739 3300005457 Bacteria 1490
62 Ga0070681_10261263 3300005458 Bacteria 1643
63 Ga0070681_10394541 3300005458 Bacteria 1295
64 Ga0068867_100030761 3300005459 Bacteria 3873
65 Ga0070679_100532653 3300005530 Bacteria 1118
66 Ga0070684_100814401 3300005535 Bacteria 873
67 Ga0068853_100136137 3300005539 Bacteria 2202
68 Ga0070672_100079151 3300005543 Bacteria 2630
69 Ga0070693_100486000 3300005547 Bacteria 873
70 Ga0070665_100000287 3300005548 Bacteria 79790
71 Ga0070665_100976945 3300005548 Bacteria 859
72 Ga0068855_100164215 3300005563 Bacteria 2518
73 Ga0070664_100009565 3300005564 Bacteria 7860
74 Ga0070664_100014775 3300005564 Bacteria 6374
75 Ga0070664_100196603 3300005564 Bacteria 1798
76 Ga0068857_100161767 3300005577 Bacteria 2032
77 Ga0068857_101184382 3300005577 Bacteria 739
78 Ga0068854_100009024 3300005578 Bacteria 6426
79 Ga0068854_100056425 3300005578 Bacteria 2831
80 Ga0068852_100100950 3300005616 Bacteria 2604
81 Ga0068852_101758772 3300005616 Unclassified 642
82 Ga0068859_100043828 3300005617 Bacteria 4497
83 Ga0068864_100102995 3300005618 Bacteria 2534
84 Ga0068861_100032431 3300005719 Bacteria 3845
85 Ga0068851_10310763 3300005834 Bacteria 908
86 Ga0068870_10067691 3300005840 Bacteria 1938
87 Ga0068863_100326614 3300005841 Bacteria 1491
88 Ga0068860_100216078 3300005843 Bacteria 1861
89 Ga0068862_100017749 3300005844 Bacteria 5922
90 Ga0068862_101751810 3300005844 Unclassified 630
91 Ga0068871_101284331 3300006358 Unclassified 688
92 Ga0097620_100043828 3300006931 Bacteria 4497
93 Ga0111539_10209601 3300009094 Bacteria 2271
94 Ga0105243_10179469 3300009148 Bacteria 1840
95 Ga0105248_10092046 3300009177 Bacteria 3415
96 Ga0105248_10218047 3300009177 Bacteria 2149
97 Ga0105238_10503864 3300009551 Bacteria 1212
98 Ga0105249_10566031 3300009553 Bacteria 1188
99 Ga0157373_10030437 3300013100 Bacteria 3885
100 Ga0157373_10119254 3300013100 Bacteria 1854
101 Ga0157371_10150888 3300013102 Bacteria 1657
102 Ga0157371_10538350 3300013102 Bacteria 865
103 Ga0163162_10140026 3300013306 Bacteria 2532
104 Ga0163162_10326353 3300013306 Bacteria 1667
105 Ga0157372_10374582 3300013307 Bacteria 1659
106 Ga0157375_10040045 3300013308 Bacteria 4514
107 Ga0157375_10416974 3300013308 Bacteria 1509
108 Ga0163163_10178086 3300014325 Bacteria 2173
109 Ga0163163_11236200 3300014325 Bacteria 809
110 Ga0157380_10049819 3300014326 Bacteria 3305
111 Ga0157377_10060327 3300014745 Bacteria 2165
112 Ga0163161_10043144 3300017792 Bacteria 3247
113 Ga0163161_10048582 3300017792 Bacteria 3064
114 Ga0163161_10058701 3300017792 Bacteria 2796
115 Ga0207666_1011539 3300025271 Bacteria 1223
116 Ga0207697_10002920 3300025315 Bacteria 8649
117 Ga0207682_10001545 3300025893 Bacteria 10571
118 Ga0207688_10101086 3300025901 Bacteria 1665
119 Ga0207688_10467460 3300025901 Bacteria 788
120 Ga0207688_10518110 3300025901 Bacteria 748
121 Ga0207645_10001759 3300025907 Bacteria 17570
122 Ga0207705_10000626 3300025909 Bacteria 29530
123 Ga0207705_10265515 3300025909 Bacteria 1311
124 Ga0207705_10335555 3300025909 Bacteria 1163
125 Ga0207707_10350519 3300025912 Bacteria 1272
126 Ga0207660_10030032 3300025917 Bacteria 3733
127 Ga0207662_10092917 3300025918 Bacteria 1858
128 Ga0207657_10002103 3300025919 Bacteria 21540
129 Ga0207657_10271806 3300025919 Bacteria 1347
130 Ga0207657_10676468 3300025919 Bacteria 802
131 Ga0207649_10027120 3300025920 Bacteria 3359
132 Ga0207649_10085368 3300025920 Bacteria 2054
133 Ga0207652_10294963 3300025921 Bacteria 1463
134 Ga0207681_10008577 3300025923 Bacteria 6242
135 Ga0207681_10018291 3300025923 Bacteria 4415
136 Ga0207681_10196972 3300025923 Bacteria 1545
137 Ga0207650_10006476 3300025925 Bacteria 7976
138 Ga0207650_10011559 3300025925 Bacteria 6078
139 Ga0207650_10046437 3300025925 Bacteria 3198
140 Ga0207650_10457937 3300025925 Bacteria 1062
141 Ga0207650_10755564 3300025925 Unclassified 823
142 Ga0207659_10001933 3300025926 Bacteria 12291
143 Ga0207659_10075750 3300025926 Bacteria 2470
