F397039

General Info

Members Datasets Scaffolds Average Seq Length
303 177 299 90

Family's Representative Sequence

Representative Sequence 3300021361|Ga0213872_10002216|Ga0213872_100022168
Length 89
Sequence MVKSEVEIINKLGLHARASSKFTQLASRFQSEIFISRNNRRVNGKSIMGVMMLAAAKGSLVELEVSGSDEETALAALVALINNRFDESE

Samples

Sample ID Description Type Environment
1 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
2 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
3 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
4 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
66 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
67 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
94 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
95 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
96 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
97 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
98 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
99 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
100 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
101 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
102 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
103 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
104 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
105 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
106 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
107 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
108 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
109 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
110 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
111 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
112 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
113 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
114 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
115 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
116 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
117 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
118 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
119 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
120 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
121 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
122 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
123 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
124 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
125 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
126 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
127 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
128 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
129 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
132 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
133 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
134 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
135 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
136 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
137 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
138 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
139 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
140 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
141 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
142 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
143 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
144 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
145 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
146 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
147 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
148 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
149 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
150 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
151 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
152 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
153 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
154 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
155 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
156 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
157 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
158 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
159 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
160 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
161 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
162 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
163 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
164 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
165 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
166 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
167 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
168 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
169 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
170 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
171 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
172 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
173 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
174 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
175 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
176 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
177 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.68
Metatranscriptomes 0
Isolates 1.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.01
Stem 0
Stem Tuber 0
Unclassified 0.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10818367 3300005295 Bacteria 593
2 Ga0070690_100221403 3300005330 Bacteria 1326
3 Ga0070690_100345323 3300005330 Bacteria 1079
4 Ga0070690_101379055 3300005330 Bacteria 567
5 Ga0070670_100008171 3300005331 Bacteria 8911
6 Ga0068869_100770794 3300005334 Bacteria 825
7 Ga0070680_100227703 3300005336 Bacteria 1574
8 Ga0070680_101285305 3300005336 Bacteria 633
9 Ga0068868_100931680 3300005338 Bacteria 791
10 Ga0070689_100008751 3300005340 Bacteria 7145
11 Ga0070689_100036622 3300005340 Bacteria 3753
12 Ga0070687_100001487 3300005343 Bacteria 8264
13 Ga0070673_100001982 3300005364 Bacteria 12351
14 Ga0070673_100224505 3300005364 Bacteria 1627
15 Ga0070688_100001308 3300005365 Bacteria 12418
16 Ga0070688_100007546 3300005365 Bacteria 5869
17 Ga0070688_100027557 3300005365 Bacteria 3385
18 Ga0070703_10142216 3300005406 Bacteria 893
19 Ga0070709_10195299 3300005434 Bacteria 1430
20 Ga0070714_100005932 3300005435 Bacteria 9378
21 Ga0070713_101138544 3300005436 Bacteria 755
22 Ga0070710_10300151 3300005437 Bacteria 1048
