F397039
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 303 | 177 | 299 | 90 |
Family's Representative Sequence
| Representative Sequence | 3300021361|Ga0213872_10002216|Ga0213872_100022168 |
| Length | 89 |
| Sequence | MVKSEVEIINKLGLHARASSKFTQLASRFQSEIFISRNNRRVNGKSIMGVMMLAAAKGSLVELEVSGSDEETALAALVALINNRFDESE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132103 | Chromobacterium sp. C-61 | Isolate | Rhizosphere |
| 2 | 2843690924 | Chromobacterium rhizoryzae JP2-74 | Isolate | Rhizosphere |
| 3 | 2846033681 | Chromobacterium sinusclupearum MWU13-2610 | Isolate | Rhizosphere |
| 4 | 2846037992 | Chromobacterium alticapitis MWU14-2602 | Isolate | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 35 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 37 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 38 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 39 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 40 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 41 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 42 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 43 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 44 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 48 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 49 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 50 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 51 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 52 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 53 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 54 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 56 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 66 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 67 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 91 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 94 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 95 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 96 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 97 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 98 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 99 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 100 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 101 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 102 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 103 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 104 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 105 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 106 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 107 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 108 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 109 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 110 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 111 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 112 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 113 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 114 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 115 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 116 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 117 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 118 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 119 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 120 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 121 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 122 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 123 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 124 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 125 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 126 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 127 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 128 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 129 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 130 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 131 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 166 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 167 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 168 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 169 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 170 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 171 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 172 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 174 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.68 |
| Metatranscriptomes | 0 |
| Isolates | 1.32 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 99.01 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.99 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065707_10818367 | 3300005295 | Bacteria | 593 |
| 2 | Ga0070690_100221403 | 3300005330 | Bacteria | 1326 |
| 3 | Ga0070690_100345323 | 3300005330 | Bacteria | 1079 |
| 4 | Ga0070690_101379055 | 3300005330 | Bacteria | 567 |
| 5 | Ga0070670_100008171 | 3300005331 | Bacteria | 8911 |
| 6 | Ga0068869_100770794 | 3300005334 | Bacteria | 825 |
| 7 | Ga0070680_100227703 | 3300005336 | Bacteria | 1574 |
| 8 | Ga0070680_101285305 | 3300005336 | Bacteria | 633 |
| 9 | Ga0068868_100931680 | 3300005338 | Bacteria | 791 |
| 10 | Ga0070689_100008751 | 3300005340 | Bacteria | 7145 |
| 11 | Ga0070689_100036622 | 3300005340 | Bacteria | 3753 |
| 12 | Ga0070687_100001487 | 3300005343 | Bacteria | 8264 |
| 13 | Ga0070673_100001982 | 3300005364 | Bacteria | 12351 |
| 14 | Ga0070673_100224505 | 3300005364 | Bacteria | 1627 |
| 15 | Ga0070688_100001308 | 3300005365 | Bacteria | 12418 |
| 16 | Ga0070688_100007546 | 3300005365 | Bacteria | 5869 |
| 17 | Ga0070688_100027557 | 3300005365 | Bacteria | 3385 |
| 18 | Ga0070703_10142216 | 3300005406 | Bacteria | 893 |
