F397002

General Info

Members Datasets Scaffolds Average Seq Length
303 174 606 539

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10024243|Ga0105238_100242435
Length 614
Sequence VWVSIGWSCPADRQNTHRPPVAFGVKDHFSRSGAAAQRELRCAAAPLREKLFTAHLSFHYNFEETTMNHFIISPASLLAQQTPAPTPDPNDPIQRIKDEGMNRSQVMQTLSYLSDVIGPRLTASPGMKRANEWTRDQLTKFGLQNAHLEAWGPFGRGWTLKRFSAQVTDPTAIPLIAYPKAWSPGLSSPVTADVVYFDAKTEADFEKYKGKLNGKIVLTAPLRDVSAHFESLGSRLTEKELLTLADAPEPRSGGPRPNFAGNPQFRATQEFNNAKLRFFQSEGVAVLVDPGRGDGGTIFVQSAAVPQPPRDPNAPAPAFGRGTPPYDKSAPKMTPQLIVAVEHYNRIVRMLQAGEPVKMSVDLAVAWQDADPMGYNTIAEIPGADLKDEIVMIGGHMDSWHSGTGATDNAAGCAVAMEAVRIIQALGIKPRRTIRIALWSGEEQGLLGSRAYVADHFGTLQNPATSAAPATGGVNNPAGPTLITKPEYEKLSAYYNLDNGTGKIRGVYLQGNEAVRSLFRQWLAPFRDLGATTLSISNTGGTDHLSFDGIGLPGFQFIQDEIEYDTRTHHSNQDVFDRIQGDDMKQAATIMAAFIYQTAMRDQKIPRKPAPGAR