23 Ga0070710_11357021 3300005437 Bacteria 530
24 Ga0070701_10044707 3300005438 Bacteria 2269
25 Ga0070701_10411696 3300005438 Bacteria 859
26 Ga0070711_101273746 3300005439 Bacteria 637
27 Ga0070705_100298938 3300005440 Bacteria 1153
28 Ga0070705_101253793 3300005440 Bacteria 613
29 Ga0070694_100011578 3300005444 Bacteria 5462
30 Ga0070694_100831578 3300005444 Bacteria 759
31 Ga0070662_101543408 3300005457 Bacteria 573
32 Ga0070685_10016116 3300005466 Bacteria 3977
33 Ga0070685_10545246 3300005466 Bacteria 827
34 Ga0070706_100250940 3300005467 Bacteria 1652
35 Ga0070707_100436675 3300005468 Bacteria 1270
36 Ga0070698_100049368 3300005471 Bacteria 4295
37 Ga0070698_100111320 3300005471 Bacteria 2703
38 Ga0070698_100221173 3300005471 Bacteria 1827
39 Ga0070697_100733922 3300005536 Bacteria 872
40 Ga0070697_101038030 3300005536 Bacteria 729
41 Ga0070686_100049353 3300005544 Bacteria 2670
42 Ga0070686_100074693 3300005544 Bacteria 2228
43 Ga0070686_100132465 3300005544 Bacteria 1726
44 Ga0070686_100822382 3300005544 Bacteria 750
45 Ga0070695_100529100 3300005545 Bacteria 916
46 Ga0070695_100803113 3300005545 Bacteria 754
47 Ga0070696_100489275 3300005546 Bacteria 977
48 Ga0070704_100100964 3300005549 Bacteria 2173
49 Ga0070704_100135616 3300005549 Bacteria 1914
50 Ga0070704_100213176 3300005549 Bacteria 1566
51 Ga0070704_100257644 3300005549 Bacteria 1435
52 Ga0070704_100380569 3300005549 Bacteria 1199
53 Ga0070704_101567956 3300005549 Bacteria 607
54 Ga0068857_100060708 3300005577 Bacteria 3358
55 Ga0068857_100463546 3300005577 Bacteria 1186
56 Ga0070702_100078121 3300005615 Bacteria 1975
57 Ga0068859_100031558 3300005617 Bacteria 5321
58 Ga0068859_101267809 3300005617 Bacteria 812
59 Ga0068864_100809702 3300005618 Bacteria 921
60 Ga0068864_100929979 3300005618 Bacteria 860
61 Ga0068864_100974481 3300005618 Bacteria 840
62 Ga0068861_100088071 3300005719 Bacteria 2444
63 Ga0068861_100435734 3300005719 Bacteria 1171
64 Ga0068863_100123517 3300005841 Bacteria 2470
65 Ga0068863_101183403 3300005841 Bacteria 770
66 Ga0068858_101676955 3300005842 Bacteria 628
67 Ga0068860_100059072 3300005843 Bacteria 3647
68 Ga0068860_100732394 3300005843 Bacteria 1000
69 Ga0068862_100596651 3300005844 Bacteria 1060
70 Ga0075432_10287964 3300006058 Bacteria 678
71 Ga0070715_10002722 3300006163 Bacteria 5484
72 Ga0070712_100851499 3300006175 Bacteria 784
73 Ga0097621_100532036 3300006237 Bacteria 1068
74 Ga0075428_100008369 3300006844 Bacteria 11468
75 Ga0075428_100039561 3300006844 Bacteria 5190
76 Ga0075430_100121965 3300006846 Bacteria 2173
77 Ga0075431_100046392 3300006847 Bacteria 4481
78 Ga0075431_100320886 3300006847 Bacteria 1562
79 Ga0075431_100569333 3300006847 Bacteria 1119
80 Ga0075433_10002549 3300006852 Bacteria 13874
81 Ga0075433_10361192 3300006852 Bacteria 1283
82 Ga0075433_10521053 3300006852 Bacteria 1046
83 Ga0075433_10643234 3300006852 Bacteria 930
84 Ga0075434_100010991 3300006871 Bacteria 8515
85 Ga0075434_100015087 3300006871 Bacteria 7399
86 Ga0075434_100116834 3300006871 Bacteria 2681
87 Ga0075434_100240374 3300006871 Bacteria 1831
88 Ga0075434_100254756 3300006871 Bacteria 1774
89 Ga0075434_101379465 3300006871 Bacteria 715
90 Ga0075429_100029203 3300006880 Bacteria 4789
91 Ga0075429_100761816 3300006880 Bacteria 848
92 Ga0075429_101131472 3300006880 Bacteria 684
93 Ga0075436_100118523 3300006914 Bacteria 1851
94 Ga0075436_100667461 3300006914 Bacteria 769
95 Ga0097620_100031556 3300006931 Bacteria 5321
96 Ga0097620_101268022 3300006931 Bacteria 812
97 Ga0075435_100008129 3300007076 Bacteria 7513
98 Ga0075435_100557213 3300007076 Bacteria 993
99 Ga0075435_100721204 3300007076 Bacteria 867
100 Ga0111539_10480656 3300009094 Bacteria 1447
101 Ga0111539_11563901 3300009094 Bacteria 765
102 Ga0114129_10404259 3300009147 Bacteria 1799
103 Ga0114129_10443475 3300009147 Bacteria 1704
104 Ga0114129_10812873 3300009147 Bacteria 1191
105 Ga0114129_10938605 3300009147 Bacteria 1094
106 Ga0105248_10097560 3300009177 Bacteria 3311
107 Ga0105248_12120480 3300009177 Bacteria 639
108 Ga0157378_10002035 3300013297 Bacteria 18105
109 Ga0157375_10060856 3300013308 Bacteria 3747
110 Ga0163163_11976506 3300014325 Bacteria 643
111 Ga0157380_10794376 3300014326 Bacteria 963
112 Ga0157377_10191227 3300014745 Bacteria 1293
113 Ga0157379_10073691 3300014968 Bacteria 3056
114 Ga0213872_10002216 3300021361 Bacteria 11627
115 Ga0213872_10009966 3300021361 Bacteria 4535
116 Ga0213876_10000316 3300021384 Bacteria 42531
117 Ga0207653_10036025 3300025885 Bacteria 1611
118 Ga0207653_10108580 3300025885 Bacteria 989
119 Ga0207685_10000988 3300025905 Bacteria 5494
120 Ga0207685_10297472 3300025905 Bacteria 797
121 Ga0207699_10100603 3300025906 Bacteria 1833
122 Ga0207684_10179993 3300025910 Bacteria 1823
123 Ga0207660_10426423 3300025917 Bacteria 1070
124 Ga0207662_10003172 3300025918 Bacteria 8407
125 Ga0207646_11005571 3300025922 Bacteria 737
126 Ga0207646_11302889 3300025922 Bacteria 634
127 Ga0207650_10048389 3300025925 Bacteria 3136
128 Ga0207687_10497312 3300025927 Unclassified 1017
129 Ga0207700_10254410 3300025928 Bacteria 1501
130 Ga0207670_10000150 3300025936 Bacteria 45960
131 Ga0207670_10038423 3300025936 Bacteria 3126
132 Ga0207670_10107384 3300025936 Bacteria 2004
133 Ga0207670_11222478 3300025936 Bacteria 636
134 Ga0207711_10200528 3300025941 Bacteria 1820
135 Ga0207711_10388529 3300025941 Bacteria 1295
136 Ga0207689_11722760 3300025942 Bacteria 519
137 Ga0207651_10021422 3300025960 Bacteria 3929
138 Ga0207651_10670840 3300025960 Bacteria 911
139 Ga0207640_10787901 3300025981 Bacteria 822
140 Ga0207677_10718739 3300026023 Bacteria 888
141 Ga0207703_11283595 3300026035 Bacteria 704
142 Ga0207703_12025456 3300026035 Bacteria 552
143 Ga0207708_10046567 3300026075 Bacteria 3302
144 Ga0207708_10219434 3300026075 Bacteria 1523
145 Ga0207641_10089444 3300026088 Bacteria 2691
146 Ga0207648_10033351 3300026089 Bacteria 4542
147 Ga0207676_10104176 3300026095 Bacteria 2359
148 Ga0207674_10509378 3300026116 Bacteria 1163
149 Ga0207674_10644087 3300026116 Bacteria 1023
150 Ga0207675_100136478 3300026118 Bacteria 2328
151 Ga0207675_101040984 3300026118 Bacteria 837
152 Ga0207428_10128793 3300027907 Bacteria 1937
153 Ga0207428_10572025 3300027907 Bacteria 816
154 Ga0268265_10121339 3300028380 Bacteria 2154
155 Ga0268265_11024548 3300028380 Bacteria 816
156 Ga0268264_10317062 3300028381 Bacteria 1473
157 Ga0268264_11207305 3300028381 Bacteria 766
158 Ga0265338_10106581 3300028800 Bacteria 2268
159 Ga0316578_10900014 3300031728 Bacteria 511
160 Ga0373948_0125443 3300034817 Bacteria 624
161 Ga0373929_0095046 3300035085 Bacteria 745