144 Ga0207644_10006552 3300025931 Bacteria 7587
145 Ga0207644_10228222 3300025931 Bacteria 1478
146 Ga0207690_10002369 3300025932 Bacteria 11421
147 Ga0207690_10508977 3300025932 Bacteria 975
148 Ga0207690_10630512 3300025932 Bacteria 877
149 Ga0207706_10000434 3300025933 Bacteria 44818
150 Ga0207706_10001464 3300025933 Bacteria 23592
151 Ga0207706_10094166 3300025933 Bacteria 2635
152 Ga0207669_10023245 3300025937 Bacteria 3308
153 Ga0207691_10012290 3300025940 Bacteria 8206
154 Ga0207711_10318268 3300025941 Bacteria 1437
155 Ga0207661_10728373 3300025944 Bacteria 912
156 Ga0207679_10047302 3300025945 Bacteria 3124
157 Ga0207679_10355357 3300025945 Bacteria 1278
158 Ga0207667_10183486 3300025949 Bacteria 2148
159 Ga0207651_10031984 3300025960 Bacteria 3372
160 Ga0207651_10322030 3300025960 Bacteria 1292
161 Ga0207712_10571703 3300025961 Bacteria 974
162 Ga0207668_10002511 3300025972 Bacteria 10714
163 Ga0207668_10458727 3300025972 Bacteria 1089
164 Ga0207640_10017926 3300025981 Bacteria 4150
165 Ga0207640_10074301 3300025981 Bacteria 2300
166 Ga0207658_10049744 3300025986 Bacteria 3081
167 Ga0207703_11680755 3300026035 Bacteria 611
168 Ga0207639_10062157 3300026041 Bacteria 2886
169 Ga0207639_11460789 3300026041 Bacteria 642
170 Ga0207678_10032284 3300026067 Bacteria 4563
171 Ga0207678_10047272 3300026067 Bacteria 3722
172 Ga0207678_10091584 3300026067 Bacteria 2599
173 Ga0207678_10097869 3300026067 Bacteria 2507
174 Ga0207678_10368472 3300026067 Bacteria 1241
175 Ga0207708_10129759 3300026075 Bacteria 1970
176 Ga0207676_10667620 3300026095 Bacteria 1004
177 Ga0207674_10011531 3300026116 Bacteria 9928
178 Ga0207674_10172233 3300026116 Bacteria 2118
179 Ga0207675_100012364 3300026118 Bacteria 7973
180 Ga0207683_10132502 3300026121 Bacteria 2242
181 Ga0209974_10017094 3300027876 Bacteria 2406
182 Ga0209974_10257320 3300027876 Bacteria 658
183 Ga0268266_10003483 3300028379 Bacteria 15673
184 Ga0268266_10095307 3300028379 Bacteria 2614
185 Ga0268266_10211130 3300028379 Bacteria 1780
186 Ga0268265_10039822 3300028380 Bacteria 3466
187 Ga0268264_10412315 3300028381 Bacteria 1301
188 Ga0307513_10166495 3300031456 Bacteria 2088
189 Ga0307408_100070650 3300031548 Bacteria 2578
190 Ga0307408_100105075 3300031548 Bacteria 2158
191 Ga0307408_100202484 3300031548 Bacteria 1608
192 Ga0307405_10010063 3300031731 Bacteria 4880
193 Ga0307405_10053803 3300031731 Bacteria 2509
194 Ga0307405_10130217 3300031731 Bacteria 1737
195 Ga0307405_10332076 3300031731 Bacteria 1165
196 Ga0307405_10373789 3300031731 Bacteria 1107
197 Ga0307413_10004257 3300031824 Bacteria 6196
198 Ga0307413_10010906 3300031824 Bacteria 4437
199 Ga0307413_10040000 3300031824 Bacteria 2732
200 Ga0307413_10058973 3300031824 Bacteria 2356
201 Ga0307413_10145491 3300031824 Bacteria 1644
202 Ga0307413_10247435 3300031824 Bacteria 1320
203 Ga0307413_10286323 3300031824 Bacteria 1242
204 Ga0307410_10000869 3300031852 Bacteria 12877
205 Ga0307410_10002068 3300031852 Bacteria 9496
206 Ga0307410_10046518 3300031852 Bacteria 2895
207 Ga0307410_10199003 3300031852 Bacteria 1528
208 Ga0307410_10210112 3300031852 Bacteria 1490
209 Ga0307410_10239124 3300031852 Bacteria 1406
210 Ga0307410_10363422 3300031852 Bacteria 1160
211 Ga0307410_10381990 3300031852 Unclassified 1133
212 Ga0307410_10800961 3300031852 Unclassified 801
213 Ga0307406_10210128 3300031901 Bacteria 1439
214 Ga0307407_10002454 3300031903 Bacteria 7266
215 Ga0307407_10004209 3300031903 Bacteria 6071
216 Ga0307407_10049901 3300031903 Bacteria 2391
217 Ga0307407_10068876 3300031903 Bacteria 2098
218 Ga0307407_10491522 3300031903 Bacteria 898
219 Ga0307412_10076680 3300031911 Bacteria 2297
220 Ga0307412_10138380 3300031911 Bacteria 1779
221 Ga0307412_10203794 3300031911 Bacteria 1504
222 Ga0307412_10337457 3300031911 Bacteria 1205
223 Ga0307412_10374029 3300031911 Bacteria 1151
224 Ga0307412_10488577 3300031911 Bacteria 1022
225 Ga0307412_10898102 3300031911 Bacteria 776