Samples

Sample ID Description Type Environment
1 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
2 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
91 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
129 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
130 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
131 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
142 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
143 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
144 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
145 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
146 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
147 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
148 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
149 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
150 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
151 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
152 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
153 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
154 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
155 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
159 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
161 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
162 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
163 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
164 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
165 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
166 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
167 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
168 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
169 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
170 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
171 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
172 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
173 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
174 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.66
Nodule 0
Rhizoplane 1.65
Rhizosphere 96.37
Stem 0
Stem Tuber 0
Unclassified 14.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105238_10024243 3300009551 Bacteria 6184
2 CNBas_1000069 3300000531 Unclassified 2836
3 JGI24751J29686_10000098 3300002459 Bacteria 48084
4 Ga0065714_10002278 3300005288 Bacteria 28662
5 Ga0065704_10106885 3300005289 Unclassified 2070
6 Ga0065712_10000133 3300005290 Bacteria 66806
7 Ga0065715_10125493 3300005293 Bacteria 2128
8 Ga0065715_10133662 3300005293 Eukaryota 1965
9 Ga0065707_10003727 3300005295 Bacteria 4771
10 Ga0065707_10009711 3300005295 Bacteria 2669
11 Ga0065707_10011615 3300005295 Bacteria 3389
12 Ga0070690_100006215 3300005330 Bacteria 6773
13 Ga0070690_100014202 3300005330 Bacteria 4722
14 Ga0070670_100001127 3300005331 Bacteria 21227
15 Ga0070670_100118607 3300005331 Bacteria 2282
16 Ga0068869_100022579 3300005334 Unclassified 4337
17 Ga0068869_100033223 3300005334 Bacteria 3641
18 Ga0068869_100050072 3300005334 Unclassified 3027
19 Ga0070680_100002150 3300005336 Bacteria 14563
20 Ga0070682_100005728 3300005337 Bacteria 6928
21 Ga0070682_100029885 3300005337 Bacteria 3285
22 Ga0070660_100047903 3300005339 Bacteria 3281
23 Ga0070687_100003521 3300005343 Bacteria 6095
24 Ga0070687_100055245 3300005343 Bacteria 2073
25 Ga0070661_100039542 3300005344 Bacteria 3437
26 Ga0070692_10007625 3300005345 Bacteria 4778
27 Ga0070669_100010044 3300005353 Bacteria 6728
28 Ga0070669_100039738 3300005353 Bacteria 3419
29 Ga0070669_100041254 3300005353 Bacteria 3357
30 Ga0070671_100003674 3300005355 Bacteria 12027
31 Ga0070673_100031927 3300005364 Bacteria 3958
32 Ga0070659_100009945 3300005366 Bacteria 6996
33 Ga0070667_100157071 3300005367 Unclassified 2001
34 Ga0070703_10000092 3300005406 Bacteria 45688
35 Ga0070709_10000033 3300005434 Bacteria 116407
36 Ga0070701_10054495 3300005438 Unclassified 2085
37 Ga0070705_100016027 3300005440 Bacteria 3886
38 Ga0070705_100022147 3300005440 Unclassified 3391