162 Ga0373934_0016971 3300035086 Bacteria 2773
163 Ga0373934_0067455 3300035086 Bacteria 1429
164 Ga0373934_0087721 3300035086 Bacteria 1252
165 Ga0373940_0214160 3300035088 Bacteria 638
166 Ga0373949_0077557 3300035090 Bacteria 880
167 Ga0373952_0225627 3300035092 Bacteria 558
168 Ga0373923_0017093 3300035111 Bacteria 2768
169 Ga0373939_0154720 3300035114 Bacteria 837
170 Ga0373941_0189476 3300035115 Bacteria 776
171 Ga0373945_0103602 3300035116 Bacteria 1116
172 Ga0373953_0038134 3300035117 Bacteria 1899
173 Ga0373953_0123929 3300035117 Bacteria 1099
174 Ga0373953_0272966 3300035117 Bacteria 736
175 Ga0373954_0012221 3300035118 Bacteria 3817
176 Ga0373954_0146989 3300035118 Bacteria 1151
177 Ga0373956_0070061 3300035119 Bacteria 1599
178 Ga0373956_0288059 3300035119 Bacteria 782
179 Ga0373957_0021336 3300035120 Bacteria 2298
180 Ga0373957_0152432 3300035120 Bacteria 949
181 Ga0373943_0428959 3300035170 Bacteria 766
182 Ga0373943_0614666 3300035170 Bacteria 641
183 Ga0373955_0008893 3300035172 Bacteria 4683
184 Ga0373961_0063920 3300035241 Bacteria 1124
185 Ga0373961_0236110 3300035241 Bacteria 657
186 Ga0373962_0131189 3300035242 Bacteria 807
187 Ga0373924_0041614 3300035410 Bacteria 1883
188 Ga0373933_0070821 3300035724 Bacteria 2121
189 Ga0373933_1037097 3300035724 Bacteria 540
190 Ga0373937_0012824 3300036401 Bacteria 7382
191 Ga0373937_0120245 3300036401 Bacteria 2447
192 Ga0436365_0585577 3300039437 Bacteria 67545
193 Ga0436361_0106919 3300039447 Bacteria 16754
194 Ga0436361_0510397 3300039447 Bacteria 1922
195 Ga0436361_0554014 3300039447 Bacteria 63849
196 Ga0436363_0265221 3300039450 Bacteria 1701
197 Ga0451577_0063582 3300042876 Bacteria 3291
198 Ga0451577_0075871 3300042876 Bacteria 2998
199 Ga0451577_0495984 3300042876 Bacteria 1109
200 Ga0466969_0000918 3300044656 Bacteria 15881
201 Ga0466969_0450012 3300044656 Bacteria 586
202 Ga0453683_0620325 3300044673 Bacteria 706
203 Ga0466965_0005425 3300044683 Bacteria 5746
204 Ga0466966_0101332 3300044684 Bacteria 1780
205 Ga0466961_0000218 3300044693 Bacteria 38766
206 Ga0466964_0024334 3300044706 Bacteria 2360
207 Ga0453684_1989093 3300044712 Bacteria 586
208 Ga0466968_0094468 3300044735 Bacteria 1329
209 Ga0466970_0117190 3300044765 Bacteria 1457
210 Ga0466959_0003320 3300045049 Bacteria 10505
211 Ga0451576_0028314 3300045051 Bacteria 6003
212 Ga0451576_0077715 3300045051 Bacteria 3454
213 Ga0451576_0296570 3300045051 Bacteria 1690
214 Ga0451576_0307985 3300045051 Bacteria 1657
215 Ga0451576_0723512 3300045051 Bacteria 1046
216 Ga0451576_0858881 3300045051 Bacteria 952
217 Ga0451576_0958759 3300045051 Bacteria 897
218 Ga0451576_1318607 3300045051 Bacteria 752
219 Ga0451576_1961478 3300045051 Bacteria 603
220 Ga0495592_0048706 3300046454 Bacteria 3151
221 Ga0495603_0190418 3300046455 Bacteria 1186
222 Ga0495629_0479430 3300046459 Bacteria 840
223 Ga0495651_0263682 3300046462 Bacteria 1171
224 Ga0495653_0034890 3300046463 Bacteria 3973
225 Ga0495653_0548175 3300046463 Bacteria 716
226 Ga0495582_0112044 3300046473 Bacteria 1533
227 Ga0495639_0166610 3300046475 Bacteria 1068
228 Ga0495662_0105249 3300046476 Bacteria 1381
229 Ga0495594_0594330 3300046499 Bacteria 627
230 Ga0495608_0002219 3300046511 Bacteria 14016
231 Ga0495618_0018437 3300046514 Bacteria 4285
232 Ga0495628_0028212 3300046516 Bacteria 4562
233 Ga0495628_0254095 3300046516 Bacteria 1311
234 Ga0495628_0485640 3300046516 Bacteria 893
235 Ga0495666_0074525 3300046526 Bacteria 1610
236 Ga0495640_0529199 3300046533 Bacteria 716
237 Ga0495640_0662301 3300046533 Bacteria 628
238 Ga0495621_0131154 3300046539 Bacteria 975
239 Ga0495667_0008208 3300046559 Bacteria 7086
240 Ga0495634_0062650 3300046642 Bacteria 2469
241 Ga0495634_0345380 3300046642 Bacteria 892
242 Ga0495635_0082279 3300046663 Bacteria 2203
243 Ga0495635_0884324 3300046663 Bacteria 573
244 Ga0495659_0202348 3300046664 Bacteria 815
245 Ga0495657_0028597 3300046675 Bacteria 3918
246 Ga0495599_0058096 3300046678 Bacteria 2420
247 Ga0495599_0400263 3300046678 Bacteria 818
248 Ga0495647_0163158 3300046681 Bacteria 961
249 Ga0495658_0145701 3300046683 Bacteria 1451
250 Ga0495658_0153007 3300046683 Bacteria 1418
251 Ga0495613_0408210 3300046689 Bacteria 926
252 Ga0495613_0717565 3300046689 Bacteria 657
253 Ga0495600_0031600 3300046809 Bacteria 3431
254 Ga0495600_0241500 3300046809 Bacteria 1151
255 Ga0495581_0070063 3300047315 Bacteria 2028
256 Ga0495581_0213538 3300047315 Bacteria 1128
257 Ga0495604_0218018 3300047317 Bacteria 1315
258 Ga0495676_0594439 3300047321 Bacteria 721
259 Ga0495680_0811073 3300047322 Bacteria 610
260 Ga0495675_0004531 3300047444 Bacteria 8425
261 Ga0495684_0437674 3300047471 Bacteria 911
262 Ga0495684_0486707 3300047471 Bacteria 851
263 Ga0501068_0982257 3300049584 Bacteria 557
264 Ga0501073_0179078 3300049589 Bacteria 1467
265 Ga0501079_1047170 3300049741 Bacteria 643
266 nmdc:mga05p37_141587_c1 3300050507 Bacteria 2946
267 nmdc:mga05p37_551377_c1 3300050507 Bacteria 1312
268 nmdc:mga05p37_987640_c1 3300050507 Bacteria 896
269 nmdc:mga09592_15493_c1 3300050508 Bacteria 6231
270 nmdc:mga09592_200587_c1 3300050508 Bacteria 1728
271 nmdc:mga09592_614184_c1 3300050508 Bacteria 931
272 nmdc:mga09592_65397_c1 3300050508 Bacteria 3081
273 nmdc:mga0qj67_110211_c1 3300050509 Bacteria 2222
274 nmdc:mga06r32_47802_c1 3300050510 Bacteria 4088
275 nmdc:mga06r32_596186_c1 3300050510 Bacteria 1076
276 nmdc:mga08y16_211435_c1 3300050511 Bacteria 2009
277 nmdc:mga08y16_721501_c1 3300050511 Bacteria 995
278 nmdc:mga08y16_80580_c1 3300050511 Bacteria 3394
279 nmdc:mga0n895_11343_c1 3300050512 Bacteria 7942
280 nmdc:mga0n895_127033_c1 3300050512 Bacteria 2574
281 nmdc:mga0n895_256177_c1 3300050512 Bacteria 1776
282 nmdc:mga0n895_487497_c1 3300050512 Bacteria 1243
283 nmdc:mga0n895_599136_c1 3300050512 Bacteria 1104
284 nmdc:mga0n895_640016_c1 3300050512 Bacteria 1063
285 nmdc:mga0rr50_13224_c1 3300050513 Bacteria 5367
286 nmdc:mga0rr50_135741_c2 3300050513 Bacteria 867
287 nmdc:mga0rr50_247402_c1 3300050513 Bacteria 1479
288 nmdc:mga0rr50_941966_c1 3300050513 Bacteria 736
289 nmdc:mga08x19_604970_c1 3300050514 Bacteria 777
290 nmdc:mga0a205_4506_c1 3300050515 Bacteria 12501
291 nmdc:mga0a205_49553_c1 3300050515 Bacteria 4054
292 nmdc:mga0a205_512465_c1 3300050515 Bacteria 1056
293 nmdc:mga0a205_597046_c1 3300050515 Bacteria 957
294 Ga0495601_0345289 3300053077 Bacteria 968
295 Ga0495601_0700129 3300053077 Bacteria 646
296 Ga0495595_0000291 3300053084 Bacteria 19527
297 Ga0495619_0035882 3300053085 Bacteria 3227
298 Ga0495619_0448864 3300053085 Bacteria 889
299 Ga0530510_1096495 3300061734 Bacteria 610