| 19 | Ga0070709_10195299 | 3300005434 | Bacteria | 1430 |
| 20 | Ga0070714_100005932 | 3300005435 | Bacteria | 9378 |
| 21 | Ga0070713_101138544 | 3300005436 | Bacteria | 755 |
| 22 | Ga0070710_10300151 | 3300005437 | Bacteria | 1048 |
| 23 | Ga0070710_11357021 | 3300005437 | Bacteria | 530 |
| 24 | Ga0070701_10044707 | 3300005438 | Bacteria | 2269 |
| 25 | Ga0070701_10411696 | 3300005438 | Bacteria | 859 |
| 26 | Ga0070711_101273746 | 3300005439 | Bacteria | 637 |
| 27 | Ga0070705_100298938 | 3300005440 | Bacteria | 1153 |
| 28 | Ga0070705_101253793 | 3300005440 | Bacteria | 613 |
| 29 | Ga0070694_100011578 | 3300005444 | Bacteria | 5462 |
| 30 | Ga0070694_100831578 | 3300005444 | Bacteria | 759 |
| 31 | Ga0070662_101543408 | 3300005457 | Bacteria | 573 |
| 32 | Ga0070685_10016116 | 3300005466 | Bacteria | 3977 |
| 33 | Ga0070685_10545246 | 3300005466 | Bacteria | 827 |
| 34 | Ga0070706_100250940 | 3300005467 | Bacteria | 1652 |
| 35 | Ga0070707_100436675 | 3300005468 | Bacteria | 1270 |
| 36 | Ga0070698_100049368 | 3300005471 | Bacteria | 4295 |
| 37 | Ga0070698_100111320 | 3300005471 | Bacteria | 2703 |
| 38 | Ga0070698_100221173 | 3300005471 | Bacteria | 1827 |
| 39 | Ga0070697_100733922 | 3300005536 | Bacteria | 872 |
| 40 | Ga0070697_101038030 | 3300005536 | Bacteria | 729 |
| 41 | Ga0070686_100049353 | 3300005544 | Bacteria | 2670 |
| 42 | Ga0070686_100074693 | 3300005544 | Bacteria | 2228 |
| 43 | Ga0070686_100132465 | 3300005544 | Bacteria | 1726 |
| 44 | Ga0070686_100822382 | 3300005544 | Bacteria | 750 |
| 45 | Ga0070695_100529100 | 3300005545 | Bacteria | 916 |
| 46 | Ga0070695_100803113 | 3300005545 | Bacteria | 754 |
| 47 | Ga0070696_100489275 | 3300005546 | Bacteria | 977 |
| 48 | Ga0070704_100100964 | 3300005549 | Bacteria | 2173 |
| 49 | Ga0070704_100135616 | 3300005549 | Bacteria | 1914 |
| 50 | Ga0070704_100213176 | 3300005549 | Bacteria | 1566 |
| 51 | Ga0070704_100257644 | 3300005549 | Bacteria | 1435 |
| 52 | Ga0070704_100380569 | 3300005549 | Bacteria | 1199 |
| 53 | Ga0070704_101567956 | 3300005549 | Bacteria | 607 |
| 54 | Ga0068857_100060708 | 3300005577 | Bacteria | 3358 |
| 55 | Ga0068857_100463546 | 3300005577 | Bacteria | 1186 |
| 56 | Ga0070702_100078121 | 3300005615 | Bacteria | 1975 |
| 57 | Ga0068859_100031558 | 3300005617 | Bacteria | 5321 |
| 58 | Ga0068859_101267809 | 3300005617 | Bacteria | 812 |
| 59 | Ga0068864_100809702 | 3300005618 | Bacteria | 921 |
| 60 | Ga0068864_100929979 | 3300005618 | Bacteria | 860 |
| 61 | Ga0068864_100974481 | 3300005618 | Bacteria | 840 |
| 62 | Ga0068861_100088071 | 3300005719 | Bacteria | 2444 |
| 63 | Ga0068861_100435734 | 3300005719 | Bacteria | 1171 |
| 64 | Ga0068863_100123517 | 3300005841 | Bacteria | 2470 |
| 65 | Ga0068863_101183403 | 3300005841 | Bacteria | 770 |
| 66 | Ga0068858_101676955 | 3300005842 | Bacteria | 628 |
| 67 | Ga0068860_100059072 | 3300005843 | Bacteria | 3647 |
| 68 | Ga0068860_100732394 | 3300005843 | Bacteria | 1000 |
| 69 | Ga0068862_100596651 | 3300005844 | Bacteria | 1060 |
| 70 | Ga0075432_10287964 | 3300006058 | Bacteria | 678 |
| 71 | Ga0070715_10002722 | 3300006163 | Bacteria | 5484 |
| 72 | Ga0070712_100851499 | 3300006175 | Bacteria | 784 |
| 73 | Ga0097621_100532036 | 3300006237 | Bacteria | 1068 |
| 74 | Ga0075428_100008369 | 3300006844 | Bacteria | 11468 |
| 75 | Ga0075428_100039561 | 3300006844 | Bacteria | 5190 |
| 76 | Ga0075430_100121965 | 3300006846 | Bacteria | 2173 |
| 77 | Ga0075431_100046392 | 3300006847 | Bacteria | 4481 |
| 78 | Ga0075431_100320886 | 3300006847 | Bacteria | 1562 |
| 79 | Ga0075431_100569333 | 3300006847 | Bacteria | 1119 |
| 80 | Ga0075433_10002549 | 3300006852 | Bacteria | 13874 |
| 81 | Ga0075433_10361192 | 3300006852 | Bacteria | 1283 |
| 82 | Ga0075433_10521053 | 3300006852 | Bacteria | 1046 |
| 83 | Ga0075433_10643234 | 3300006852 | Bacteria | 930 |
| 84 | Ga0075434_100010991 | 3300006871 | Bacteria | 8515 |
| 85 | Ga0075434_100015087 | 3300006871 | Bacteria | 7399 |
| 86 | Ga0075434_100116834 | 3300006871 | Bacteria | 2681 |
| 87 | Ga0075434_100240374 | 3300006871 | Bacteria | 1831 |
| 88 | Ga0075434_100254756 | 3300006871 | Bacteria | 1774 |
| 89 | Ga0075434_101379465 | 3300006871 | Bacteria | 715 |
| 90 | Ga0075429_100029203 | 3300006880 | Bacteria | 4789 |
| 91 | Ga0075429_100761816 | 3300006880 | Bacteria | 848 |
| 92 | Ga0075429_101131472 | 3300006880 | Bacteria | 684 |
| 93 | Ga0075436_100118523 | 3300006914 | Bacteria | 1851 |
| 94 | Ga0075436_100667461 | 3300006914 | Bacteria | 769 |
| 95 | Ga0097620_100031556 | 3300006931 | Bacteria | 5321 |
| 96 | Ga0097620_101268022 | 3300006931 | Bacteria | 812 |
| 97 | Ga0075435_100008129 | 3300007076 | Bacteria | 7513 |
| 98 | Ga0075435_100557213 | 3300007076 | Bacteria | 993 |
| 99 | Ga0075435_100721204 | 3300007076 | Bacteria | 867 |
| 100 | Ga0111539_10480656 | 3300009094 | Bacteria | 1447 |
| 101 | Ga0111539_11563901 | 3300009094 | Bacteria | 765 |
| 102 | Ga0114129_10404259 | 3300009147 | Bacteria | 1799 |
| 103 | Ga0114129_10443475 | 3300009147 | Bacteria | 1704 |
| 104 | Ga0114129_10812873 | 3300009147 | Bacteria | 1191 |
| 105 | Ga0114129_10938605 | 3300009147 | Bacteria | 1094 |
| 106 | Ga0105248_10097560 | 3300009177 | Bacteria | 3311 |
| 107 | Ga0105248_12120480 | 3300009177 | Bacteria | 639 |
| 108 | Ga0157378_10002035 | 3300013297 | Bacteria | 18105 |
| 109 | Ga0157375_10060856 | 3300013308 | Bacteria | 3747 |
| 110 | Ga0163163_11976506 | 3300014325 | Bacteria | 643 |
| 111 | Ga0157380_10794376 | 3300014326 | Bacteria | 963 |
| 112 | Ga0157377_10191227 | 3300014745 | Bacteria | 1293 |
| 113 | Ga0157379_10073691 | 3300014968 | Bacteria | 3056 |
| 114 | Ga0213872_10002216 | 3300021361 | Bacteria | 11627 |
| 115 | Ga0213872_10009966 | 3300021361 | Bacteria | 4535 |
| 116 | Ga0213876_10000316 | 3300021384 | Bacteria | 42531 |