39 Ga0070700_100000157 3300005441 Bacteria 39668
40 Ga0070700_100026802 3300005441 Bacteria 3408
41 Ga0070694_100019971 3300005444 Bacteria 4268
42 Ga0070694_100107402 3300005444 Unclassified 1983
43 Ga0070708_100071630 3300005445 Bacteria 3121
44 Ga0070681_10000065 3300005458 Bacteria 76633
45 Ga0070681_10002833 3300005458 Bacteria 16027
46 Ga0070681_10009291 3300005458 Bacteria 9669
47 Ga0068867_100031855 3300005459 Bacteria 3809
48 Ga0068867_100034437 3300005459 Bacteria 3670
49 Ga0070706_100000431 3300005467 Bacteria 50311
50 Ga0070707_100000452 3300005468 Bacteria 40667
51 Ga0070707_100048400 3300005468 Bacteria 4073
52 Ga0070698_100006010 3300005471 Bacteria 13217
53 Ga0070698_100043471 3300005471 Unclassified 4605
54 Ga0070698_100058157 3300005471 Unclassified 3909
55 Ga0070698_100120145 3300005471 Bacteria 2588
56 Ga0070699_100002222 3300005518 Bacteria 17539
57 Ga0070699_100066580 3300005518 Bacteria 3127
58 Ga0070699_100084124 3300005518 Bacteria 2776
59 Ga0070679_100000013 3300005530 Bacteria 151602
60 Ga0070697_100018704 3300005536 Bacteria 5466
61 Ga0070697_100031993 3300005536 Unclassified 4232
62 Ga0070697_100044390 3300005536 Bacteria 3600
63 Ga0068853_100013946 3300005539 Bacteria 6572
64 Ga0070696_100016949 3300005546 Bacteria 4913
65 Ga0070696_100024723 3300005546 Bacteria 4082
66 Ga0070696_100055866 3300005546 Unclassified 2753
67 Ga0070665_100001953 3300005548 Bacteria 23214
68 Ga0070704_100003845 3300005549 Bacteria 8643
69 Ga0070704_100009667 3300005549 Bacteria 5842
70 Ga0070704_100014233 3300005549 Bacteria 4965
71 Ga0070704_100028692 3300005549 Bacteria 3706
72 Ga0068855_100009809 3300005563 Bacteria 11551
73 Ga0070664_100001208 3300005564 Bacteria 20575
74 Ga0070664_100022267 3300005564 Bacteria 5225
75 Ga0068857_100004706 3300005577 Bacteria 11567
76 Ga0068854_100008149 3300005578 Bacteria 6721
77 Ga0068856_100045285 3300005614 Unclassified 4331
78 Ga0070702_100018931 3300005615 Bacteria 3580
79 Ga0070702_100021997 3300005615 Bacteria 3364
80 Ga0068852_100179375 3300005616 Bacteria 1991
81 Ga0068859_100004465 3300005617 Bacteria 14273
82 Ga0068859_100007739 3300005617 Bacteria 10906
83 Ga0068859_100015034 3300005617 Bacteria 7770
84 Ga0068859_100017612 3300005617 Bacteria 7182
85 Ga0068859_100038583 3300005617 Bacteria 4791
86 Ga0068859_100063752 3300005617 Bacteria 3717
87 Ga0068859_100117841 3300005617 Bacteria 2721
88 Ga0068859_100174340 3300005617 Unclassified 2232
89 Ga0068864_100010350 3300005618 Bacteria 7702
90 Ga0068864_100034684 3300005618 Unclassified 4293
91 Ga0068864_100038332 3300005618 Bacteria 4093
92 Ga0068861_100001144 3300005719 Bacteria 16523
93 Ga0068861_100007058 3300005719 Bacteria 7679
94 Ga0068861_100022833 3300005719 Bacteria 4510
95 Ga0068863_100031232 3300005841 Bacteria 5084
96 Ga0068858_100142852 3300005842 Unclassified 2247
97 Ga0068860_100015825 3300005843 Bacteria 7364
98 Ga0068860_100093569 3300005843 Unclassified 2864
99 Ga0068860_100116130 3300005843 Bacteria 2560
100 Ga0068860_100157365 3300005843 Viruses 2190
101 Ga0068862_100144419 3300005844 Unclassified 2114
102 Ga0081455_10001897 3300005937 Bacteria 25152
103 Ga0081539_10000998 3300005985 Bacteria 52505
104 Ga0081539_10002508 3300005985 Bacteria 25695
105 Ga0097621_100014902 3300006237 Bacteria 5833
106 Ga0068871_100010199 3300006358 Bacteria 6843
107 Ga0068871_100015389 3300006358 Bacteria 5723
108 Ga0075428_100063347 3300006844 Bacteria 4048
109 Ga0075430_100034616 3300006846 Bacteria 4287
110 Ga0075430_100050473 3300006846 Bacteria 3508
111 Ga0075431_100195057 3300006847 Unclassified 2074
112 Ga0075433_10037141 3300006852 Bacteria 4200
113 Ga0068865_100010584 3300006881 Bacteria 5748
114 Ga0075436_100000020 3300006914 Bacteria 124822
115 Ga0097620_100004466 3300006931 Bacteria 14273
116 Ga0097620_100007740 3300006931 Bacteria 10906
117 Ga0097620_100015034 3300006931 Bacteria 7770
118 Ga0097620_100017610 3300006931 Bacteria 7182
119 Ga0097620_100038585 3300006931 Bacteria 4791