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006852 Ga0075433_10643234 Ga0075433_106432342 83
2 3300006880 Ga0075429_101131472 Ga0075429_1011314721 83
3 3300005331 Ga0070670_100008171 Ga0070670_1000081713 84
4 3300025925 Ga0207650_10048389 Ga0207650_100483895 84
5 3300045051 Ga0451576_0028314 Ga0451576_0028314_83_337 84
6 iso_pu_bacteria 2547132103 2547371183 85
7 iso_pu_bacteria 2843690924 2843695008 85
8 iso_pu_bacteria 2846033681 2846037379 85
9 iso_pu_bacteria 2846037992 2846038103 85
10 3300009177 Ga0105248_12120480 Ga0105248_121204801 86
11 3300049584 Ga0501068_0982257 Ga0501068_0982257_229_489 86
12 3300005435 Ga0070714_100005932 Ga0070714_10000593211 88
13 3300005436 Ga0070713_101138544 Ga0070713_1011385442 88
14 3300005437 Ga0070710_10300151 Ga0070710_103001512 88
15 3300005439 Ga0070711_101273746 Ga0070711_1012737461 88
16 3300006175 Ga0070712_100851499 Ga0070712_1008514992 88
17 3300025928 Ga0207700_10254410 Ga0207700_102544102 88
18 3300025981 Ga0207640_10787901 Ga0207640_107879012 88
19 3300035241 Ga0373961_0063920 Ga0373961_0063920_12_278 88
20 3300005295 Ga0065707_10818367 Ga0065707_108183672 89
21 3300005330 Ga0070690_100221403 Ga0070690_1002214032 89
22 3300005330 Ga0070690_100345323 Ga0070690_1003453231 89
23 3300005330 Ga0070690_101379055 Ga0070690_1013790551 89
24 3300005334 Ga0068869_100770794 Ga0068869_1007707941 89
25 3300005336 Ga0070680_100227703 Ga0070680_1002277032 89
26 3300005336 Ga0070680_101285305 Ga0070680_1012853051 89
27 3300005338 Ga0068868_100931680 Ga0068868_1009316801 89
28 3300005340 Ga0070689_100008751 Ga0070689_1000087513 89
29 3300005340 Ga0070689_100036622 Ga0070689_1000366224 89
30 3300005343 Ga0070687_100001487 Ga0070687_10000148711 89
31 3300005364 Ga0070673_100001982 Ga0070673_1000019827 89
32 3300005364 Ga0070673_100224505 Ga0070673_1002245052 89
33 3300005365 Ga0070688_100001308 Ga0070688_10000130811 89
34 3300005365 Ga0070688_100007546 Ga0070688_1000075468 89
35 3300005365 Ga0070688_100027557 Ga0070688_1000275574 89
36 3300005406 Ga0070703_10142216 Ga0070703_101422162 89
37 3300005434 Ga0070709_10195299 Ga0070709_101952992 89
38 3300005437 Ga0070710_11357021 Ga0070710_113570212 89
39 3300005438 Ga0070701_10044707 Ga0070701_100447072 89
40 3300005438 Ga0070701_10411696 Ga0070701_104116962 89
41 3300005440 Ga0070705_100298938 Ga0070705_1002989382 89
42 3300005440 Ga0070705_101253793 Ga0070705_1012537932 89
43 3300005444 Ga0070694_100011578 Ga0070694_1000115782 89
44 3300005444 Ga0070694_100831578 Ga0070694_1008315781 89
45 3300005457 Ga0070662_101543408 Ga0070662_1015434081 89
46 3300005466 Ga0070685_10016116 Ga0070685_100161162 89
47 3300005466 Ga0070685_10545246 Ga0070685_105452462 89
48 3300005467 Ga0070706_100250940 Ga0070706_1002509402 89
49 3300005468 Ga0070707_100436675 Ga0070707_1004366752 89
50 3300005471 Ga0070698_100049368 Ga0070698_1000493684 89
51 3300005471 Ga0070698_100111320 Ga0070698_1001113202 89
52 3300005471 Ga0070698_100221173 Ga0070698_1002211733 89
53 3300005536 Ga0070697_100733922 Ga0070697_1007339222 89
54 3300005536 Ga0070697_101038030 Ga0070697_1010380302 89
55 3300005544 Ga0070686_100049353 Ga0070686_1000493532 89
56 3300005544 Ga0070686_100074693 Ga0070686_1000746934 89
57 3300005544 Ga0070686_100132465 Ga0070686_1001324653 89
58 3300005544 Ga0070686_100822382 Ga0070686_1008223822 89
59 3300005545 Ga0070695_100529100 Ga0070695_1005291002 89
60 3300005545 Ga0070695_100803113 Ga0070695_1008031132 89
61 3300005546 Ga0070696_100489275 Ga0070696_1004892752 89
62 3300005549 Ga0070704_100100964 Ga0070704_1001009642 89
63 3300005549 Ga0070704_100135616 Ga0070704_1001356162 89
64 3300005549 Ga0070704_100213176 Ga0070704_1002131762 89
65 3300005549 Ga0070704_100257644 Ga0070704_1002576442 89
66 3300005549 Ga0070704_100380569 Ga0070704_1003805691 89
67 3300005549 Ga0070704_101567956 Ga0070704_1015679562 89
68 3300005577 Ga0068857_100060708 Ga0068857_1000607084 89
69 3300005577 Ga0068857_100463546 Ga0068857_1004635462 89
70 3300005615 Ga0070702_100078121 Ga0070702_1000781212 89
71 3300005617 Ga0068859_100031558 Ga0068859_1000315587 89
72 3300005617 Ga0068859_101267809 Ga0068859_1012678092 89
73 3300005618 Ga0068864_100809702 Ga0068864_1008097022 89
74 3300005618 Ga0068864_100929979 Ga0068864_1009299792 89
75 3300005618 Ga0068864_100974481 Ga0068864_1009744812 89
76 3300005719 Ga0068861_100088071 Ga0068861_1000880712 89
77 3300005719 Ga0068861_100435734 Ga0068861_1004357342 89
78 3300005841 Ga0068863_100123517 Ga0068863_1001235172 89
79 3300005841 Ga0068863_101183403 Ga0068863_1011834032 89
80 3300005842 Ga0068858_101676955 Ga0068858_1016769552 89