226 Ga0307409_100007161 3300031995 Bacteria 6644
227 Ga0307409_100013504 3300031995 Bacteria 5260
228 Ga0307409_100074306 3300031995 Bacteria 2716
229 Ga0307409_100227334 3300031995 Bacteria 1689
230 Ga0307409_101468990 3300031995 Bacteria 709
231 Ga0307409_102340749 3300031995 Unclassified 563
232 Ga0307416_100001984 3300032002 Bacteria 11477
233 Ga0307416_100010137 3300032002 Bacteria 6210
234 Ga0307416_100011395 3300032002 Bacteria 5927
235 Ga0307416_100023651 3300032002 Bacteria 4464
236 Ga0307416_100173591 3300032002 Bacteria 2010
237 Ga0307416_100331652 3300032002 Bacteria 1529
238 Ga0307416_100611374 3300032002 Unclassified 1171
239 Ga0307416_100773381 3300032002 Bacteria 1054
240 Ga0307416_102561016 3300032002 Bacteria 608
241 Ga0307414_10001114 3300032004 Bacteria 13723
242 Ga0307414_10010549 3300032004 Bacteria 5369
243 Ga0307414_10028391 3300032004 Bacteria 3629
244 Ga0307414_10047658 3300032004 Bacteria 2951
245 Ga0307414_10071514 3300032004 Bacteria 2502
246 Ga0307414_10097136 3300032004 Bacteria 2206
247 Ga0307414_10140072 3300032004 Bacteria 1892
248 Ga0307414_10271437 3300032004 Bacteria 1421
249 Ga0307414_10413433 3300032004 Bacteria 1175
250 Ga0307414_10479026 3300032004 Bacteria 1097
251 Ga0307414_10626365 3300032004 Bacteria 967
252 Ga0307414_10811980 3300032004 Bacteria 853
253 Ga0307411_10002865 3300032005 Bacteria 7795
254 Ga0307411_10004456 3300032005 Bacteria 6710
255 Ga0307411_10032646 3300032005 Bacteria 3219
256 Ga0307411_10121228 3300032005 Bacteria 1892
257 Ga0307411_10135916 3300032005 Bacteria 1805
258 Ga0307411_10207680 3300032005 Bacteria 1509
259 Ga0307411_10361276 3300032005 Bacteria 1187
260 Ga0307411_10369393 3300032005 Bacteria 1176
261 Ga0307411_10496055 3300032005 Bacteria 1031
262 Ga0307415_100005363 3300032126 Bacteria 6798
263 Ga0307415_100017872 3300032126 Bacteria 4264
264 Ga0307415_100162781 3300032126 Bacteria 1731
265 Ga0307415_101431390 3300032126 Bacteria 659
266 Ga0307415_101522874 3300032126 Bacteria 640
267 Ga0395899_0031248 3300037312 Bacteria 4003
268 Ga0395900_0020983 3300037418 Bacteria 6677
269 Ga0395905_0000538 3300037471 Bacteria 51665
270 Ga0395905_0017244 3300037471 Bacteria 6859
271 Ga0395905_0319896 3300037471 Bacteria 1441
272 Ga0395901_0005322 3300038443 Bacteria 13005
273 Ga0439465_0065757 3300041413 Bacteria 1208
274 Ga0439445_0000476 3300042004 Bacteria 8124
275 Ga0439432_057137 3300042006 Bacteria 1208
276 Ga0439458_0041129 3300042157 Bacteria 1122
277 Ga0495620_0076536 3300046515 Bacteria 1360
278 Ga0495663_0003408 3300046525 Bacteria 4588
279 Ga0495642_0084552 3300046528 Bacteria 1339
280 Ga0495598_0014299 3300046537 Bacteria 1983
281 Ga0495621_0000347 3300046539 Bacteria 11286
282 Ga0495621_0004543 3300046539 Bacteria 3913
283 Ga0495633_0050406 3300046558 Bacteria 1963
284 Ga0495633_0455278 3300046558 Unclassified 578
285 Ga0495668_0213621 3300046616 Bacteria 1056
286 Ga0495668_0250761 3300046616 Bacteria 969
287 Ga0495669_0031478 3300046684 Bacteria 2330
288 Ga0495670_0005563 3300046691 Bacteria 6183
289 Ga0495681_0153617 3300047470 Bacteria 964
290 Ga0496109_0567272 3300048912 Bacteria 1070
291 Ga0496111_0016780 3300048914 Bacteria 5052
292 Ga0501224_038818 3300049664 Bacteria 718
293 Ga0501249_057227 3300049679 Bacteria 900
294 Ga0501249_136800 3300049679 Bacteria 608
295 Ga0501221_119780 3300049704 Bacteria 671
296 Ga0501225_0023510 3300049705 Bacteria 1698
297 Ga0501268_110842 3300049765 Unclassified 598
298 Ga0501272_025285 3300049769 Bacteria 732
299 Ga0495655_0030058 3300053083 Bacteria 1311
300 Ga0500568_0014736 3300053139 Bacteria 3519
301 Ga0500604_0000040 3300053151 Bacteria 49952
302 Ga0500616_0001034 3300053153 Bacteria 29477
303 Ga0500587_006638 3300053739 Bacteria 1528

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300017792 Ga0163161_10058701 Ga0163161_100587016 132
2 3300005364 Ga0070673_101041433 Ga0070673_1010414331 138
3 3300005456 Ga0070678_100387975 Ga0070678_1003879752 138