120 Ga0097620_100063754 3300006931 Bacteria 3717
121 Ga0097620_100117842 3300006931 Bacteria 2721
122 Ga0097620_100174342 3300006931 Unclassified 2232
123 Ga0075435_100000165 3300007076 Bacteria 38337
124 Ga0075435_100014754 3300007076 Bacteria 5855
125 Ga0105240_10017529 3300009093 Bacteria 9648
126 Ga0105240_10068091 3300009093 Bacteria 4410
127 Ga0111539_10001778 3300009094 Bacteria 28642
128 Ga0111539_10021324 3300009094 Bacteria 7976
129 Ga0111539_10021437 3300009094 Bacteria 7951
130 Ga0105245_10081180 3300009098 Unclassified 2964
131 Ga0105247_10008505 3300009101 Bacteria 6251
132 Ga0114129_10004385 3300009147 Bacteria 19901
133 Ga0114129_10056449 3300009147 Bacteria 5500
134 Ga0114129_10083585 3300009147 Unclassified 4434
135 Ga0114129_10142096 3300009147 Bacteria 3289
136 Ga0114129_10240932 3300009147 Bacteria 2431
137 Ga0114129_10331102 3300009147 Bacteria 2022
138 Ga0105243_10004652 3300009148 Bacteria 10806
139 Ga0105241_10018621 3300009174 Bacteria 5110
140 Ga0105241_10199273 3300009174 Bacteria 1671
141 Ga0105242_10052053 3300009176 Bacteria 3339
142 Ga0105248_10028084 3300009177 Bacteria 6267
143 Ga0105237_10000468 3300009545 Bacteria 57134
144 Ga0105237_10028051 3300009545 Bacteria 5736
145 Ga0105249_10046246 3300009553 Bacteria 3961
146 Ga0105249_10128464 3300009553 Bacteria 2417
147 Ga0105249_10185256 3300009553 Unclassified 2028
148 Ga0105239_10228624 3300010375 Unclassified 2087
149 Ga0157373_10040324 3300013100 Bacteria 3341
150 Ga0157374_10037499 3300013296 Bacteria 4449
151 Ga0157378_10004619 3300013297 Bacteria 12080
152 Ga0157378_10005931 3300013297 Bacteria 10705
153 Ga0157378_10009894 3300013297 Bacteria 8312
154 Ga0157378_10017553 3300013297 Bacteria 6281
155 Ga0163162_10011328 3300013306 Bacteria 8697
156 Ga0163162_10022571 3300013306 Bacteria 6204
157 Ga0163162_10070739 3300013306 Bacteria 3540
158 Ga0163162_10173589 3300013306 Unclassified 2280
159 Ga0163162_10220403 3300013306 Bacteria 2027
160 Ga0157372_10002248 3300013307 Bacteria 20959
161 Ga0157372_10035379 3300013307 Bacteria 5498
162 Ga0157375_10064532 3300013308 Bacteria 3646
163 Ga0157375_10074985 3300013308 Bacteria 3406
164 Ga0163163_10000928 3300014325 Bacteria 24852
165 Ga0163163_10005117 3300014325 Bacteria 11306
166 Ga0163163_10013491 3300014325 Bacteria 7485
167 Ga0163163_10028808 3300014325 Bacteria 5337
168 Ga0163163_10063000 3300014325 Bacteria 3676
169 Ga0163163_10063971 3300014325 Unclassified 3650
170 Ga0163163_10144468 3300014325 Unclassified 2422
171 Ga0157380_10004149 3300014326 Bacteria 10011
172 Ga0157380_10010646 3300014326 Bacteria 6622
173 Ga0157376_10021124 3300014969 Bacteria 5052
174 Ga0163161_10001822 3300017792 Bacteria 15566
175 Ga0163161_10007069 3300017792 Bacteria 7763
176 Ga0213875_10002568 3300021388 Bacteria 10817
177 Ga0207653_10000291 3300025885 Bacteria 29231
178 Ga0207653_10003468 3300025885 Bacteria 4964
179 Ga0207647_10002727 3300025904 Bacteria 13332
180 Ga0207699_10000002 3300025906 Bacteria 662194
181 Ga0207643_10007032 3300025908 Bacteria 6029
182 Ga0207643_10008465 3300025908 Bacteria 5518
183 Ga0207643_10051964 3300025908 Unclassified 2327
184 Ga0207684_10000316 3300025910 Bacteria 68606
185 Ga0207684_10002187 3300025910 Bacteria 20004
186 Ga0207684_10037060 3300025910 Bacteria 4139
187 Ga0207707_10000004 3300025912 Bacteria 391281
188 Ga0207707_10009472 3300025912 Bacteria 8446
189 Ga0207707_10009546 3300025912 Bacteria 8417
190 Ga0207671_10001108 3300025914 Bacteria 32488
191 Ga0207660_10001789 3300025917 Bacteria 14353
192 Ga0207662_10012198 3300025918 Bacteria 4784
193 Ga0207662_10016421 3300025918 Bacteria 4178
194 Ga0207657_10073950 3300025919 Bacteria 2879
195 Ga0207652_10000122 3300025921 Bacteria 85075
196 Ga0207652_10067006 3300025921 Unclassified 3112
197 Ga0207646_10000798 3300025922 Bacteria 41005
198 Ga0207646_10035087 3300025922 Bacteria 4532
199 Ga0207646_10061110 3300025922 Bacteria 3364
200 Ga0207646_10116870 3300025922 Bacteria 2395
201 Ga0207681_10040012 3300025923 Bacteria 3116
202 Ga0207681_10093306 3300025923 Bacteria 2154