81 3300005843 Ga0068860_100059072 Ga0068860_1000590722 89
82 3300005843 Ga0068860_100732394 Ga0068860_1007323942 89
83 3300005844 Ga0068862_100596651 Ga0068862_1005966512 89
84 3300006058 Ga0075432_10287964 Ga0075432_102879641 89
85 3300006163 Ga0070715_10002722 Ga0070715_100027224 89
86 3300006237 Ga0097621_100532036 Ga0097621_1005320362 89
87 3300006844 Ga0075428_100008369 Ga0075428_1000083694 89
88 3300006844 Ga0075428_100039561 Ga0075428_1000395614 89
89 3300006846 Ga0075430_100121965 Ga0075430_1001219652 89
90 3300006847 Ga0075431_100046392 Ga0075431_1000463922 89
91 3300006847 Ga0075431_100320886 Ga0075431_1003208862 89
92 3300006847 Ga0075431_100569333 Ga0075431_1005693332 89
93 3300006852 Ga0075433_10002549 Ga0075433_1000254915 89
94 3300006852 Ga0075433_10361192 Ga0075433_103611922 89
95 3300006852 Ga0075433_10521053 Ga0075433_105210532 89
96 3300006871 Ga0075434_100010991 Ga0075434_1000109912 89
97 3300006871 Ga0075434_100015087 Ga0075434_1000150878 89
98 3300006871 Ga0075434_100116834 Ga0075434_1001168343 89
99 3300006871 Ga0075434_100240374 Ga0075434_1002403742 89
100 3300006871 Ga0075434_100254756 Ga0075434_1002547562 89
101 3300006871 Ga0075434_101379465 Ga0075434_1013794652 89
102 3300006880 Ga0075429_100029203 Ga0075429_1000292035 89
103 3300006880 Ga0075429_100761816 Ga0075429_1007618162 89
104 3300006914 Ga0075436_100118523 Ga0075436_1001185232 89
105 3300006914 Ga0075436_100667461 Ga0075436_1006674612 89
106 3300006931 Ga0097620_100031556 Ga0097620_1000315567 89
107 3300006931 Ga0097620_101268022 Ga0097620_1012680222 89
108 3300007076 Ga0075435_100008129 Ga0075435_10000812911 89
109 3300007076 Ga0075435_100557213 Ga0075435_1005572132 89
110 3300007076 Ga0075435_100721204 Ga0075435_1007212042 89
111 3300009094 Ga0111539_10480656 Ga0111539_104806562 89
112 3300009094 Ga0111539_11563901 Ga0111539_115639012 89
113 3300009147 Ga0114129_10404259 Ga0114129_104042592 89
114 3300009147 Ga0114129_10443475 Ga0114129_104434752 89
115 3300009147 Ga0114129_10812873 Ga0114129_108128732 89
116 3300009147 Ga0114129_10938605 Ga0114129_109386052 89
117 3300009177 Ga0105248_10097560 Ga0105248_100975602 89
118 3300013297 Ga0157378_10002035 Ga0157378_1000203515 89
119 3300013308 Ga0157375_10060856 Ga0157375_100608562 89
120 3300014325 Ga0163163_11976506 Ga0163163_119765062 89
121 3300014326 Ga0157380_10794376 Ga0157380_107943762 89
122 3300014745 Ga0157377_10191227 Ga0157377_101912271 89
123 3300014968 Ga0157379_10073691 Ga0157379_100736912 89
124 3300021361 Ga0213872_10002216 Ga0213872_100022168 89
125 3300021361 Ga0213872_10009966 Ga0213872_100099664 89
126 3300021384 Ga0213876_10000316 Ga0213876_1000031624 89
127 3300025885 Ga0207653_10036025 Ga0207653_100360253 89
128 3300025885 Ga0207653_10108580 Ga0207653_101085801 89
129 3300025905 Ga0207685_10000988 Ga0207685_100009884 89
130 3300025905 Ga0207685_10297472 Ga0207685_102974722 89
131 3300025906 Ga0207699_10100603 Ga0207699_101006032 89
132 3300025910 Ga0207684_10179993 Ga0207684_101799933 89
133 3300025917 Ga0207660_10426423 Ga0207660_104264232 89
134 3300025918 Ga0207662_10003172 Ga0207662_100031722 89
135 3300025922 Ga0207646_11005571 Ga0207646_110055712 89
136 3300025922 Ga0207646_11302889 Ga0207646_113028892 89
137 3300025927 Ga0207687_10497312 Ga0207687_104973121 89
138 3300025936 Ga0207670_10000150 Ga0207670_1000015028 89
139 3300025936 Ga0207670_10038423 Ga0207670_100384234 89
140 3300025936 Ga0207670_10107384 Ga0207670_101073842 89
141 3300025936 Ga0207670_11222478 Ga0207670_112224782 89
142 3300025941 Ga0207711_10200528 Ga0207711_102005282 89
143 3300025941 Ga0207711_10388529 Ga0207711_103885292 89
144 3300025942 Ga0207689_11722760 Ga0207689_117227602 89
145 3300025960 Ga0207651_10021422 Ga0207651_100214222 89
146 3300025960 Ga0207651_10670840 Ga0207651_106708402 89
147 3300026023 Ga0207677_10718739 Ga0207677_107187392 89
148 3300026035 Ga0207703_11283595 Ga0207703_112835952 89
149 3300026035 Ga0207703_12025456 Ga0207703_120254562 89
150 3300026075 Ga0207708_10046567 Ga0207708_100465673 89
151 3300026075 Ga0207708_10219434 Ga0207708_102194342 89
152 3300026088 Ga0207641_10089444 Ga0207641_100894442 89
153 3300026089 Ga0207648_10033351 Ga0207648_100333514 89
154 3300026095 Ga0207676_10104176 Ga0207676_101041764 89
155 3300026116 Ga0207674_10509378 Ga0207674_105093782 89
156 3300026116 Ga0207674_10644087 Ga0207674_106440872 89
157 3300026118 Ga0207675_100136478 Ga0207675_1001364782 89
158 3300026118 Ga0207675_101040984 Ga0207675_1010409842 89
159 3300027907 Ga0207428_10128793 Ga0207428_101287933 89
160 3300027907 Ga0207428_10572025 Ga0207428_105720252 89