| 117 | Ga0207653_10036025 | 3300025885 | Bacteria | 1611 |
| 118 | Ga0207653_10108580 | 3300025885 | Bacteria | 989 |
| 119 | Ga0207685_10000988 | 3300025905 | Bacteria | 5494 |
| 120 | Ga0207685_10297472 | 3300025905 | Bacteria | 797 |
| 121 | Ga0207699_10100603 | 3300025906 | Bacteria | 1833 |
| 122 | Ga0207684_10179993 | 3300025910 | Bacteria | 1823 |
| 123 | Ga0207660_10426423 | 3300025917 | Bacteria | 1070 |
| 124 | Ga0207662_10003172 | 3300025918 | Bacteria | 8407 |
| 125 | Ga0207646_11005571 | 3300025922 | Bacteria | 737 |
| 126 | Ga0207646_11302889 | 3300025922 | Bacteria | 634 |
| 127 | Ga0207650_10048389 | 3300025925 | Bacteria | 3136 |
| 128 | Ga0207687_10497312 | 3300025927 | Unclassified | 1017 |
| 129 | Ga0207700_10254410 | 3300025928 | Bacteria | 1501 |
| 130 | Ga0207670_10000150 | 3300025936 | Bacteria | 45960 |
| 131 | Ga0207670_10038423 | 3300025936 | Bacteria | 3126 |
| 132 | Ga0207670_10107384 | 3300025936 | Bacteria | 2004 |
| 133 | Ga0207670_11222478 | 3300025936 | Bacteria | 636 |
| 134 | Ga0207711_10200528 | 3300025941 | Bacteria | 1820 |
| 135 | Ga0207711_10388529 | 3300025941 | Bacteria | 1295 |
| 136 | Ga0207689_11722760 | 3300025942 | Bacteria | 519 |
| 137 | Ga0207651_10021422 | 3300025960 | Bacteria | 3929 |
| 138 | Ga0207651_10670840 | 3300025960 | Bacteria | 911 |
| 139 | Ga0207640_10787901 | 3300025981 | Bacteria | 822 |
| 140 | Ga0207677_10718739 | 3300026023 | Bacteria | 888 |
| 141 | Ga0207703_11283595 | 3300026035 | Bacteria | 704 |
| 142 | Ga0207703_12025456 | 3300026035 | Bacteria | 552 |
| 143 | Ga0207708_10046567 | 3300026075 | Bacteria | 3302 |
| 144 | Ga0207708_10219434 | 3300026075 | Bacteria | 1523 |
| 145 | Ga0207641_10089444 | 3300026088 | Bacteria | 2691 |
| 146 | Ga0207648_10033351 | 3300026089 | Bacteria | 4542 |
| 147 | Ga0207676_10104176 | 3300026095 | Bacteria | 2359 |
| 148 | Ga0207674_10509378 | 3300026116 | Bacteria | 1163 |
| 149 | Ga0207674_10644087 | 3300026116 | Bacteria | 1023 |
| 150 | Ga0207675_100136478 | 3300026118 | Bacteria | 2328 |
| 151 | Ga0207675_101040984 | 3300026118 | Bacteria | 837 |
| 152 | Ga0207428_10128793 | 3300027907 | Bacteria | 1937 |
| 153 | Ga0207428_10572025 | 3300027907 | Bacteria | 816 |
| 154 | Ga0268265_10121339 | 3300028380 | Bacteria | 2154 |
| 155 | Ga0268265_11024548 | 3300028380 | Bacteria | 816 |
| 156 | Ga0268264_10317062 | 3300028381 | Bacteria | 1473 |
| 157 | Ga0268264_11207305 | 3300028381 | Bacteria | 766 |
| 158 | Ga0265338_10106581 | 3300028800 | Bacteria | 2268 |
| 159 | Ga0316578_10900014 | 3300031728 | Bacteria | 511 |
| 160 | Ga0373948_0125443 | 3300034817 | Bacteria | 624 |
| 161 | Ga0373929_0095046 | 3300035085 | Bacteria | 745 |
| 162 | Ga0373934_0016971 | 3300035086 | Bacteria | 2773 |
| 163 | Ga0373934_0067455 | 3300035086 | Bacteria | 1429 |
| 164 | Ga0373934_0087721 | 3300035086 | Bacteria | 1252 |
| 165 | Ga0373940_0214160 | 3300035088 | Bacteria | 638 |
| 166 | Ga0373949_0077557 | 3300035090 | Bacteria | 880 |
| 167 | Ga0373952_0225627 | 3300035092 | Bacteria | 558 |
| 168 | Ga0373923_0017093 | 3300035111 | Bacteria | 2768 |
| 169 | Ga0373939_0154720 | 3300035114 | Bacteria | 837 |
| 170 | Ga0373941_0189476 | 3300035115 | Bacteria | 776 |
| 171 | Ga0373945_0103602 | 3300035116 | Bacteria | 1116 |
| 172 | Ga0373953_0038134 | 3300035117 | Bacteria | 1899 |
| 173 | Ga0373953_0123929 | 3300035117 | Bacteria | 1099 |
| 174 | Ga0373953_0272966 | 3300035117 | Bacteria | 736 |
| 175 | Ga0373954_0012221 | 3300035118 | Bacteria | 3817 |
| 176 | Ga0373954_0146989 | 3300035118 | Bacteria | 1151 |
| 177 | Ga0373956_0070061 | 3300035119 | Bacteria | 1599 |
| 178 | Ga0373956_0288059 | 3300035119 | Bacteria | 782 |
| 179 | Ga0373957_0021336 | 3300035120 | Bacteria | 2298 |
| 180 | Ga0373957_0152432 | 3300035120 | Bacteria | 949 |
| 181 | Ga0373943_0428959 | 3300035170 | Bacteria | 766 |
| 182 | Ga0373943_0614666 | 3300035170 | Bacteria | 641 |
| 183 | Ga0373955_0008893 | 3300035172 | Bacteria | 4683 |
| 184 | Ga0373961_0063920 | 3300035241 | Bacteria | 1124 |
| 185 | Ga0373961_0236110 | 3300035241 | Bacteria | 657 |
| 186 | Ga0373962_0131189 | 3300035242 | Bacteria | 807 |
| 187 | Ga0373924_0041614 | 3300035410 | Bacteria | 1883 |
| 188 | Ga0373933_0070821 | 3300035724 | Bacteria | 2121 |
| 189 | Ga0373933_1037097 | 3300035724 | Bacteria | 540 |
| 190 | Ga0373937_0012824 | 3300036401 | Bacteria | 7382 |
| 191 | Ga0373937_0120245 | 3300036401 | Bacteria | 2447 |
| 192 | Ga0436365_0585577 | 3300039437 | Bacteria | 67545 |
| 193 | Ga0436361_0106919 | 3300039447 | Bacteria | 16754 |
| 194 | Ga0436361_0510397 | 3300039447 | Bacteria | 1922 |
| 195 | Ga0436361_0554014 | 3300039447 | Bacteria | 63849 |
| 196 | Ga0436363_0265221 | 3300039450 | Bacteria | 1701 |
| 197 | Ga0451577_0063582 | 3300042876 | Bacteria | 3291 |
| 198 | Ga0451577_0075871 | 3300042876 | Bacteria | 2998 |
| 199 | Ga0451577_0495984 | 3300042876 | Bacteria | 1109 |
| 200 | Ga0466969_0000918 | 3300044656 | Bacteria | 15881 |
| 201 | Ga0466969_0450012 | 3300044656 | Bacteria | 586 |
| 202 | Ga0453683_0620325 | 3300044673 | Bacteria | 706 |
| 203 | Ga0466965_0005425 | 3300044683 | Bacteria | 5746 |
| 204 | Ga0466966_0101332 | 3300044684 | Bacteria | 1780 |
| 205 | Ga0466961_0000218 | 3300044693 | Bacteria | 38766 |
| 206 | Ga0466964_0024334 | 3300044706 | Bacteria | 2360 |
| 207 | Ga0453684_1989093 | 3300044712 | Bacteria | 586 |
| 208 | Ga0466968_0094468 | 3300044735 | Bacteria | 1329 |
| 209 | Ga0466970_0117190 | 3300044765 | Bacteria | 1457 |
| 210 | Ga0466959_0003320 | 3300045049 | Bacteria | 10505 |
| 211 | Ga0451576_0028314 | 3300045051 | Bacteria | 6003 |
| 212 | Ga0451576_0077715 | 3300045051 | Bacteria | 3454 |
| 213 | Ga0451576_0296570 | 3300045051 | Bacteria | 1690 |
| 214 | Ga0451576_0307985 | 3300045051 | Bacteria | 1657 |