203 Ga0207694_10015713 3300025924 Bacteria 5710
204 Ga0207650_10000001 3300025925 Bacteria 1545726
205 Ga0207650_10067222 3300025925 Bacteria 2689
206 Ga0207650_10119107 3300025925 Unclassified 2053
207 Ga0207687_10117101 3300025927 Unclassified 1987
208 Ga0207690_10054411 3300025932 Bacteria 2691
209 Ga0207706_10032189 3300025933 Bacteria 4670
210 Ga0207686_10020311 3300025934 Bacteria 3792
211 Ga0207704_10003090 3300025938 Bacteria 7523
212 Ga0207691_10020511 3300025940 Bacteria 6249
213 Ga0207691_10061615 3300025940 Bacteria 3407
214 Ga0207711_10006168 3300025941 Bacteria 10130
215 Ga0207711_10172662 3300025941 Unclassified 1962
216 Ga0207689_10049848 3300025942 Bacteria 3454
217 Ga0207667_10000543 3300025949 Bacteria 49789
218 Ga0207667_10044631 3300025949 Bacteria 4696
219 Ga0207667_10152437 3300025949 Bacteria 2379
220 Ga0207651_10037437 3300025960 Unclassified 3178
221 Ga0207712_10003471 3300025961 Bacteria 9954
222 Ga0207712_10052721 3300025961 Bacteria 2851
223 Ga0207712_10076880 3300025961 Bacteria 2418
224 Ga0207712_10088329 3300025961 Bacteria 2275
225 Ga0207658_10130379 3300025986 Unclassified 2019
226 Ga0207658_10131683 3300025986 Unclassified 2010
227 Ga0207639_10078257 3300026041 Bacteria 2609
228 Ga0207708_10000331 3300026075 Bacteria 37200
229 Ga0207708_10008684 3300026075 Bacteria 7520
230 Ga0207708_10030558 3300026075 Bacteria 4085
231 Ga0207708_10053938 3300026075 Bacteria 3064
232 Ga0207702_10029830 3300026078 Bacteria 4541
233 Ga0207676_10002621 3300026095 Bacteria 12825
234 Ga0207676_10166870 3300026095 Unclassified 1914
235 Ga0207674_10000023 3300026116 Bacteria 157752
236 Ga0207675_100004103 3300026118 Bacteria 14102
237 Ga0207675_100012771 3300026118 Bacteria 7846
238 Ga0207675_100025167 3300026118 Bacteria 5539
239 Ga0207428_10036876 3300027907 Unclassified 3983
240 Ga0207428_10046537 3300027907 Bacteria 3489
241 Ga0268266_10000939 3300028379 Bacteria 37154
242 Ga0268265_10060703 3300028380 Unclassified 2898
243 Ga0268265_10096724 3300028380 Bacteria 2374
244 Ga0268264_10159199 3300028381 Viruses 2032
245 Ga0265338_10004678 3300028800 Bacteria 18361
246 Ga0265325_10019932 3300031241 Bacteria 3701
247 Ga0265339_10003130 3300031249 Bacteria 11649
248 Ga0265339_10026687 3300031249 Bacteria 3306
249 Ga0307513_10002126 3300031456 Bacteria 27811
250 Ga0307406_10110869 3300031901 Unclassified 1889
251 Ga0307415_100069991 3300032126 Bacteria 2462
252 Ga0373951_0000103 3300035091 Bacteria 32935
253 Ga0373937_0156776 3300036401 Bacteria 2134
254 Ga0395900_0070872 3300037418 Bacteria 3583
255 Ga0395905_0059757 3300037471 Unclassified 3564
256 Ga0395905_0084535 3300037471 Bacteria 2973
257 Ga0436364_1471477 3300037853 Bacteria 27952
258 Ga0395901_0156587 3300038443 Bacteria 2393
259 Ga0436365_1647429 3300039437 Bacteria 1664
260 Ga0451577_0000227 3300042876 Bacteria 114840
261 Ga0453683_0000210 3300044673 Bacteria 78708
262 Ga0453684_0000033 3300044712 Bacteria 734012
263 Ga0453684_0123226 3300044712 Bacteria 3126
264 Ga0451576_0028231 3300045051 Bacteria 6013
265 Ga0495592_0000007 3300046454 Bacteria 180892
266 Ga0495618_0003735 3300046514 Bacteria 9422
267 Ga0495628_0000269 3300046516 Bacteria 46574
268 Ga0495630_0145337 3300046517 Bacteria 1803
269 Ga0495666_0043452 3300046526 Bacteria 2171
270 Ga0495586_0000401 3300046535 Bacteria 26270
271 Ga0495645_0011896 3300046543 Bacteria 6131
272 Ga0495599_0002580 3300046678 Bacteria 10556
273 Ga0495624_0050891 3300046690 Bacteria 2623
274 Ga0495674_0006366 3300047319 Bacteria 11316
275 Ga0496102_0053412 3300048905 Unclassified 3683
276 Ga0496109_0000014 3300048912 Bacteria 223246
277 Ga0496112_0036438 3300048915 Bacteria 4799
278 Ga0496112_0145203 3300048915 Bacteria 2341
279 Ga0496112_0183046 3300048915 Bacteria 2059
280 Ga0501291_002979 3300049514 Bacteria 2080
281 Ga0501038_0003285 3300049574 Bacteria 15069
282 Ga0501073_0032567 3300049589 Unclassified 3716
283 Ga0501217_004491 3300049661 Bacteria 2873
284 Ga0501243_003049 3300049675 Unclassified 2472