161 3300028380 Ga0268265_10121339 Ga0268265_101213392 89
162 3300028380 Ga0268265_11024548 Ga0268265_110245482 89
163 3300028381 Ga0268264_10317062 Ga0268264_103170622 89
164 3300028381 Ga0268264_11207305 Ga0268264_112073052 89
165 3300028800 Ga0265338_10106581 Ga0265338_101065812 89
166 3300031728 Ga0316578_10900014 Ga0316578_109000142 89
167 3300034817 Ga0373948_0125443 Ga0373948_0125443_179_448 89
168 3300035085 Ga0373929_0095046 Ga0373929_0095046_68_337 89
169 3300035086 Ga0373934_0016971 Ga0373934_0016971_2417_2686 89
170 3300035086 Ga0373934_0067455 Ga0373934_0067455_735_1004 89
171 3300035086 Ga0373934_0087721 Ga0373934_0087721_593_901 89
172 3300035088 Ga0373940_0214160 Ga0373940_0214160_110_379 89
173 3300035090 Ga0373949_0077557 Ga0373949_0077557_480_749 89
174 3300035092 Ga0373952_0225627 Ga0373952_0225627_190_459 89
175 3300035111 Ga0373923_0017093 Ga0373923_0017093_1630_1899 89
176 3300035114 Ga0373939_0154720 Ga0373939_0154720_252_521 89
177 3300035115 Ga0373941_0189476 Ga0373941_0189476_51_320 89
178 3300035116 Ga0373945_0103602 Ga0373945_0103602_556_825 89
179 3300035117 Ga0373953_0038134 Ga0373953_0038134_1445_1714 89
180 3300035117 Ga0373953_0123929 Ga0373953_0123929_278_586 89
181 3300035117 Ga0373953_0272966 Ga0373953_0272966_104_373 89
182 3300035118 Ga0373954_0012221 Ga0373954_0012221_1705_1974 89
183 3300035118 Ga0373954_0146989 Ga0373954_0146989_736_1005 89
184 3300035119 Ga0373956_0070061 Ga0373956_0070061_869_1138 89
185 3300035119 Ga0373956_0288059 Ga0373956_0288059_310_579 89
186 3300035120 Ga0373957_0021336 Ga0373957_0021336_1964_2233 89
187 3300035120 Ga0373957_0152432 Ga0373957_0152432_166_435 89
188 3300035170 Ga0373943_0428959 Ga0373943_0428959_243_533 89
189 3300035170 Ga0373943_0614666 Ga0373943_0614666_145_414 89
190 3300035172 Ga0373955_0008893 Ga0373955_0008893_1256_1525 89
191 3300035241 Ga0373961_0236110 Ga0373961_0236110_77_346 89
192 3300035242 Ga0373962_0131189 Ga0373962_0131189_322_591 89
193 3300035410 Ga0373924_0041614 Ga0373924_0041614_279_548 89
194 3300035724 Ga0373933_0070821 Ga0373933_0070821_662_931 89
195 3300035724 Ga0373933_1037097 Ga0373933_1037097_223_492 89
196 3300036401 Ga0373937_0012824 Ga0373937_0012824_4055_4363 89
197 3300036401 Ga0373937_0120245 Ga0373937_0120245_238_507 89
198 3300039437 Ga0436365_0585577 Ga0436365_0585577_19776_20048 89
199 3300039447 Ga0436361_0106919 Ga0436361_0106919_4807_5076 89
200 3300039447 Ga0436361_0510397 Ga0436361_0510397_41_310 89
201 3300039447 Ga0436361_0554014 Ga0436361_0554014_10487_10756 89
202 3300039450 Ga0436363_0265221 Ga0436363_0265221_742_1014 89
203 3300042876 Ga0451577_0063582 Ga0451577_0063582_990_1259 89
204 3300042876 Ga0451577_0075871 Ga0451577_0075871_323_592 89
205 3300042876 Ga0451577_0495984 Ga0451577_0495984_57_335 89
206 3300044656 Ga0466969_0000918 Ga0466969_0000918_10049_10318 89
207 3300044656 Ga0466969_0450012 Ga0466969_0450012_64_333 89
208 3300044673 Ga0453683_0620325 Ga0453683_0620325_73_342 89
209 3300044683 Ga0466965_0005425 Ga0466965_0005425_1096_1365 89
210 3300044684 Ga0466966_0101332 Ga0466966_0101332_1105_1374 89
211 3300044693 Ga0466961_0000218 Ga0466961_0000218_17221_17490 89
212 3300044706 Ga0466964_0024334 Ga0466964_0024334_470_739 89
213 3300044712 Ga0453684_1989093 Ga0453684_1989093_267_536 89
214 3300044735 Ga0466968_0094468 Ga0466968_0094468_948_1217 89
215 3300044765 Ga0466970_0117190 Ga0466970_0117190_994_1263 89
216 3300045049 Ga0466959_0003320 Ga0466959_0003320_387_656 89
217 3300045051 Ga0451576_0077715 Ga0451576_0077715_2106_2375 89
218 3300045051 Ga0451576_0296570 Ga0451576_0296570_297_566 89
219 3300045051 Ga0451576_0307985 Ga0451576_0307985_287_556 89
220 3300045051 Ga0451576_0723512 Ga0451576_0723512_247_516 89
221 3300045051 Ga0451576_0858881 Ga0451576_0858881_334_612 89
222 3300045051 Ga0451576_0958759 Ga0451576_0958759_379_648 89
223 3300045051 Ga0451576_1318607 Ga0451576_1318607_180_449 89
224 3300045051 Ga0451576_1961478 Ga0451576_1961478_113_382 89
225 3300046454 Ga0495592_0048706 Ga0495592_0048706_1338_1607 89
226 3300046455 Ga0495603_0190418 Ga0495603_0190418_386_655 89
227 3300046459 Ga0495629_0479430 Ga0495629_0479430_78_347 89
228 3300046462 Ga0495651_0263682 Ga0495651_0263682_781_1050 89
229 3300046463 Ga0495653_0034890 Ga0495653_0034890_1795_2064 89
230 3300046463 Ga0495653_0548175 Ga0495653_0548175_97_366 89
231 3300046473 Ga0495582_0112044 Ga0495582_0112044_967_1236 89
232 3300046475 Ga0495639_0166610 Ga0495639_0166610_85_393 89
233 3300046476 Ga0495662_0105249 Ga0495662_0105249_600_869 89
234 3300046499 Ga0495594_0594330 Ga0495594_0594330_209_499 89