4 3300025901 Ga0207688_10467460 Ga0207688_104674602 138
5 3300053083 Ga0495655_0030058 Ga0495655_0030058_327_758 138
6 3300002459 JGI24751J29686_10067196 JGI24751J29686_100671961 142
7 3300005327 Ga0070658_10307408 Ga0070658_103074081 142
8 3300005543 Ga0070672_100079151 Ga0070672_1000791513 142
9 3300005578 Ga0068854_100056425 Ga0068854_1000564252 142
10 3300005616 Ga0068852_101758772 Ga0068852_1017587721 142
11 3300005617 Ga0068859_100043828 Ga0068859_1000438283 142
12 3300005719 Ga0068861_100032431 Ga0068861_1000324314 142
13 3300005840 Ga0068870_10067691 Ga0068870_100676913 142
14 3300005841 Ga0068863_100326614 Ga0068863_1003266142 142
15 3300005844 Ga0068862_100017749 Ga0068862_1000177496 142
16 3300006931 Ga0097620_100043828 Ga0097620_1000438285 142
17 3300017792 Ga0163161_10043144 Ga0163161_100431443 142
18 3300025271 Ga0207666_1011539 Ga0207666_10115392 142
19 3300025315 Ga0207697_10002920 Ga0207697_1000292011 142
20 3300025893 Ga0207682_10001545 Ga0207682_1000154510 142
21 3300025907 Ga0207645_10001759 Ga0207645_100017593 142
22 3300025909 Ga0207705_10265515 Ga0207705_102655152 142
23 3300025918 Ga0207662_10092917 Ga0207662_100929172 142
24 3300025923 Ga0207681_10008577 Ga0207681_100085776 142
25 3300025925 Ga0207650_10011559 Ga0207650_100115594 142
26 3300025925 Ga0207650_10046437 Ga0207650_100464374 142
27 3300025926 Ga0207659_10001933 Ga0207659_100019337 142
28 3300025931 Ga0207644_10228222 Ga0207644_102282222 142
29 3300025933 Ga0207706_10000434 Ga0207706_100004344 142
30 3300025937 Ga0207669_10023245 Ga0207669_100232454 142
31 3300025940 Ga0207691_10012290 Ga0207691_1001229011 142
32 3300025960 Ga0207651_10322030 Ga0207651_103220302 142
33 3300025972 Ga0207668_10002511 Ga0207668_100025113 142
34 3300025981 Ga0207640_10017926 Ga0207640_100179262 142
35 3300025986 Ga0207658_10049744 Ga0207658_100497443 142
36 3300026035 Ga0207703_11680755 Ga0207703_116807552 142
37 3300026067 Ga0207678_10047272 Ga0207678_100472722 142
38 3300026067 Ga0207678_10368472 Ga0207678_103684722 142
39 3300026075 Ga0207708_10129759 Ga0207708_101297593 142
40 3300026095 Ga0207676_10667620 Ga0207676_106676202 142
41 3300026116 Ga0207674_10172233 Ga0207674_101722333 142
42 3300026118 Ga0207675_100012364 Ga0207675_10001236410 142
43 3300026121 Ga0207683_10132502 Ga0207683_101325022 142
44 3300028380 Ga0268265_10039822 Ga0268265_100398224 142
45 3300028381 Ga0268264_10412315 Ga0268264_104123152 142
46 3300031911 Ga0307412_10076680 Ga0307412_100766804 142
47 3300049765 Ga0501268_110842 Ga0501268_110842_30_458 142
48 3300032126 Ga0307415_101431390 Ga0307415_1014313902 148
49 3300046616 Ga0495668_0250761 Ga0495668_0250761_123_587 149
50 3300013102 Ga0157371_10538350 Ga0157371_105383502 156
51 3300046616 Ga0495668_0213621 Ga0495668_0213621_27_524 160
52 3300005456 Ga0070678_101507091 Ga0070678_1015070911 161
53 3300031456 Ga0307513_10166495 Ga0307513_101664952 161
54 3300053139 Ga0500568_0014736 Ga0500568_0014736_1380_1886 161
55 3300053151 Ga0500604_0000040 Ga0500604_0000040_7033_7539 161
56 3300053153 Ga0500616_0001034 Ga0500616_0001034_17019_17525 161
57 3300005331 Ga0070670_100218350 Ga0070670_1002183503 162
58 3300005339 Ga0070660_100245676 Ga0070660_1002456762 162
59 3300005844 Ga0068862_101751810 Ga0068862_1017518102 162
60 3300013100 Ga0157373_10119254 Ga0157373_101192542 162
61 3300025925 Ga0207650_10457937 Ga0207650_104579372 162
62 3300032126 Ga0307415_100162781 Ga0307415_1001627812 162
63 3300046515 Ga0495620_0076536 Ga0495620_0076536_132_641 162
64 2162886012 MBSR1b_contig_11398603 MBSR1b_0095.00002480 163
65 2162886012 MBSR1b_contig_3336001 MBSR1b_0796.00000670 163
66 3300001915 JGI24741J21665_1007285 JGI24741J21665_10072852 163
67 3300001989 JGI24739J22299_10010060 JGI24739J22299_100100603 163
68 3300001990 JGI24737J22298_10013141 JGI24737J22298_100131413 163
69 3300002067 JGI24735J21928_10004503 JGI24735J21928_100045035 163
70 3300002076 JGI24749J21850_1000582 JGI24749J21850_10005826 163