285 Ga0501249_007237 3300049679 Bacteria 2292
286 Ga0501225_0002368 3300049705 Bacteria 5813
287 nmdc:mga05p37_22021_c1 3300050507 Bacteria 7722
288 nmdc:mga05p37_48116_c1 3300050507 Bacteria 5245
289 nmdc:mga05p37_94293_c1 3300050507 Unclassified 3688
290 nmdc:mga06r32_214554_c1 3300050510 Bacteria 1912
291 nmdc:mga06r32_78933_c1 3300050510 Bacteria 3201
292 nmdc:mga08y16_18779_c1 3300050511 Bacteria 7284
293 nmdc:mga08y16_29628_c1 3300050511 Bacteria 5764
294 nmdc:mga08y16_63948_c1 3300050511 Bacteria 3843
295 nmdc:mga0n895_59965_c1 3300050512 Bacteria 3754
296 nmdc:mga0rr50_139_c1 3300050513 Bacteria 40055
297 nmdc:mga08x19_3_c1 3300050514 Bacteria 654433
298 nmdc:mga0a205_11036_c1 3300050515 Bacteria 8315
299 nmdc:mga0a205_44917_c1 3300050515 Bacteria 4260
300 nmdc:mga0a205_48709_c1 3300050515 Bacteria 4090
301 Ga0500555_005474 3300053103 Bacteria 3600
302 Ga0500616_0009863 3300053153 Bacteria 5756
303 Ga0530510_0060245 3300061734 Bacteria 2747
304 Ga0105238_10024243
305 CNBas_1000069
306 JGI24751J29686_10000098
307 Ga0065714_10002278
308 Ga0065704_10106885
309 Ga0065712_10000133
310 Ga0065715_10125493
311 Ga0065715_10133662
312 Ga0065707_10003727
313 Ga0065707_10009711
314 Ga0065707_10011615
315 Ga0070690_100006215
316 Ga0070690_100014202
317 Ga0070670_100001127
318 Ga0070670_100118607
319 Ga0068869_100022579
320 Ga0068869_100033223
321 Ga0068869_100050072
322 Ga0070680_100002150
323 Ga0070682_100005728
324 Ga0070682_100029885
325 Ga0070660_100047903
326 Ga0070687_100003521
327 Ga0070687_100055245
328 Ga0070661_100039542
329 Ga0070692_10007625
330 Ga0070669_100010044
331 Ga0070669_100039738
332 Ga0070669_100041254
333 Ga0070671_100003674
334 Ga0070673_100031927
335 Ga0070659_100009945
336 Ga0070667_100157071
337 Ga0070703_10000092
338 Ga0070709_10000033
339 Ga0070701_10054495
340 Ga0070705_100016027
341 Ga0070705_100022147
342 Ga0070700_100000157
343 Ga0070700_100026802
344 Ga0070694_100019971
345 Ga0070694_100107402
346 Ga0070708_100071630
347 Ga0070681_10000065
348 Ga0070681_10002833
349 Ga0070681_10009291
350 Ga0068867_100031855
351 Ga0068867_100034437
352 Ga0070706_100000431
353 Ga0070707_100000452
354 Ga0070707_100048400
355 Ga0070698_100006010
356 Ga0070698_100043471
357 Ga0070698_100058157
358 Ga0070698_100120145
359 Ga0070699_100002222
360 Ga0070699_100066580
361 Ga0070699_100084124
362 Ga0070679_100000013
363 Ga0070697_100018704
364 Ga0070697_100031993
365 Ga0070697_100044390
366 Ga0068853_100013946
367 Ga0070696_100016949
368 Ga0070696_100024723
369 Ga0070696_100055866
370 Ga0070665_100001953
371 Ga0070704_100003845
372 Ga0070704_100009667
373 Ga0070704_100014233
374 Ga0070704_100028692
375 Ga0068855_100009809
376 Ga0070664_100001208
377 Ga0070664_100022267
378 Ga0068857_100004706
379 Ga0068854_100008149
380 Ga0068856_100045285
381 Ga0070702_100018931
382 Ga0070702_100021997
383 Ga0068852_100179375
384 Ga0068859_100004465
385 Ga0068859_100007739
386 Ga0068859_100015034
387 Ga0068859_100017612
388 Ga0068859_100038583
389 Ga0068859_100063752
390 Ga0068859_100117841
391 Ga0068859_100174340
392 Ga0068864_100010350
393 Ga0068864_100034684
394 Ga0068864_100038332
395 Ga0068861_100001144
396 Ga0068861_100007058
397 Ga0068861_100022833
398 Ga0068863_100031232
399 Ga0068858_100142852
400 Ga0068860_100015825
401 Ga0068860_100093569
402 Ga0068860_100116130
403 Ga0068860_100157365
404 Ga0068862_100144419
405 Ga0081455_10001897
406 Ga0081539_10000998
407 Ga0081539_10002508
408 Ga0097621_100014902
409 Ga0068871_100010199
410 Ga0068871_100015389
411 Ga0075428_100063347
412 Ga0075430_100034616
413 Ga0075430_100050473
414 Ga0075431_100195057
415 Ga0075433_10037141
416 Ga0068865_100010584
417 Ga0075436_100000020
418 Ga0097620_100004466
419 Ga0097620_100007740
420 Ga0097620_100015034
421 Ga0097620_100017610
422 Ga0097620_100038585
423 Ga0097620_100063754
424 Ga0097620_100117842
425 Ga0097620_100174342
426 Ga0075435_100000165
427 Ga0075435_100014754
428 Ga0105240_10017529
429 Ga0105240_10068091
430 Ga0111539_10001778
431 Ga0111539_10021324
432 Ga0111539_10021437