| 215 | Ga0451576_0723512 | 3300045051 | Bacteria | 1046 |
| 216 | Ga0451576_0858881 | 3300045051 | Bacteria | 952 |
| 217 | Ga0451576_0958759 | 3300045051 | Bacteria | 897 |
| 218 | Ga0451576_1318607 | 3300045051 | Bacteria | 752 |
| 219 | Ga0451576_1961478 | 3300045051 | Bacteria | 603 |
| 220 | Ga0495592_0048706 | 3300046454 | Bacteria | 3151 |
| 221 | Ga0495603_0190418 | 3300046455 | Bacteria | 1186 |
| 222 | Ga0495629_0479430 | 3300046459 | Bacteria | 840 |
| 223 | Ga0495651_0263682 | 3300046462 | Bacteria | 1171 |
| 224 | Ga0495653_0034890 | 3300046463 | Bacteria | 3973 |
| 225 | Ga0495653_0548175 | 3300046463 | Bacteria | 716 |
| 226 | Ga0495582_0112044 | 3300046473 | Bacteria | 1533 |
| 227 | Ga0495639_0166610 | 3300046475 | Bacteria | 1068 |
| 228 | Ga0495662_0105249 | 3300046476 | Bacteria | 1381 |
| 229 | Ga0495594_0594330 | 3300046499 | Bacteria | 627 |
| 230 | Ga0495608_0002219 | 3300046511 | Bacteria | 14016 |
| 231 | Ga0495618_0018437 | 3300046514 | Bacteria | 4285 |
| 232 | Ga0495628_0028212 | 3300046516 | Bacteria | 4562 |
| 233 | Ga0495628_0254095 | 3300046516 | Bacteria | 1311 |
| 234 | Ga0495628_0485640 | 3300046516 | Bacteria | 893 |
| 235 | Ga0495666_0074525 | 3300046526 | Bacteria | 1610 |
| 236 | Ga0495640_0529199 | 3300046533 | Bacteria | 716 |
| 237 | Ga0495640_0662301 | 3300046533 | Bacteria | 628 |
| 238 | Ga0495621_0131154 | 3300046539 | Bacteria | 975 |
| 239 | Ga0495667_0008208 | 3300046559 | Bacteria | 7086 |
| 240 | Ga0495634_0062650 | 3300046642 | Bacteria | 2469 |
| 241 | Ga0495634_0345380 | 3300046642 | Bacteria | 892 |
| 242 | Ga0495635_0082279 | 3300046663 | Bacteria | 2203 |
| 243 | Ga0495635_0884324 | 3300046663 | Bacteria | 573 |
| 244 | Ga0495659_0202348 | 3300046664 | Bacteria | 815 |
| 245 | Ga0495657_0028597 | 3300046675 | Bacteria | 3918 |
| 246 | Ga0495599_0058096 | 3300046678 | Bacteria | 2420 |
| 247 | Ga0495599_0400263 | 3300046678 | Bacteria | 818 |
| 248 | Ga0495647_0163158 | 3300046681 | Bacteria | 961 |
| 249 | Ga0495658_0145701 | 3300046683 | Bacteria | 1451 |
| 250 | Ga0495658_0153007 | 3300046683 | Bacteria | 1418 |
| 251 | Ga0495613_0408210 | 3300046689 | Bacteria | 926 |
| 252 | Ga0495613_0717565 | 3300046689 | Bacteria | 657 |
| 253 | Ga0495600_0031600 | 3300046809 | Bacteria | 3431 |
| 254 | Ga0495600_0241500 | 3300046809 | Bacteria | 1151 |
| 255 | Ga0495581_0070063 | 3300047315 | Bacteria | 2028 |
| 256 | Ga0495581_0213538 | 3300047315 | Bacteria | 1128 |
| 257 | Ga0495604_0218018 | 3300047317 | Bacteria | 1315 |
| 258 | Ga0495676_0594439 | 3300047321 | Bacteria | 721 |
| 259 | Ga0495680_0811073 | 3300047322 | Bacteria | 610 |
| 260 | Ga0495675_0004531 | 3300047444 | Bacteria | 8425 |
| 261 | Ga0495684_0437674 | 3300047471 | Bacteria | 911 |
| 262 | Ga0495684_0486707 | 3300047471 | Bacteria | 851 |
| 263 | Ga0501068_0982257 | 3300049584 | Bacteria | 557 |
| 264 | Ga0501073_0179078 | 3300049589 | Bacteria | 1467 |
| 265 | Ga0501079_1047170 | 3300049741 | Bacteria | 643 |
| 266 | nmdc:mga05p37_141587_c1 | 3300050507 | Bacteria | 2946 |
| 267 | nmdc:mga05p37_551377_c1 | 3300050507 | Bacteria | 1312 |
| 268 | nmdc:mga05p37_987640_c1 | 3300050507 | Bacteria | 896 |
| 269 | nmdc:mga09592_15493_c1 | 3300050508 | Bacteria | 6231 |
| 270 | nmdc:mga09592_200587_c1 | 3300050508 | Bacteria | 1728 |
| 271 | nmdc:mga09592_614184_c1 | 3300050508 | Bacteria | 931 |
| 272 | nmdc:mga09592_65397_c1 | 3300050508 | Bacteria | 3081 |
| 273 | nmdc:mga0qj67_110211_c1 | 3300050509 | Bacteria | 2222 |
| 274 | nmdc:mga06r32_47802_c1 | 3300050510 | Bacteria | 4088 |
| 275 | nmdc:mga06r32_596186_c1 | 3300050510 | Bacteria | 1076 |
| 276 | nmdc:mga08y16_211435_c1 | 3300050511 | Bacteria | 2009 |
| 277 | nmdc:mga08y16_721501_c1 | 3300050511 | Bacteria | 995 |
| 278 | nmdc:mga08y16_80580_c1 | 3300050511 | Bacteria | 3394 |
| 279 | nmdc:mga0n895_11343_c1 | 3300050512 | Bacteria | 7942 |
| 280 | nmdc:mga0n895_127033_c1 | 3300050512 | Bacteria | 2574 |
| 281 | nmdc:mga0n895_256177_c1 | 3300050512 | Bacteria | 1776 |
| 282 | nmdc:mga0n895_487497_c1 | 3300050512 | Bacteria | 1243 |
| 283 | nmdc:mga0n895_599136_c1 | 3300050512 | Bacteria | 1104 |
| 284 | nmdc:mga0n895_640016_c1 | 3300050512 | Bacteria | 1063 |
| 285 | nmdc:mga0rr50_13224_c1 | 3300050513 | Bacteria | 5367 |
| 286 | nmdc:mga0rr50_135741_c2 | 3300050513 | Bacteria | 867 |
| 287 | nmdc:mga0rr50_247402_c1 | 3300050513 | Bacteria | 1479 |
| 288 | nmdc:mga0rr50_941966_c1 | 3300050513 | Bacteria | 736 |
| 289 | nmdc:mga08x19_604970_c1 | 3300050514 | Bacteria | 777 |
| 290 | nmdc:mga0a205_4506_c1 | 3300050515 | Bacteria | 12501 |
| 291 | nmdc:mga0a205_49553_c1 | 3300050515 | Bacteria | 4054 |
| 292 | nmdc:mga0a205_512465_c1 | 3300050515 | Bacteria | 1056 |
| 293 | nmdc:mga0a205_597046_c1 | 3300050515 | Bacteria | 957 |
| 294 | Ga0495601_0345289 | 3300053077 | Bacteria | 968 |
| 295 | Ga0495601_0700129 | 3300053077 | Bacteria | 646 |
| 296 | Ga0495595_0000291 | 3300053084 | Bacteria | 19527 |
| 297 | Ga0495619_0035882 | 3300053085 | Bacteria | 3227 |
| 298 | Ga0495619_0448864 | 3300053085 | Bacteria | 889 |
| 299 | Ga0530510_1096495 | 3300061734 | Bacteria | 610 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006852 | Ga0075433_10643234 | Ga0075433_106432342 | 83 |
| 2 | 3300006880 | Ga0075429_101131472 | Ga0075429_1011314721 | 83 |
| 3 | 3300005331 | Ga0070670_100008171 | Ga0070670_1000081713 | 84 |
| 4 | 3300025925 | Ga0207650_10048389 | Ga0207650_100483895 | 84 |
| 5 | 3300045051 | Ga0451576_0028314 | Ga0451576_0028314_83_337 | 84 |
| 6 | iso_pu_bacteria | 2547132103 | 2547371183 | 85 |
| 7 | iso_pu_bacteria | 2843690924 | 2843695008 | 85 |
| 8 | iso_pu_bacteria | 2846033681 | 2846037379 | 85 |
| 9 | iso_pu_bacteria | 2846037992 | 2846038103 | 85 |
| 10 | 3300009177 | Ga0105248_12120480 | Ga0105248_121204801 | 86 |