71 3300002155 JGI24033J26618_1033390 JGI24033J26618_10333902 163
72 3300002239 JGI24034J26672_10031962 JGI24034J26672_100319622 163
73 3300005293 Ga0065715_10008756 Ga0065715_100087564 163
74 3300005293 Ga0065715_10110693 Ga0065715_101106932 163
75 3300005327 Ga0070658_10012333 Ga0070658_100123332 163
76 3300005327 Ga0070658_10029736 Ga0070658_100297364 163
77 3300005327 Ga0070658_10752110 Ga0070658_107521102 163
78 3300005328 Ga0070676_10001868 Ga0070676_1000186812 163
79 3300005329 Ga0070683_100005317 Ga0070683_10000531712 163
80 3300005331 Ga0070670_100007934 Ga0070670_1000079343 163
81 3300005331 Ga0070670_100028640 Ga0070670_1000286404 163
82 3300005333 Ga0070677_10009393 Ga0070677_100093933 163
83 3300005335 Ga0070666_10335530 Ga0070666_103355302 163
84 3300005337 Ga0070682_100092069 Ga0070682_1000920692 163
85 3300005339 Ga0070660_100055586 Ga0070660_1000555863 163
86 3300005339 Ga0070660_100328017 Ga0070660_1003280172 163
87 3300005339 Ga0070660_100615336 Ga0070660_1006153361 163
88 3300005339 Ga0070660_100813722 Ga0070660_1008137222 163
89 3300005340 Ga0070689_101759035 Ga0070689_1017590351 163
90 3300005343 Ga0070687_100054300 Ga0070687_1000543003 163
91 3300005344 Ga0070661_100018486 Ga0070661_1000184865 163
92 3300005344 Ga0070661_100224620 Ga0070661_1002246202 163
93 3300005347 Ga0070668_100009036 Ga0070668_1000090364 163
94 3300005347 Ga0070668_100109332 Ga0070668_1001093321 163
95 3300005347 Ga0070668_100569959 Ga0070668_1005699591 163
96 3300005353 Ga0070669_100026150 Ga0070669_1000261504 163
97 3300005354 Ga0070675_100011940 Ga0070675_1000119405 163
98 3300005354 Ga0070675_100033838 Ga0070675_1000338384 163
99 3300005355 Ga0070671_100002390 Ga0070671_1000023907 163
100 3300005355 Ga0070671_100005519 Ga0070671_1000055195 163
101 3300005356 Ga0070674_100001014 Ga0070674_10000101416 163
102 3300005364 Ga0070673_100049559 Ga0070673_1000495594 163
103 3300005364 Ga0070673_100106848 Ga0070673_1001068482 163
104 3300005366 Ga0070659_100199442 Ga0070659_1001994422 163
105 3300005366 Ga0070659_100514502 Ga0070659_1005145022 163
106 3300005366 Ga0070659_100579936 Ga0070659_1005799362 163
107 3300005367 Ga0070667_100034546 Ga0070667_1000345465 163
108 3300005367 Ga0070667_100248868 Ga0070667_1002488683 163
109 3300005438 Ga0070701_10060277 Ga0070701_100602772 163
110 3300005441 Ga0070700_100035412 Ga0070700_1000354124 163
111 3300005455 Ga0070663_100000647 Ga0070663_10000064713 163
112 3300005455 Ga0070663_100037935 Ga0070663_1000379351 163
113 3300005455 Ga0070663_100051739 Ga0070663_1000517393 163
114 3300005455 Ga0070663_100148134 Ga0070663_1001481342 163
115 3300005455 Ga0070663_100171172 Ga0070663_1001711722 163
116 3300005457 Ga0070662_100120229 Ga0070662_1001202292 163
117 3300005457 Ga0070662_100227739 Ga0070662_1002277392 163
118 3300005458 Ga0070681_10261263 Ga0070681_102612633 163
119 3300005458 Ga0070681_10394541 Ga0070681_103945412 163
120 3300005459 Ga0068867_100030761 Ga0068867_1000307614 163
121 3300005530 Ga0070679_100532653 Ga0070679_1005326532 163
122 3300005535 Ga0070684_100814401 Ga0070684_1008144011 163
123 3300005539 Ga0068853_100136137 Ga0068853_1001361372 163
124 3300005547 Ga0070693_100486000 Ga0070693_1004860002 163
125 3300005548 Ga0070665_100000287 Ga0070665_1000002877 163
126 3300005548 Ga0070665_100976945 Ga0070665_1009769452 163
127 3300005563 Ga0068855_100164215 Ga0068855_1001642152 163
128 3300005564 Ga0070664_100009565 Ga0070664_1000095657 163
129 3300005564 Ga0070664_100014775 Ga0070664_1000147758 163
130 3300005564 Ga0070664_100196603 Ga0070664_1001966033 163
131 3300005577 Ga0068857_100161767 Ga0068857_1001617674 163
132 3300005577 Ga0068857_101184382 Ga0068857_1011843822 163
133 3300005578 Ga0068854_100009024 Ga0068854_1000090242 163
134 3300005616 Ga0068852_100100950 Ga0068852_1001009504 163
135 3300005618 Ga0068864_100102995 Ga0068864_1001029952 163
136 3300005834 Ga0068851_10310763 Ga0068851_103107632 163