235 3300046511 Ga0495608_0002219 Ga0495608_0002219_4669_4938 89
236 3300046514 Ga0495618_0018437 Ga0495618_0018437_1962_2231 89
237 3300046516 Ga0495628_0028212 Ga0495628_0028212_1093_1362 89
238 3300046516 Ga0495628_0254095 Ga0495628_0254095_501_770 89
239 3300046516 Ga0495628_0485640 Ga0495628_0485640_158_427 89
240 3300046526 Ga0495666_0074525 Ga0495666_0074525_679_969 89
241 3300046533 Ga0495640_0529199 Ga0495640_0529199_258_527 89
242 3300046533 Ga0495640_0662301 Ga0495640_0662301_203_472 89
243 3300046539 Ga0495621_0131154 Ga0495621_0131154_35_304 89
244 3300046559 Ga0495667_0008208 Ga0495667_0008208_6366_6635 89
245 3300046642 Ga0495634_0062650 Ga0495634_0062650_918_1187 89
246 3300046642 Ga0495634_0345380 Ga0495634_0345380_271_540 89
247 3300046663 Ga0495635_0082279 Ga0495635_0082279_1448_1717 89
248 3300046663 Ga0495635_0884324 Ga0495635_0884324_27_335 89
249 3300046664 Ga0495659_0202348 Ga0495659_0202348_213_482 89
250 3300046675 Ga0495657_0028597 Ga0495657_0028597_1157_1426 89
251 3300046678 Ga0495599_0058096 Ga0495599_0058096_795_1064 89
252 3300046678 Ga0495599_0400263 Ga0495599_0400263_488_757 89
253 3300046681 Ga0495647_0163158 Ga0495647_0163158_496_804 89
254 3300046683 Ga0495658_0145701 Ga0495658_0145701_518_787 89
255 3300046683 Ga0495658_0153007 Ga0495658_0153007_82_351 89
256 3300046689 Ga0495613_0408210 Ga0495613_0408210_589_858 89
257 3300046689 Ga0495613_0717565 Ga0495613_0717565_242_511 89
258 3300046809 Ga0495600_0031600 Ga0495600_0031600_1220_1489 89
259 3300046809 Ga0495600_0241500 Ga0495600_0241500_631_900 89
260 3300047315 Ga0495581_0070063 Ga0495581_0070063_826_1134 89
261 3300047315 Ga0495581_0213538 Ga0495581_0213538_240_509 89
262 3300047317 Ga0495604_0218018 Ga0495604_0218018_375_644 89
263 3300047321 Ga0495676_0594439 Ga0495676_0594439_360_629 89
264 3300047322 Ga0495680_0811073 Ga0495680_0811073_118_387 89
265 3300047444 Ga0495675_0004531 Ga0495675_0004531_5565_5834 89
266 3300047471 Ga0495684_0437674 Ga0495684_0437674_338_607 89
267 3300047471 Ga0495684_0486707 Ga0495684_0486707_245_514 89
268 3300049589 Ga0501073_0179078 Ga0501073_0179078_1135_1404 89
269 3300049741 Ga0501079_1047170 Ga0501079_1047170_274_543 89
270 3300050507 nmdc:mga05p37_141587_c1 nmdc:mga05p37_141587_c1_2344_2613 89
271 3300050507 nmdc:mga05p37_551377_c1 nmdc:mga05p37_551377_c1_307_576 89
272 3300050507 nmdc:mga05p37_987640_c1 nmdc:mga05p37_987640_c1_574_843 89
273 3300050508 nmdc:mga09592_15493_c1 nmdc:mga09592_15493_c1_4895_5233 89
274 3300050508 nmdc:mga09592_200587_c1 nmdc:mga09592_200587_c1_630_899 89
275 3300050508 nmdc:mga09592_614184_c1 nmdc:mga09592_614184_c1_234_503 89
276 3300050508 nmdc:mga09592_65397_c1 nmdc:mga09592_65397_c1_2030_2299 89
277 3300050509 nmdc:mga0qj67_110211_c1 nmdc:mga0qj67_110211_c1_1500_1769 89
278 3300050510 nmdc:mga06r32_47802_c1 nmdc:mga06r32_47802_c1_1418_1687 89
279 3300050510 nmdc:mga06r32_596186_c1 nmdc:mga06r32_596186_c1_678_947 89
280 3300050511 nmdc:mga08y16_211435_c1 nmdc:mga08y16_211435_c1_403_672 89
281 3300050511 nmdc:mga08y16_721501_c1 nmdc:mga08y16_721501_c1_398_667 89
282 3300050511 nmdc:mga08y16_80580_c1 nmdc:mga08y16_80580_c1_642_920 89
283 3300050512 nmdc:mga0n895_11343_c1 nmdc:mga0n895_11343_c1_5892_6161 89
284 3300050512 nmdc:mga0n895_127033_c1 nmdc:mga0n895_127033_c1_2147_2416 89
285 3300050512 nmdc:mga0n895_256177_c1 nmdc:mga0n895_256177_c1_719_997 89
286 3300050512 nmdc:mga0n895_487497_c1 nmdc:mga0n895_487497_c1_476_745 89
287 3300050512 nmdc:mga0n895_599136_c1 nmdc:mga0n895_599136_c1_242_520 89
288 3300050512 nmdc:mga0n895_640016_c1 nmdc:mga0n895_640016_c1_185_454 89
289 3300050513 nmdc:mga0rr50_13224_c1 nmdc:mga0rr50_13224_c1_1537_1806 89
290 3300050513 nmdc:mga0rr50_135741_c2 nmdc:mga0rr50_135741_c2_521_790 89
291 3300050513 nmdc:mga0rr50_247402_c1 nmdc:mga0rr50_247402_c1_159_428 89
292 3300050513 nmdc:mga0rr50_941966_c1 nmdc:mga0rr50_941966_c1_59_337 89
293 3300050514 nmdc:mga08x19_604970_c1 nmdc:mga08x19_604970_c1_490_759 89
294 3300050515 nmdc:mga0a205_4506_c1 nmdc:mga0a205_4506_c1_5912_6190 89
295 3300050515 nmdc:mga0a205_49553_c1 nmdc:mga0a205_49553_c1_82_351 89
296 3300050515 nmdc:mga0a205_512465_c1 nmdc:mga0a205_512465_c1_574_843 89
297 3300050515 nmdc:mga0a205_597046_c1 nmdc:mga0a205_597046_c1_411_680 89
298 3300053077 Ga0495601_0345289 Ga0495601_0345289_177_446 89
299 3300053077 Ga0495601_0700129 Ga0495601_0700129_196_465 89
300 3300053084 Ga0495595_0000291 Ga0495595_0000291_5811_6080 89
301 3300053085 Ga0495619_0035882 Ga0495619_0035882_882_1151 89
302 3300053085 Ga0495619_0448864 Ga0495619_0448864_346_615 89
303 3300061734 Ga0530510_1096495 Ga0530510_1096495_319_600 89

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00381

PTS-HPr

PTS HPr component phosphorylation site

2

83

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lfg-assembly2.cif.gz_B crystal structure of hpr-c-his from thermoanaerobacter tengcongensis 0.9805 1 89
3ihs-assembly2.cif.gz_B crystal structure of a phosphocarrier protein hpr from bacillus anthracis str. ames 0.9727 2 81
3ccd-assembly1.cif.gz_A 1.0 a structure of post-succinimide his15asp hpr 0.9727 1 82
1opd-assembly1.cif.gz_A histidine-containing protein (hpr), mutant with ser 46 replaced by asp (s46d) 0.9713 1 81
4xwj-assembly1.cif.gz_B histidine-containing phosphocarrier protein (hpr) and antisigma factor rsd complex 0.969 1 82
ID Description Score Start End Superfamily
af_P69811_287_371_3.30.1340.10 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.9767 4 83 3.30.1340.10
3ccdB00 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.9724 1 82 3.30.1340.10
af_P37349_156_242_3.30.1340.10 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.9703 2 86 3.30.1340.10
3ihsB00 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.9662 1 81 3.30.1340.10
3oqoD00 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.9569 2 79 3.30.1340.10
ID Description Score Start End GO Terms
AF-A0A7C6ATM0-F1-model_v4 HPr family phosphocarrier protein 1.001 1 86 GO:0005737
GO:0009401
AF-A0A1F5R2W8-F1-model_v4 Phosphocarrier protein HPr 1 1 89 GO:0005737
GO:0009401
AF-A0A0M2NHT1-F1-model_v4 Phosphocarrier protein HPr 0.9992 1 86
AF-A0A3M8RBL6-F1-model_v4 HPr family phosphocarrier protein 0.9991 2 86 GO:0005737
GO:0009401
AF-A0A4T9WGP9-F1-model_v4 deleted 0.9985 1 85

Feature Viewer

pLDDT pTM Quality
96.22 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map