| 11 | 3300049584 | Ga0501068_0982257 | Ga0501068_0982257_229_489 | 86 |
| 12 | 3300005435 | Ga0070714_100005932 | Ga0070714_10000593211 | 88 |
| 13 | 3300005436 | Ga0070713_101138544 | Ga0070713_1011385442 | 88 |
| 14 | 3300005437 | Ga0070710_10300151 | Ga0070710_103001512 | 88 |
| 15 | 3300005439 | Ga0070711_101273746 | Ga0070711_1012737461 | 88 |
| 16 | 3300006175 | Ga0070712_100851499 | Ga0070712_1008514992 | 88 |
| 17 | 3300025928 | Ga0207700_10254410 | Ga0207700_102544102 | 88 |
| 18 | 3300025981 | Ga0207640_10787901 | Ga0207640_107879012 | 88 |
| 19 | 3300035241 | Ga0373961_0063920 | Ga0373961_0063920_12_278 | 88 |
| 20 | 3300005295 | Ga0065707_10818367 | Ga0065707_108183672 | 89 |
| 21 | 3300005330 | Ga0070690_100221403 | Ga0070690_1002214032 | 89 |
| 22 | 3300005330 | Ga0070690_100345323 | Ga0070690_1003453231 | 89 |
| 23 | 3300005330 | Ga0070690_101379055 | Ga0070690_1013790551 | 89 |
| 24 | 3300005334 | Ga0068869_100770794 | Ga0068869_1007707941 | 89 |
| 25 | 3300005336 | Ga0070680_100227703 | Ga0070680_1002277032 | 89 |
| 26 | 3300005336 | Ga0070680_101285305 | Ga0070680_1012853051 | 89 |
| 27 | 3300005338 | Ga0068868_100931680 | Ga0068868_1009316801 | 89 |
| 28 | 3300005340 | Ga0070689_100008751 | Ga0070689_1000087513 | 89 |
| 29 | 3300005340 | Ga0070689_100036622 | Ga0070689_1000366224 | 89 |
| 30 | 3300005343 | Ga0070687_100001487 | Ga0070687_10000148711 | 89 |
| 31 | 3300005364 | Ga0070673_100001982 | Ga0070673_1000019827 | 89 |
| 32 | 3300005364 | Ga0070673_100224505 | Ga0070673_1002245052 | 89 |
| 33 | 3300005365 | Ga0070688_100001308 | Ga0070688_10000130811 | 89 |
| 34 | 3300005365 | Ga0070688_100007546 | Ga0070688_1000075468 | 89 |
| 35 | 3300005365 | Ga0070688_100027557 | Ga0070688_1000275574 | 89 |
| 36 | 3300005406 | Ga0070703_10142216 | Ga0070703_101422162 | 89 |
| 37 | 3300005434 | Ga0070709_10195299 | Ga0070709_101952992 | 89 |
| 38 | 3300005437 | Ga0070710_11357021 | Ga0070710_113570212 | 89 |
| 39 | 3300005438 | Ga0070701_10044707 | Ga0070701_100447072 | 89 |
| 40 | 3300005438 | Ga0070701_10411696 | Ga0070701_104116962 | 89 |
| 41 | 3300005440 | Ga0070705_100298938 | Ga0070705_1002989382 | 89 |
| 42 | 3300005440 | Ga0070705_101253793 | Ga0070705_1012537932 | 89 |
| 43 | 3300005444 | Ga0070694_100011578 | Ga0070694_1000115782 | 89 |
| 44 | 3300005444 | Ga0070694_100831578 | Ga0070694_1008315781 | 89 |
| 45 | 3300005457 | Ga0070662_101543408 | Ga0070662_1015434081 | 89 |
| 46 | 3300005466 | Ga0070685_10016116 | Ga0070685_100161162 | 89 |
| 47 | 3300005466 | Ga0070685_10545246 | Ga0070685_105452462 | 89 |
| 48 | 3300005467 | Ga0070706_100250940 | Ga0070706_1002509402 | 89 |
| 49 | 3300005468 | Ga0070707_100436675 | Ga0070707_1004366752 | 89 |
| 50 | 3300005471 | Ga0070698_100049368 | Ga0070698_1000493684 | 89 |
| 51 | 3300005471 | Ga0070698_100111320 | Ga0070698_1001113202 | 89 |
| 52 | 3300005471 | Ga0070698_100221173 | Ga0070698_1002211733 | 89 |
| 53 | 3300005536 | Ga0070697_100733922 | Ga0070697_1007339222 | 89 |
| 54 | 3300005536 | Ga0070697_101038030 | Ga0070697_1010380302 | 89 |
| 55 | 3300005544 | Ga0070686_100049353 | Ga0070686_1000493532 | 89 |
| 56 | 3300005544 | Ga0070686_100074693 | Ga0070686_1000746934 | 89 |
| 57 | 3300005544 | Ga0070686_100132465 | Ga0070686_1001324653 | 89 |
| 58 | 3300005544 | Ga0070686_100822382 | Ga0070686_1008223822 | 89 |
| 59 | 3300005545 | Ga0070695_100529100 | Ga0070695_1005291002 | 89 |
| 60 | 3300005545 | Ga0070695_100803113 | Ga0070695_1008031132 | 89 |
| 61 | 3300005546 | Ga0070696_100489275 | Ga0070696_1004892752 | 89 |
| 62 | 3300005549 | Ga0070704_100100964 | Ga0070704_1001009642 | 89 |
| 63 | 3300005549 | Ga0070704_100135616 | Ga0070704_1001356162 | 89 |
| 64 | 3300005549 | Ga0070704_100213176 | Ga0070704_1002131762 | 89 |
| 65 | 3300005549 | Ga0070704_100257644 | Ga0070704_1002576442 | 89 |
| 66 | 3300005549 | Ga0070704_100380569 | Ga0070704_1003805691 | 89 |
| 67 | 3300005549 | Ga0070704_101567956 | Ga0070704_1015679562 | 89 |
| 68 | 3300005577 | Ga0068857_100060708 | Ga0068857_1000607084 | 89 |
| 69 | 3300005577 | Ga0068857_100463546 | Ga0068857_1004635462 | 89 |
| 70 | 3300005615 | Ga0070702_100078121 | Ga0070702_1000781212 | 89 |
| 71 | 3300005617 | Ga0068859_100031558 | Ga0068859_1000315587 | 89 |
| 72 | 3300005617 | Ga0068859_101267809 | Ga0068859_1012678092 | 89 |
| 73 | 3300005618 | Ga0068864_100809702 | Ga0068864_1008097022 | 89 |
| 74 | 3300005618 | Ga0068864_100929979 | Ga0068864_1009299792 | 89 |
| 75 | 3300005618 | Ga0068864_100974481 | Ga0068864_1009744812 | 89 |
| 76 | 3300005719 | Ga0068861_100088071 | Ga0068861_1000880712 | 89 |
| 77 | 3300005719 | Ga0068861_100435734 | Ga0068861_1004357342 | 89 |
| 78 | 3300005841 | Ga0068863_100123517 | Ga0068863_1001235172 | 89 |
| 79 | 3300005841 | Ga0068863_101183403 | Ga0068863_1011834032 | 89 |
| 80 | 3300005842 | Ga0068858_101676955 | Ga0068858_1016769552 | 89 |
| 81 | 3300005843 | Ga0068860_100059072 | Ga0068860_1000590722 | 89 |
| 82 | 3300005843 | Ga0068860_100732394 | Ga0068860_1007323942 | 89 |
| 83 | 3300005844 | Ga0068862_100596651 | Ga0068862_1005966512 | 89 |
| 84 | 3300006058 | Ga0075432_10287964 | Ga0075432_102879641 | 89 |
| 85 | 3300006163 | Ga0070715_10002722 | Ga0070715_100027224 | 89 |
| 86 | 3300006237 | Ga0097621_100532036 | Ga0097621_1005320362 | 89 |
| 87 | 3300006844 | Ga0075428_100008369 | Ga0075428_1000083694 | 89 |
| 88 | 3300006844 | Ga0075428_100039561 | Ga0075428_1000395614 | 89 |
| 89 | 3300006846 | Ga0075430_100121965 | Ga0075430_1001219652 | 89 |
| 90 | 3300006847 | Ga0075431_100046392 | Ga0075431_1000463922 | 89 |
| 91 | 3300006847 | Ga0075431_100320886 | Ga0075431_1003208862 | 89 |
| 92 | 3300006847 | Ga0075431_100569333 | Ga0075431_1005693332 | 89 |
| 93 | 3300006852 | Ga0075433_10002549 | Ga0075433_1000254915 | 89 |