137 3300005843 Ga0068860_100216078 Ga0068860_1002160784 163
138 3300006358 Ga0068871_101284331 Ga0068871_1012843312 163
139 3300009094 Ga0111539_10209601 Ga0111539_102096013 163
140 3300009148 Ga0105243_10179469 Ga0105243_101794692 163
141 3300009177 Ga0105248_10092046 Ga0105248_100920463 163
142 3300009177 Ga0105248_10218047 Ga0105248_102180472 163
143 3300009551 Ga0105238_10503864 Ga0105238_105038642 163
144 3300009553 Ga0105249_10566031 Ga0105249_105660312 163
145 3300013100 Ga0157373_10030437 Ga0157373_100304372 163
146 3300013102 Ga0157371_10150888 Ga0157371_101508882 163
147 3300013306 Ga0163162_10140026 Ga0163162_101400262 163
148 3300013306 Ga0163162_10326353 Ga0163162_103263533 163
149 3300013307 Ga0157372_10374582 Ga0157372_103745822 163
150 3300013308 Ga0157375_10040045 Ga0157375_100400455 163
151 3300013308 Ga0157375_10416974 Ga0157375_104169742 163
152 3300014325 Ga0163163_10178086 Ga0163163_101780862 163
153 3300014325 Ga0163163_11236200 Ga0163163_112362002 163
154 3300014326 Ga0157380_10049819 Ga0157380_100498193 163
155 3300014745 Ga0157377_10060327 Ga0157377_100603273 163
156 3300017792 Ga0163161_10048582 Ga0163161_100485824 163
157 3300025901 Ga0207688_10101086 Ga0207688_101010863 163
158 3300025901 Ga0207688_10518110 Ga0207688_105181101 163
159 3300025909 Ga0207705_10000626 Ga0207705_1000062622 163
160 3300025909 Ga0207705_10335555 Ga0207705_103355552 163
161 3300025912 Ga0207707_10350519 Ga0207707_103505192 163
162 3300025917 Ga0207660_10030032 Ga0207660_100300322 163
163 3300025919 Ga0207657_10002103 Ga0207657_1000210313 163
164 3300025919 Ga0207657_10271806 Ga0207657_102718062 163
165 3300025919 Ga0207657_10676468 Ga0207657_106764682 163
166 3300025920 Ga0207649_10027120 Ga0207649_100271201 163
167 3300025920 Ga0207649_10085368 Ga0207649_100853684 163
168 3300025921 Ga0207652_10294963 Ga0207652_102949632 163
169 3300025923 Ga0207681_10018291 Ga0207681_100182914 163
170 3300025923 Ga0207681_10196972 Ga0207681_101969722 163
171 3300025925 Ga0207650_10006476 Ga0207650_100064769 163
172 3300025925 Ga0207650_10755564 Ga0207650_107555642 163
173 3300025926 Ga0207659_10075750 Ga0207659_100757502 163
174 3300025931 Ga0207644_10006552 Ga0207644_100065526 163
175 3300025932 Ga0207690_10002369 Ga0207690_100023695 163
176 3300025932 Ga0207690_10508977 Ga0207690_105089772 163
177 3300025932 Ga0207690_10630512 Ga0207690_106305121 163
178 3300025933 Ga0207706_10001464 Ga0207706_1000146425 163
179 3300025933 Ga0207706_10094166 Ga0207706_100941665 163
180 3300025941 Ga0207711_10318268 Ga0207711_103182682 163
181 3300025944 Ga0207661_10728373 Ga0207661_107283732 163
182 3300025945 Ga0207679_10047302 Ga0207679_100473026 163
183 3300025945 Ga0207679_10355357 Ga0207679_103553572 163
184 3300025949 Ga0207667_10183486 Ga0207667_101834862 163
185 3300025960 Ga0207651_10031984 Ga0207651_100319843 163
186 3300025961 Ga0207712_10571703 Ga0207712_105717032 163
187 3300025972 Ga0207668_10458727 Ga0207668_104587272 163
188 3300025981 Ga0207640_10074301 Ga0207640_100743012 163
189 3300026041 Ga0207639_10062157 Ga0207639_100621572 163
190 3300026041 Ga0207639_11460789 Ga0207639_114607892 163
191 3300026067 Ga0207678_10032284 Ga0207678_100322849 163
192 3300026067 Ga0207678_10091584 Ga0207678_100915842 163
193 3300026067 Ga0207678_10097869 Ga0207678_100978692 163
194 3300026116 Ga0207674_10011531 Ga0207674_1001153113 163
195 3300027876 Ga0209974_10017094 Ga0209974_100170945 163
196 3300027876 Ga0209974_10257320 Ga0209974_102573201 163
197 3300028379 Ga0268266_10003483 Ga0268266_100034837 163
198 3300028379 Ga0268266_10095307 Ga0268266_100953075 163
199 3300028379 Ga0268266_10211130 Ga0268266_102111302 163
200 3300031548 Ga0307408_100070650 Ga0307408_1000706504 163
201 3300031548 Ga0307408_100105075 Ga0307408_1001050754 163
202 3300031548 Ga0307408_100202484 Ga0307408_1002024842 163
203 3300031731 Ga0307405_10010063 Ga0307405_100100633 163
204 3300031731 Ga0307405_10053803 Ga0307405_100538035 163