433 Ga0105245_10081180
434 Ga0105247_10008505
435 Ga0114129_10004385
436 Ga0114129_10056449
437 Ga0114129_10083585
438 Ga0114129_10142096
439 Ga0114129_10240932
440 Ga0114129_10331102
441 Ga0105243_10004652
442 Ga0105241_10018621
443 Ga0105241_10199273
444 Ga0105242_10052053
445 Ga0105248_10028084
446 Ga0105237_10000468
447 Ga0105237_10028051
448 Ga0105249_10046246
449 Ga0105249_10128464
450 Ga0105249_10185256
451 Ga0105239_10228624
452 Ga0157373_10040324
453 Ga0157374_10037499
454 Ga0157378_10004619
455 Ga0157378_10005931
456 Ga0157378_10009894
457 Ga0157378_10017553
458 Ga0163162_10011328
459 Ga0163162_10022571
460 Ga0163162_10070739
461 Ga0163162_10173589
462 Ga0163162_10220403
463 Ga0157372_10002248
464 Ga0157372_10035379
465 Ga0157375_10064532
466 Ga0157375_10074985
467 Ga0163163_10000928
468 Ga0163163_10005117
469 Ga0163163_10013491
470 Ga0163163_10028808
471 Ga0163163_10063000
472 Ga0163163_10063971
473 Ga0163163_10144468
474 Ga0157380_10004149
475 Ga0157380_10010646
476 Ga0157376_10021124
477 Ga0163161_10001822
478 Ga0163161_10007069
479 Ga0213875_10002568
480 Ga0207653_10000291
481 Ga0207653_10003468
482 Ga0207647_10002727
483 Ga0207699_10000002
484 Ga0207643_10007032
485 Ga0207643_10008465
486 Ga0207643_10051964
487 Ga0207684_10000316
488 Ga0207684_10002187
489 Ga0207684_10037060
490 Ga0207707_10000004
491 Ga0207707_10009472
492 Ga0207707_10009546
493 Ga0207671_10001108
494 Ga0207660_10001789
495 Ga0207662_10012198
496 Ga0207662_10016421
497 Ga0207657_10073950
498 Ga0207652_10000122
499 Ga0207652_10067006
500 Ga0207646_10000798
501 Ga0207646_10035087
502 Ga0207646_10061110
503 Ga0207646_10116870
504 Ga0207681_10040012
505 Ga0207681_10093306
506 Ga0207694_10015713
507 Ga0207650_10000001
508 Ga0207650_10067222
509 Ga0207650_10119107
510 Ga0207687_10117101
511 Ga0207690_10054411
512 Ga0207706_10032189
513 Ga0207686_10020311
514 Ga0207704_10003090
515 Ga0207691_10020511
516 Ga0207691_10061615
517 Ga0207711_10006168
518 Ga0207711_10172662
519 Ga0207689_10049848
520 Ga0207667_10000543
521 Ga0207667_10044631
522 Ga0207667_10152437
523 Ga0207651_10037437
524 Ga0207712_10003471
525 Ga0207712_10052721
526 Ga0207712_10076880
527 Ga0207712_10088329
528 Ga0207658_10130379
529 Ga0207658_10131683
530 Ga0207639_10078257
531 Ga0207708_10000331
532 Ga0207708_10008684
533 Ga0207708_10030558
534 Ga0207708_10053938
535 Ga0207702_10029830
536 Ga0207676_10002621
537 Ga0207676_10166870
538 Ga0207674_10000023
539 Ga0207675_100004103
540 Ga0207675_100012771
541 Ga0207675_100025167
542 Ga0207428_10036876
543 Ga0207428_10046537
544 Ga0268266_10000939
545 Ga0268265_10060703
546 Ga0268265_10096724
547 Ga0268264_10159199
548 Ga0265338_10004678
549 Ga0265325_10019932
550 Ga0265339_10003130
551 Ga0265339_10026687
552 Ga0307513_10002126
553 Ga0307406_10110869
554 Ga0307415_100069991
555 Ga0373951_0000103
556 Ga0373937_0156776
557 Ga0395900_0070872
558 Ga0395905_0059757
559 Ga0395905_0084535
560 Ga0436364_1471477
561 Ga0395901_0156587
562 Ga0436365_1647429
563 Ga0451577_0000227
564 Ga0453683_0000210
565 Ga0453684_0000033
566 Ga0453684_0123226
567 Ga0451576_0028231
568 Ga0495592_0000007
569 Ga0495618_0003735
570 Ga0495628_0000269
571 Ga0495630_0145337
572 Ga0495666_0043452
573 Ga0495586_0000401
574 Ga0495645_0011896
575 Ga0495599_0002580
576 Ga0495624_0050891
577 Ga0495674_0006366
578 Ga0496102_0053412
579 Ga0496109_0000014
580 Ga0496112_0036438
581 Ga0496112_0145203
582 Ga0496112_0183046
583 Ga0501291_002979
584 Ga0501038_0003285
585 Ga0501073_0032567
586 Ga0501217_004491
587 Ga0501243_003049
588 Ga0501249_007237
589 Ga0501225_0002368
590 nmdc:mga05p37_22021_c1
591 nmdc:mga05p37_48116_c1
592 nmdc:mga05p37_94293_c1
593 nmdc:mga06r32_214554_c1
594 nmdc:mga06r32_78933_c1
595 nmdc:mga08y16_18779_c1
596 nmdc:mga08y16_29628_c1
597 nmdc:mga08y16_63948_c1
598 nmdc:mga0n895_59965_c1
599 nmdc:mga0rr50_139_c1
600 nmdc:mga08x19_3_c1
601 nmdc:mga0a205_11036_c1
602 nmdc:mga0a205_44917_c1
603 nmdc:mga0a205_48709_c1
604 Ga0500555_005474
605 Ga0500616_0009863
606 Ga0530510_0060245