| 94 | 3300006852 | Ga0075433_10361192 | Ga0075433_103611922 | 89 |
| 95 | 3300006852 | Ga0075433_10521053 | Ga0075433_105210532 | 89 |
| 96 | 3300006871 | Ga0075434_100010991 | Ga0075434_1000109912 | 89 |
| 97 | 3300006871 | Ga0075434_100015087 | Ga0075434_1000150878 | 89 |
| 98 | 3300006871 | Ga0075434_100116834 | Ga0075434_1001168343 | 89 |
| 99 | 3300006871 | Ga0075434_100240374 | Ga0075434_1002403742 | 89 |
| 100 | 3300006871 | Ga0075434_100254756 | Ga0075434_1002547562 | 89 |
| 101 | 3300006871 | Ga0075434_101379465 | Ga0075434_1013794652 | 89 |
| 102 | 3300006880 | Ga0075429_100029203 | Ga0075429_1000292035 | 89 |
| 103 | 3300006880 | Ga0075429_100761816 | Ga0075429_1007618162 | 89 |
| 104 | 3300006914 | Ga0075436_100118523 | Ga0075436_1001185232 | 89 |
| 105 | 3300006914 | Ga0075436_100667461 | Ga0075436_1006674612 | 89 |
| 106 | 3300006931 | Ga0097620_100031556 | Ga0097620_1000315567 | 89 |
| 107 | 3300006931 | Ga0097620_101268022 | Ga0097620_1012680222 | 89 |
| 108 | 3300007076 | Ga0075435_100008129 | Ga0075435_10000812911 | 89 |
| 109 | 3300007076 | Ga0075435_100557213 | Ga0075435_1005572132 | 89 |
| 110 | 3300007076 | Ga0075435_100721204 | Ga0075435_1007212042 | 89 |
| 111 | 3300009094 | Ga0111539_10480656 | Ga0111539_104806562 | 89 |
| 112 | 3300009094 | Ga0111539_11563901 | Ga0111539_115639012 | 89 |
| 113 | 3300009147 | Ga0114129_10404259 | Ga0114129_104042592 | 89 |
| 114 | 3300009147 | Ga0114129_10443475 | Ga0114129_104434752 | 89 |
| 115 | 3300009147 | Ga0114129_10812873 | Ga0114129_108128732 | 89 |
| 116 | 3300009147 | Ga0114129_10938605 | Ga0114129_109386052 | 89 |
| 117 | 3300009177 | Ga0105248_10097560 | Ga0105248_100975602 | 89 |
| 118 | 3300013297 | Ga0157378_10002035 | Ga0157378_1000203515 | 89 |
| 119 | 3300013308 | Ga0157375_10060856 | Ga0157375_100608562 | 89 |
| 120 | 3300014325 | Ga0163163_11976506 | Ga0163163_119765062 | 89 |
| 121 | 3300014326 | Ga0157380_10794376 | Ga0157380_107943762 | 89 |
| 122 | 3300014745 | Ga0157377_10191227 | Ga0157377_101912271 | 89 |
| 123 | 3300014968 | Ga0157379_10073691 | Ga0157379_100736912 | 89 |
| 124 | 3300021361 | Ga0213872_10002216 | Ga0213872_100022168 | 89 |
| 125 | 3300021361 | Ga0213872_10009966 | Ga0213872_100099664 | 89 |
| 126 | 3300021384 | Ga0213876_10000316 | Ga0213876_1000031624 | 89 |
| 127 | 3300025885 | Ga0207653_10036025 | Ga0207653_100360253 | 89 |
| 128 | 3300025885 | Ga0207653_10108580 | Ga0207653_101085801 | 89 |
| 129 | 3300025905 | Ga0207685_10000988 | Ga0207685_100009884 | 89 |
| 130 | 3300025905 | Ga0207685_10297472 | Ga0207685_102974722 | 89 |
| 131 | 3300025906 | Ga0207699_10100603 | Ga0207699_101006032 | 89 |
| 132 | 3300025910 | Ga0207684_10179993 | Ga0207684_101799933 | 89 |
| 133 | 3300025917 | Ga0207660_10426423 | Ga0207660_104264232 | 89 |
| 134 | 3300025918 | Ga0207662_10003172 | Ga0207662_100031722 | 89 |
| 135 | 3300025922 | Ga0207646_11005571 | Ga0207646_110055712 | 89 |
| 136 | 3300025922 | Ga0207646_11302889 | Ga0207646_113028892 | 89 |
| 137 | 3300025927 | Ga0207687_10497312 | Ga0207687_104973121 | 89 |
| 138 | 3300025936 | Ga0207670_10000150 | Ga0207670_1000015028 | 89 |
| 139 | 3300025936 | Ga0207670_10038423 | Ga0207670_100384234 | 89 |
| 140 | 3300025936 | Ga0207670_10107384 | Ga0207670_101073842 | 89 |
| 141 | 3300025936 | Ga0207670_11222478 | Ga0207670_112224782 | 89 |
| 142 | 3300025941 | Ga0207711_10200528 | Ga0207711_102005282 | 89 |
| 143 | 3300025941 | Ga0207711_10388529 | Ga0207711_103885292 | 89 |
| 144 | 3300025942 | Ga0207689_11722760 | Ga0207689_117227602 | 89 |
| 145 | 3300025960 | Ga0207651_10021422 | Ga0207651_100214222 | 89 |
| 146 | 3300025960 | Ga0207651_10670840 | Ga0207651_106708402 | 89 |
| 147 | 3300026023 | Ga0207677_10718739 | Ga0207677_107187392 | 89 |
| 148 | 3300026035 | Ga0207703_11283595 | Ga0207703_112835952 | 89 |
| 149 | 3300026035 | Ga0207703_12025456 | Ga0207703_120254562 | 89 |
| 150 | 3300026075 | Ga0207708_10046567 | Ga0207708_100465673 | 89 |
| 151 | 3300026075 | Ga0207708_10219434 | Ga0207708_102194342 | 89 |
| 152 | 3300026088 | Ga0207641_10089444 | Ga0207641_100894442 | 89 |
| 153 | 3300026089 | Ga0207648_10033351 | Ga0207648_100333514 | 89 |
| 154 | 3300026095 | Ga0207676_10104176 | Ga0207676_101041764 | 89 |
| 155 | 3300026116 | Ga0207674_10509378 | Ga0207674_105093782 | 89 |
| 156 | 3300026116 | Ga0207674_10644087 | Ga0207674_106440872 | 89 |
| 157 | 3300026118 | Ga0207675_100136478 | Ga0207675_1001364782 | 89 |
| 158 | 3300026118 | Ga0207675_101040984 | Ga0207675_1010409842 | 89 |
| 159 | 3300027907 | Ga0207428_10128793 | Ga0207428_101287933 | 89 |
| 160 | 3300027907 | Ga0207428_10572025 | Ga0207428_105720252 | 89 |
| 161 | 3300028380 | Ga0268265_10121339 | Ga0268265_101213392 | 89 |
| 162 | 3300028380 | Ga0268265_11024548 | Ga0268265_110245482 | 89 |
| 163 | 3300028381 | Ga0268264_10317062 | Ga0268264_103170622 | 89 |
| 164 | 3300028381 | Ga0268264_11207305 | Ga0268264_112073052 | 89 |
| 165 | 3300028800 | Ga0265338_10106581 | Ga0265338_101065812 | 89 |
| 166 | 3300031728 | Ga0316578_10900014 | Ga0316578_109000142 | 89 |
| 167 | 3300034817 | Ga0373948_0125443 | Ga0373948_0125443_179_448 | 89 |
| 168 | 3300035085 | Ga0373929_0095046 | Ga0373929_0095046_68_337 | 89 |
| 169 | 3300035086 | Ga0373934_0016971 | Ga0373934_0016971_2417_2686 | 89 |
| 170 | 3300035086 | Ga0373934_0067455 | Ga0373934_0067455_735_1004 | 89 |
| 171 | 3300035086 | Ga0373934_0087721 | Ga0373934_0087721_593_901 | 89 |
| 172 | 3300035088 | Ga0373940_0214160 | Ga0373940_0214160_110_379 | 89 |
| 173 | 3300035090 | Ga0373949_0077557 | Ga0373949_0077557_480_749 | 89 |
| 174 | 3300035092 | Ga0373952_0225627 | Ga0373952_0225627_190_459 | 89 |
| 175 | 3300035111 | Ga0373923_0017093 | Ga0373923_0017093_1630_1899 | 89 |
| 176 | 3300035114 | Ga0373939_0154720 | Ga0373939_0154720_252_521 | 89 |