205 3300031731 Ga0307405_10130217 Ga0307405_101302173 163
206 3300031731 Ga0307405_10332076 Ga0307405_103320762 163
207 3300031731 Ga0307405_10373789 Ga0307405_103737892 163
208 3300031824 Ga0307413_10004257 Ga0307413_100042573 163
209 3300031824 Ga0307413_10010906 Ga0307413_100109063 163
210 3300031824 Ga0307413_10040000 Ga0307413_100400004 163
211 3300031824 Ga0307413_10058973 Ga0307413_100589734 163
212 3300031824 Ga0307413_10145491 Ga0307413_101454913 163
213 3300031824 Ga0307413_10247435 Ga0307413_102474352 163
214 3300031824 Ga0307413_10286323 Ga0307413_102863232 163
215 3300031852 Ga0307410_10000869 Ga0307410_100008695 163
216 3300031852 Ga0307410_10002068 Ga0307410_100020686 163
217 3300031852 Ga0307410_10046518 Ga0307410_100465182 163
218 3300031852 Ga0307410_10199003 Ga0307410_101990032 163
219 3300031852 Ga0307410_10210112 Ga0307410_102101122 163
220 3300031852 Ga0307410_10239124 Ga0307410_102391242 163
221 3300031852 Ga0307410_10363422 Ga0307410_103634222 163
222 3300031852 Ga0307410_10381990 Ga0307410_103819902 163
223 3300031852 Ga0307410_10800961 Ga0307410_108009612 163
224 3300031901 Ga0307406_10210128 Ga0307406_102101282 163
225 3300031903 Ga0307407_10002454 Ga0307407_100024542 163
226 3300031903 Ga0307407_10004209 Ga0307407_100042094 163
227 3300031903 Ga0307407_10049901 Ga0307407_100499012 163
228 3300031903 Ga0307407_10068876 Ga0307407_100688761 163
229 3300031903 Ga0307407_10491522 Ga0307407_104915221 163
230 3300031911 Ga0307412_10138380 Ga0307412_101383802 163
231 3300031911 Ga0307412_10203794 Ga0307412_102037941 163
232 3300031911 Ga0307412_10337457 Ga0307412_103374572 163
233 3300031911 Ga0307412_10374029 Ga0307412_103740292 163
234 3300031911 Ga0307412_10488577 Ga0307412_104885772 163
235 3300031911 Ga0307412_10898102 Ga0307412_108981022 163
236 3300031995 Ga0307409_100007161 Ga0307409_1000071612 163
237 3300031995 Ga0307409_100013504 Ga0307409_1000135046 163
238 3300031995 Ga0307409_100074306 Ga0307409_1000743063 163
239 3300031995 Ga0307409_100227334 Ga0307409_1002273342 163
240 3300031995 Ga0307409_101468990 Ga0307409_1014689902 163
241 3300031995 Ga0307409_102340749 Ga0307409_1023407491 163
242 3300032002 Ga0307416_100001984 Ga0307416_1000019845 163
243 3300032002 Ga0307416_100010137 Ga0307416_1000101372 163
244 3300032002 Ga0307416_100011395 Ga0307416_1000113954 163
245 3300032002 Ga0307416_100023651 Ga0307416_1000236515 163
246 3300032002 Ga0307416_100173591 Ga0307416_1001735912 163
247 3300032002 Ga0307416_100331652 Ga0307416_1003316522 163
248 3300032002 Ga0307416_100611374 Ga0307416_1006113742 163
249 3300032002 Ga0307416_100773381 Ga0307416_1007733812 163
250 3300032002 Ga0307416_102561016 Ga0307416_1025610161 163
251 3300032004 Ga0307414_10001114 Ga0307414_1000111411 163
252 3300032004 Ga0307414_10010549 Ga0307414_100105494 163
253 3300032004 Ga0307414_10028391 Ga0307414_100283914 163
254 3300032004 Ga0307414_10047658 Ga0307414_100476583 163
255 3300032004 Ga0307414_10071514 Ga0307414_100715143 163
256 3300032004 Ga0307414_10097136 Ga0307414_100971363 163
257 3300032004 Ga0307414_10140072 Ga0307414_101400722 163
258 3300032004 Ga0307414_10271437 Ga0307414_102714372 163
259 3300032004 Ga0307414_10413433 Ga0307414_104134332 163
260 3300032004 Ga0307414_10479026 Ga0307414_104790262 163
261 3300032004 Ga0307414_10626365 Ga0307414_106263652 163
262 3300032004 Ga0307414_10811980 Ga0307414_108119802 163
263 3300032005 Ga0307411_10002865 Ga0307411_100028659 163
264 3300032005 Ga0307411_10004456 Ga0307411_100044564 163
265 3300032005 Ga0307411_10032646 Ga0307411_100326464 163
266 3300032005 Ga0307411_10121228 Ga0307411_101212283 163
267 3300032005 Ga0307411_10135916 Ga0307411_101359163 163
268 3300032005 Ga0307411_10207680 Ga0307411_102076802 163
269 3300032005 Ga0307411_10361276 Ga0307411_103612761 163
270 3300032005 Ga0307411_10369393 Ga0307411_103693932 163
271 3300032005 Ga0307411_10496055 Ga0307411_104960552 163