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04389

Peptidase_M28

Peptidase family M28

376

595

0.82

PF01546

Peptidase_M20

Peptidase family M20/M25/M40

392

597

0.65

Structural Annotation

Top 5 Hits

ID Description Score Start End
1oy0-assembly1.cif.gz_A the crystal structure of the first enzyme of pantothenate biosynthetic pathway, ketopantoate hydroxymethyltransferase from mycobacterium tuberculosis shows a decameric assembly and terminal helix-swapping 0.7961 212 236
3iib-assembly1.cif.gz_A-2 crystal structure of peptidase m28 precursor (yp_926796.1) from shewanella amazonensis sb2b at 1.70 a resolution 0.7901 38 545
3b3t-assembly1.cif.gz_A crystal structure of the d118n mutant of the aminopeptidase from vibrio proteolyticus 0.7807 319 537
1amp-assembly1.cif.gz_A crystal structure of aeromonas proteolytica aminopeptidase: a prototypical member of the co-catalytic zinc enzyme family 0.7798 319 537
3ki9-assembly1.cif.gz_A crystal structure of staphylococcus aureus metallopeptidase (sapep/dape) in the mn2+ bound form 0.7758 321 387
ID Description Score Start End Superfamily
3iibA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8831 38 545 3.40.630.10
3iibA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8512 38 545 3.40.630.10
af_Q55DP8_2_191_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8266 319 390 3.40.630.10
af_Q2FV21_2_270_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.8019 212 236 3.20.20.60
1oy0A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.7961 212 236 3.20.20.60
ID Description Score Start End GO Terms
AF-A0A7C7Y6H3-F1-model_v4 M28 family peptidase 0.9672 419 543
AF-A0A7W1QZ37-F1-model_v4 Carboxypeptidase Q (Plasma glutamate carboxypeptidase) 0.966 327 545 GO:0004180
GO:0005576
GO:0005764
GO:0070573
AF-A0A7W1W737-F1-model_v4 Carboxypeptidase Q (Plasma glutamate carboxypeptidase) 0.9624 417 545 GO:0004180
GO:0005576
GO:0005764
GO:0070573
AF-A0A160VIR9-F1-model_v4 Carboxypeptidase Q (Plasma glutamate carboxypeptidase) 0.9587 321 542 GO:0004177
GO:0004180
GO:0005576
GO:0005764
GO:0005783
GO:0005794
GO:0070573
AF-A0A5C9C5U6-F1-model_v4 Peptidase M28 0.9554 423 548

Map