| 177 | 3300035115 | Ga0373941_0189476 | Ga0373941_0189476_51_320 | 89 |
| 178 | 3300035116 | Ga0373945_0103602 | Ga0373945_0103602_556_825 | 89 |
| 179 | 3300035117 | Ga0373953_0038134 | Ga0373953_0038134_1445_1714 | 89 |
| 180 | 3300035117 | Ga0373953_0123929 | Ga0373953_0123929_278_586 | 89 |
| 181 | 3300035117 | Ga0373953_0272966 | Ga0373953_0272966_104_373 | 89 |
| 182 | 3300035118 | Ga0373954_0012221 | Ga0373954_0012221_1705_1974 | 89 |
| 183 | 3300035118 | Ga0373954_0146989 | Ga0373954_0146989_736_1005 | 89 |
| 184 | 3300035119 | Ga0373956_0070061 | Ga0373956_0070061_869_1138 | 89 |
| 185 | 3300035119 | Ga0373956_0288059 | Ga0373956_0288059_310_579 | 89 |
| 186 | 3300035120 | Ga0373957_0021336 | Ga0373957_0021336_1964_2233 | 89 |
| 187 | 3300035120 | Ga0373957_0152432 | Ga0373957_0152432_166_435 | 89 |
| 188 | 3300035170 | Ga0373943_0428959 | Ga0373943_0428959_243_533 | 89 |
| 189 | 3300035170 | Ga0373943_0614666 | Ga0373943_0614666_145_414 | 89 |
| 190 | 3300035172 | Ga0373955_0008893 | Ga0373955_0008893_1256_1525 | 89 |
| 191 | 3300035241 | Ga0373961_0236110 | Ga0373961_0236110_77_346 | 89 |
| 192 | 3300035242 | Ga0373962_0131189 | Ga0373962_0131189_322_591 | 89 |
| 193 | 3300035410 | Ga0373924_0041614 | Ga0373924_0041614_279_548 | 89 |
| 194 | 3300035724 | Ga0373933_0070821 | Ga0373933_0070821_662_931 | 89 |
| 195 | 3300035724 | Ga0373933_1037097 | Ga0373933_1037097_223_492 | 89 |
| 196 | 3300036401 | Ga0373937_0012824 | Ga0373937_0012824_4055_4363 | 89 |
| 197 | 3300036401 | Ga0373937_0120245 | Ga0373937_0120245_238_507 | 89 |
| 198 | 3300039437 | Ga0436365_0585577 | Ga0436365_0585577_19776_20048 | 89 |
| 199 | 3300039447 | Ga0436361_0106919 | Ga0436361_0106919_4807_5076 | 89 |
| 200 | 3300039447 | Ga0436361_0510397 | Ga0436361_0510397_41_310 | 89 |
| 201 | 3300039447 | Ga0436361_0554014 | Ga0436361_0554014_10487_10756 | 89 |
| 202 | 3300039450 | Ga0436363_0265221 | Ga0436363_0265221_742_1014 | 89 |
| 203 | 3300042876 | Ga0451577_0063582 | Ga0451577_0063582_990_1259 | 89 |
| 204 | 3300042876 | Ga0451577_0075871 | Ga0451577_0075871_323_592 | 89 |
| 205 | 3300042876 | Ga0451577_0495984 | Ga0451577_0495984_57_335 | 89 |
| 206 | 3300044656 | Ga0466969_0000918 | Ga0466969_0000918_10049_10318 | 89 |
| 207 | 3300044656 | Ga0466969_0450012 | Ga0466969_0450012_64_333 | 89 |
| 208 | 3300044673 | Ga0453683_0620325 | Ga0453683_0620325_73_342 | 89 |
| 209 | 3300044683 | Ga0466965_0005425 | Ga0466965_0005425_1096_1365 | 89 |
| 210 | 3300044684 | Ga0466966_0101332 | Ga0466966_0101332_1105_1374 | 89 |
| 211 | 3300044693 | Ga0466961_0000218 | Ga0466961_0000218_17221_17490 | 89 |
| 212 | 3300044706 | Ga0466964_0024334 | Ga0466964_0024334_470_739 | 89 |
| 213 | 3300044712 | Ga0453684_1989093 | Ga0453684_1989093_267_536 | 89 |
| 214 | 3300044735 | Ga0466968_0094468 | Ga0466968_0094468_948_1217 | 89 |
| 215 | 3300044765 | Ga0466970_0117190 | Ga0466970_0117190_994_1263 | 89 |
| 216 | 3300045049 | Ga0466959_0003320 | Ga0466959_0003320_387_656 | 89 |
| 217 | 3300045051 | Ga0451576_0077715 | Ga0451576_0077715_2106_2375 | 89 |
| 218 | 3300045051 | Ga0451576_0296570 | Ga0451576_0296570_297_566 | 89 |
| 219 | 3300045051 | Ga0451576_0307985 | Ga0451576_0307985_287_556 | 89 |
| 220 | 3300045051 | Ga0451576_0723512 | Ga0451576_0723512_247_516 | 89 |
| 221 | 3300045051 | Ga0451576_0858881 | Ga0451576_0858881_334_612 | 89 |
| 222 | 3300045051 | Ga0451576_0958759 | Ga0451576_0958759_379_648 | 89 |
| 223 | 3300045051 | Ga0451576_1318607 | Ga0451576_1318607_180_449 | 89 |
| 224 | 3300045051 | Ga0451576_1961478 | Ga0451576_1961478_113_382 | 89 |
| 225 | 3300046454 | Ga0495592_0048706 | Ga0495592_0048706_1338_1607 | 89 |
| 226 | 3300046455 | Ga0495603_0190418 | Ga0495603_0190418_386_655 | 89 |
| 227 | 3300046459 | Ga0495629_0479430 | Ga0495629_0479430_78_347 | 89 |
| 228 | 3300046462 | Ga0495651_0263682 | Ga0495651_0263682_781_1050 | 89 |
| 229 | 3300046463 | Ga0495653_0034890 | Ga0495653_0034890_1795_2064 | 89 |
| 230 | 3300046463 | Ga0495653_0548175 | Ga0495653_0548175_97_366 | 89 |
| 231 | 3300046473 | Ga0495582_0112044 | Ga0495582_0112044_967_1236 | 89 |
| 232 | 3300046475 | Ga0495639_0166610 | Ga0495639_0166610_85_393 | 89 |
| 233 | 3300046476 | Ga0495662_0105249 | Ga0495662_0105249_600_869 | 89 |
| 234 | 3300046499 | Ga0495594_0594330 | Ga0495594_0594330_209_499 | 89 |
| 235 | 3300046511 | Ga0495608_0002219 | Ga0495608_0002219_4669_4938 | 89 |
| 236 | 3300046514 | Ga0495618_0018437 | Ga0495618_0018437_1962_2231 | 89 |
| 237 | 3300046516 | Ga0495628_0028212 | Ga0495628_0028212_1093_1362 | 89 |
| 238 | 3300046516 | Ga0495628_0254095 | Ga0495628_0254095_501_770 | 89 |
| 239 | 3300046516 | Ga0495628_0485640 | Ga0495628_0485640_158_427 | 89 |
| 240 | 3300046526 | Ga0495666_0074525 | Ga0495666_0074525_679_969 | 89 |
| 241 | 3300046533 | Ga0495640_0529199 | Ga0495640_0529199_258_527 | 89 |
| 242 | 3300046533 | Ga0495640_0662301 | Ga0495640_0662301_203_472 | 89 |
| 243 | 3300046539 | Ga0495621_0131154 | Ga0495621_0131154_35_304 | 89 |
| 244 | 3300046559 | Ga0495667_0008208 | Ga0495667_0008208_6366_6635 | 89 |
| 245 | 3300046642 | Ga0495634_0062650 | Ga0495634_0062650_918_1187 | 89 |
| 246 | 3300046642 | Ga0495634_0345380 | Ga0495634_0345380_271_540 | 89 |
| 247 | 3300046663 | Ga0495635_0082279 | Ga0495635_0082279_1448_1717 | 89 |
| 248 | 3300046663 | Ga0495635_0884324 | Ga0495635_0884324_27_335 | 89 |
| 249 | 3300046664 | Ga0495659_0202348 | Ga0495659_0202348_213_482 | 89 |
| 250 | 3300046675 | Ga0495657_0028597 | Ga0495657_0028597_1157_1426 | 89 |
| 251 | 3300046678 | Ga0495599_0058096 | Ga0495599_0058096_795_1064 | 89 |
| 252 | 3300046678 | Ga0495599_0400263 | Ga0495599_0400263_488_757 | 89 |
| 253 | 3300046681 | Ga0495647_0163158 | Ga0495647_0163158_496_804 | 89 |
| 254 | 3300046683 | Ga0495658_0145701 | Ga0495658_0145701_518_787 | 89 |