272 3300032126 Ga0307415_100005363 Ga0307415_10000536310 163
273 3300032126 Ga0307415_100017872 Ga0307415_1000178725 163
274 3300032126 Ga0307415_101522874 Ga0307415_1015228741 163
275 3300037312 Ga0395899_0031248 Ga0395899_0031248_3344_3847 163
276 3300037418 Ga0395900_0020983 Ga0395900_0020983_3143_3646 163
277 3300037471 Ga0395905_0000538 Ga0395905_0000538_15349_15852 163
278 3300037471 Ga0395905_0017244 Ga0395905_0017244_582_1094 163
279 3300037471 Ga0395905_0319896 Ga0395905_0319896_336_842 163
280 3300038443 Ga0395901_0005322 Ga0395901_0005322_10077_10580 163
281 3300041413 Ga0439465_0065757 Ga0439465_0065757_165_659 163
282 3300042004 Ga0439445_0000476 Ga0439445_0000476_7334_7864 163
283 3300042006 Ga0439432_057137 Ga0439432_057137_608_1102 163
284 3300042157 Ga0439458_0041129 Ga0439458_0041129_478_975 163
285 3300046525 Ga0495663_0003408 Ga0495663_0003408_1841_2341 163
286 3300046528 Ga0495642_0084552 Ga0495642_0084552_712_1212 163
287 3300046537 Ga0495598_0014299 Ga0495598_0014299_599_1090 163
288 3300046539 Ga0495621_0000347 Ga0495621_0000347_3537_4028 163
289 3300046539 Ga0495621_0004543 Ga0495621_0004543_1194_1694 163
290 3300046558 Ga0495633_0050406 Ga0495633_0050406_970_1470 163
291 3300046558 Ga0495633_0455278 Ga0495633_0455278_31_531 163
292 3300046684 Ga0495669_0031478 Ga0495669_0031478_212_706 163
293 3300046691 Ga0495670_0005563 Ga0495670_0005563_2460_2960 163
294 3300047470 Ga0495681_0153617 Ga0495681_0153617_120_620 163
295 3300048912 Ga0496109_0567272 Ga0496109_0567272_277_771 163
296 3300048914 Ga0496111_0016780 Ga0496111_0016780_4425_4919 163
297 3300049664 Ga0501224_038818 Ga0501224_038818_160_660 163
298 3300049679 Ga0501249_057227 Ga0501249_057227_336_830 163
299 3300049679 Ga0501249_136800 Ga0501249_136800_20_514 163
300 3300049704 Ga0501221_119780 Ga0501221_119780_17_511 163
301 3300049705 Ga0501225_0023510 Ga0501225_0023510_699_1193 163
302 3300049769 Ga0501272_025285 Ga0501272_025285_54_548 163
303 3300053739 Ga0500587_006638 Ga0500587_006638_20_526 163

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

12

142

0.91

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

24

141

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7f-assembly1.cif.gz_A-2 riml- ribosomal l7/l12 alpha-n-protein acetyltransferase crystal form i (apo) 0.9062 2 163
1z9u-assembly1.cif.gz_A structural genomics, the crystal structure of the acetyl transferase, modifies n-terminal serine of 50s ribosomal subunit protein l7/l12 from salmonella typhimurium 0.9016 2 163
1s7n-assembly1.cif.gz_B ribosomal l7/l12 alpha-n-protein acetyltransferase in complex with coenzyme a (coa free sulfhydryl) 0.9007 2 163
1s7f-assembly1.cif.gz_A-2 riml- ribosomal l7/l12 alpha-n-protein acetyltransferase crystal form i (apo) 0.8956 2 163
1z9u-assembly1.cif.gz_A structural genomics, the crystal structure of the acetyl transferase, modifies n-terminal serine of 50s ribosomal subunit protein l7/l12 from salmonella typhimurium 0.8913 2 163
ID Description Score Start End Superfamily
af_A0A1D6QIS1_205_278_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9404 98 163 3.40.630.30
af_C7IYZ1_1_59_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.94 113 163 3.40.630.30
af_A0A0R0LDP2_1_100_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9304 90 163 3.40.630.30
af_Q54L65_11_183_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9238 4 161 3.40.630.30
af_A0A0R0ECR9_59_131_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9213 96 162 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A4Q3C4F6-F1-model_v4 N-acetyltransferase 0.986 1 161 GO:0016747
AF-A0A0B5EJD4-F1-model_v4 PFQ25.10c 0.9809 83 163 GO:0016747
AF-A0A7U2K869-F1-model_v4 deleted 0.9771 1 162
AF-A0A4Q3C4F6-F1-model_v4 N-acetyltransferase 0.974 1 161 GO:0016747
AF-A0A2N3BUN3-F1-model_v4 N-acetyltransferase 0.9729 1 162 GO:0016747

Feature Viewer

pLDDT pTM Quality
95.15 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map