| 255 | 3300046683 | Ga0495658_0153007 | Ga0495658_0153007_82_351 | 89 |
| 256 | 3300046689 | Ga0495613_0408210 | Ga0495613_0408210_589_858 | 89 |
| 257 | 3300046689 | Ga0495613_0717565 | Ga0495613_0717565_242_511 | 89 |
| 258 | 3300046809 | Ga0495600_0031600 | Ga0495600_0031600_1220_1489 | 89 |
| 259 | 3300046809 | Ga0495600_0241500 | Ga0495600_0241500_631_900 | 89 |
| 260 | 3300047315 | Ga0495581_0070063 | Ga0495581_0070063_826_1134 | 89 |
| 261 | 3300047315 | Ga0495581_0213538 | Ga0495581_0213538_240_509 | 89 |
| 262 | 3300047317 | Ga0495604_0218018 | Ga0495604_0218018_375_644 | 89 |
| 263 | 3300047321 | Ga0495676_0594439 | Ga0495676_0594439_360_629 | 89 |
| 264 | 3300047322 | Ga0495680_0811073 | Ga0495680_0811073_118_387 | 89 |
| 265 | 3300047444 | Ga0495675_0004531 | Ga0495675_0004531_5565_5834 | 89 |
| 266 | 3300047471 | Ga0495684_0437674 | Ga0495684_0437674_338_607 | 89 |
| 267 | 3300047471 | Ga0495684_0486707 | Ga0495684_0486707_245_514 | 89 |
| 268 | 3300049589 | Ga0501073_0179078 | Ga0501073_0179078_1135_1404 | 89 |
| 269 | 3300049741 | Ga0501079_1047170 | Ga0501079_1047170_274_543 | 89 |
| 270 | 3300050507 | nmdc:mga05p37_141587_c1 | nmdc:mga05p37_141587_c1_2344_2613 | 89 |
| 271 | 3300050507 | nmdc:mga05p37_551377_c1 | nmdc:mga05p37_551377_c1_307_576 | 89 |
| 272 | 3300050507 | nmdc:mga05p37_987640_c1 | nmdc:mga05p37_987640_c1_574_843 | 89 |
| 273 | 3300050508 | nmdc:mga09592_15493_c1 | nmdc:mga09592_15493_c1_4895_5233 | 89 |
| 274 | 3300050508 | nmdc:mga09592_200587_c1 | nmdc:mga09592_200587_c1_630_899 | 89 |
| 275 | 3300050508 | nmdc:mga09592_614184_c1 | nmdc:mga09592_614184_c1_234_503 | 89 |
| 276 | 3300050508 | nmdc:mga09592_65397_c1 | nmdc:mga09592_65397_c1_2030_2299 | 89 |
| 277 | 3300050509 | nmdc:mga0qj67_110211_c1 | nmdc:mga0qj67_110211_c1_1500_1769 | 89 |
| 278 | 3300050510 | nmdc:mga06r32_47802_c1 | nmdc:mga06r32_47802_c1_1418_1687 | 89 |
| 279 | 3300050510 | nmdc:mga06r32_596186_c1 | nmdc:mga06r32_596186_c1_678_947 | 89 |
| 280 | 3300050511 | nmdc:mga08y16_211435_c1 | nmdc:mga08y16_211435_c1_403_672 | 89 |
| 281 | 3300050511 | nmdc:mga08y16_721501_c1 | nmdc:mga08y16_721501_c1_398_667 | 89 |
| 282 | 3300050511 | nmdc:mga08y16_80580_c1 | nmdc:mga08y16_80580_c1_642_920 | 89 |
| 283 | 3300050512 | nmdc:mga0n895_11343_c1 | nmdc:mga0n895_11343_c1_5892_6161 | 89 |
| 284 | 3300050512 | nmdc:mga0n895_127033_c1 | nmdc:mga0n895_127033_c1_2147_2416 | 89 |
| 285 | 3300050512 | nmdc:mga0n895_256177_c1 | nmdc:mga0n895_256177_c1_719_997 | 89 |
| 286 | 3300050512 | nmdc:mga0n895_487497_c1 | nmdc:mga0n895_487497_c1_476_745 | 89 |
| 287 | 3300050512 | nmdc:mga0n895_599136_c1 | nmdc:mga0n895_599136_c1_242_520 | 89 |
| 288 | 3300050512 | nmdc:mga0n895_640016_c1 | nmdc:mga0n895_640016_c1_185_454 | 89 |
| 289 | 3300050513 | nmdc:mga0rr50_13224_c1 | nmdc:mga0rr50_13224_c1_1537_1806 | 89 |
| 290 | 3300050513 | nmdc:mga0rr50_135741_c2 | nmdc:mga0rr50_135741_c2_521_790 | 89 |
| 291 | 3300050513 | nmdc:mga0rr50_247402_c1 | nmdc:mga0rr50_247402_c1_159_428 | 89 |
| 292 | 3300050513 | nmdc:mga0rr50_941966_c1 | nmdc:mga0rr50_941966_c1_59_337 | 89 |
| 293 | 3300050514 | nmdc:mga08x19_604970_c1 | nmdc:mga08x19_604970_c1_490_759 | 89 |
| 294 | 3300050515 | nmdc:mga0a205_4506_c1 | nmdc:mga0a205_4506_c1_5912_6190 | 89 |
| 295 | 3300050515 | nmdc:mga0a205_49553_c1 | nmdc:mga0a205_49553_c1_82_351 | 89 |
| 296 | 3300050515 | nmdc:mga0a205_512465_c1 | nmdc:mga0a205_512465_c1_574_843 | 89 |
| 297 | 3300050515 | nmdc:mga0a205_597046_c1 | nmdc:mga0a205_597046_c1_411_680 | 89 |
| 298 | 3300053077 | Ga0495601_0345289 | Ga0495601_0345289_177_446 | 89 |
| 299 | 3300053077 | Ga0495601_0700129 | Ga0495601_0700129_196_465 | 89 |
| 300 | 3300053084 | Ga0495595_0000291 | Ga0495595_0000291_5811_6080 | 89 |
| 301 | 3300053085 | Ga0495619_0035882 | Ga0495619_0035882_882_1151 | 89 |
| 302 | 3300053085 | Ga0495619_0448864 | Ga0495619_0448864_346_615 | 89 |
| 303 | 3300061734 | Ga0530510_1096495 | Ga0530510_1096495_319_600 | 89 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3lfg-assembly2.cif.gz_B | crystal structure of hpr-c-his from thermoanaerobacter tengcongensis | 0.9805 | 1 | 89 |
| 3ihs-assembly2.cif.gz_B | crystal structure of a phosphocarrier protein hpr from bacillus anthracis str. ames | 0.9727 | 2 | 81 |
| 3ccd-assembly1.cif.gz_A | 1.0 a structure of post-succinimide his15asp hpr | 0.9727 | 1 | 82 |
| 1opd-assembly1.cif.gz_A | histidine-containing protein (hpr), mutant with ser 46 replaced by asp (s46d) | 0.9713 | 1 | 81 |
| 4xwj-assembly1.cif.gz_B | histidine-containing phosphocarrier protein (hpr) and antisigma factor rsd complex | 0.969 | 1 | 82 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P69811_287_371_3.30.1340.10 | Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like | 0.9767 | 4 | 83 | 3.30.1340.10 |
| 3ccdB00 | Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like | 0.9724 | 1 | 82 | 3.30.1340.10 |
| af_P37349_156_242_3.30.1340.10 | Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like | 0.9703 | 2 | 86 | 3.30.1340.10 |
| 3ihsB00 | Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like | 0.9662 | 1 | 81 | 3.30.1340.10 |
| 3oqoD00 | Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like | 0.9569 | 2 | 79 | 3.30.1340.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C6ATM0-F1-model_v4 | HPr family phosphocarrier protein | 1.001 | 1 | 86 |
GO:0005737
GO:0009401 |
| AF-A0A1F5R2W8-F1-model_v4 | Phosphocarrier protein HPr | 1 | 1 | 89 |
GO:0005737
GO:0009401 |
| AF-A0A0M2NHT1-F1-model_v4 | Phosphocarrier protein HPr | 0.9992 | 1 | 86 |
|
| AF-A0A3M8RBL6-F1-model_v4 | HPr family phosphocarrier protein | 0.9991 | 2 | 86 |
GO:0005737
GO:0009401 |
| AF-A0A4T9WGP9-F1-model_v4 | deleted | 0.9985 | 1 | 85 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar