F396988

General Info

Members Datasets Scaffolds Average Seq Length
303 123 303 272

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10786672|Ga0114129_107866722
Length 296
Sequence VTADPRLTAGPAVIAHPRDGGQPVLPLVVFDDVSFEYPRPEASRGGGFSLAGVSFAITAGEVFGVIGPNSAGKTTLLRLLTRVVRPKRGVVRLDGRPVGSLGHAELARQIAVVPQEAPRPFPFSVEQLVLMGRYPHAPSRFFESDEDRAQAVAAMDATGVLALAALPLEQLSGGERQRAMLARALAQQPRLLVLDEPTSHLDLHYQAEAAALLQRVNGERGMTVLLVSHDLNLAGEVCDRLLLLSGGRVARVGGPADVLRRDVLEDVFRCAVVVDVNPMSGRPLVRVAWPEPRTRR

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
9 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
67 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
70 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
71 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
72 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
73 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
74 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
75 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
76 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
77 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
78 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
79 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
80 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
81 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
82 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
83 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
84 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
85 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
86 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
87 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
88 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
89 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
90 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
91 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
100 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
101 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
102 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
103 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
104 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
105 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
106 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
107 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
108 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
109 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
110 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
111 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
112 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
113 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
114 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
115 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
116 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
117 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
118 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
119 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
120 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
121 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
122 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
123 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.66
Rhizosphere 99.01
Stem 0
Stem Tuber 0
Unclassified 0.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10007134 3300003203 Bacteria 5117
2 Ga0068869_100019029 3300005334 Bacteria 4684
3 Ga0070680_100020727 3300005336 Bacteria 5216
4 Ga0070680_100131465 3300005336 Bacteria 2094
5 Ga0070689_100363194 3300005340 Bacteria 1217
6 Ga0070691_10012049 3300005341 Bacteria 3959
7 Ga0070668_100146591 3300005347 Bacteria 1906
8 Ga0070669_100000928 3300005353 Bacteria 21349
9 Ga0070669_100054287 3300005353 Bacteria 2934
10 Ga0070703_10002042 3300005406 Bacteria 5890
11 Ga0070701_10006508 3300005438 Bacteria 4921
12 Ga0070711_100190137 3300005439 Bacteria 1577
13 Ga0070705_100034604 3300005440 Bacteria 2825
14 Ga0070705_100082717 3300005440 Bacteria 1976
15 Ga0070705_100261743 3300005440 Bacteria 1220
16 Ga0070694_100032921 3300005444 Bacteria 3406
17 Ga0070694_100321715 3300005444 Bacteria 1191
18 Ga0070708_100016671 3300005445 Bacteria 6104
19 Ga0070708_100039454 3300005445 Bacteria 4131
20 Ga0070708_100110200 3300005445 Bacteria 2529
21 Ga0070662_100028778 3300005457 Bacteria 3870
22 Ga0070681_10061145 3300005458 Bacteria 3743
23 Ga0070706_100208975 3300005467 Bacteria 1823
24 Ga0070706_100627158 3300005467 Bacteria 998
25 Ga0070706_100627161 3300005467 Bacteria 998
26 Ga0070707_100086664 3300005468 Bacteria 3028
27 Ga0070707_100231193 3300005468 Bacteria 1800
28 Ga0070699_100010889 3300005518 Bacteria 7867
29 Ga0070699_100129688 3300005518 Bacteria 2222
30 Ga0070699_100180003 3300005518 Bacteria 1876
31 Ga0070699_100255151 3300005518 Bacteria 1567
32 Ga0070697_100056293 3300005536 Bacteria 3199
33 Ga0070672_100046327 3300005543 Bacteria 3369
34 Ga0070695_100003851 3300005545 Bacteria 8753
35 Ga0070695_100013918 3300005545 Bacteria 4842
36 Ga0070696_100018116 3300005546 Bacteria 4757
37 Ga0070696_100031948 3300005546 Bacteria 3610
38 Ga0070696_100069486 3300005546 Bacteria 2475
39 Ga0070696_100236835 3300005546 Bacteria 1375
40 Ga0070704_100077658 3300005549 Bacteria 2433
41 Ga0070704_100080231 3300005549 Bacteria 2399
42 Ga0068857_100037652 3300005577 Bacteria 4286
43 Ga0068859_100085162 3300005617 Bacteria 3206
44 Ga0068859_100755968 3300005617 Bacteria 1061
45 Ga0068863_100144025 3300005841 Bacteria 2279
46 Ga0068863_100341091 3300005841 Bacteria 1458
47 Ga0068860_100617967 3300005843 Bacteria 1090
48 Ga0068862_100490716 3300005844 Archaea 1164
49 Ga0068862_100688349 3300005844 Bacteria 989
50 Ga0081455_10077366 3300005937 Bacteria 2737
51 Ga0081539_10000920 3300005985 Bacteria 55416
52 Ga0070712_100014746 3300006175 Bacteria 5019
53 Ga0075428_100000277 3300006844 Bacteria 51053
54 Ga0075428_100004521 3300006844 Bacteria 15363
55 Ga0075428_100007434 3300006844 Bacteria 12137
56 Ga0075428_100014308 3300006844 Bacteria 8820
57 Ga0075428_100089807 3300006844 Bacteria 3351
58 Ga0075428_100092280 3300006844 Bacteria 3301
59 Ga0075428_100221130 3300006844 Bacteria 2045
60 Ga0075428_100734386 3300006844 Bacteria 1051
61 Ga0075430_100006731 3300006846 Bacteria 9694
62 Ga0075430_100044005 3300006846 Bacteria 3776
63 Ga0075430_100046028 3300006846 Bacteria 3684
64 Ga0075430_100079631 3300006846 Bacteria 2745
65 Ga0075430_100158992 3300006846 Bacteria 1881
66 Ga0075430_100233806 3300006846 Bacteria 1524
67 Ga0075431_100000902 3300006847 Bacteria 26158
68 Ga0075431_100001042 3300006847 Bacteria 24720
69 Ga0075431_100001294 3300006847 Bacteria 22848
70 Ga0075431_100001572 3300006847 Bacteria 21215
71 Ga0075431_100003209 3300006847 Bacteria 15821
72 Ga0075431_100019588 3300006847 Bacteria 6902
73 Ga0075431_100020474 3300006847 Bacteria 6757
74 Ga0075431_100032999 3300006847 Bacteria 5336
75 Ga0075431_100047115 3300006847 Bacteria 4444
76 Ga0075431_100049784 3300006847 Bacteria 4320
77 Ga0075433_10017646 3300006852 Bacteria 5918
78 Ga0075433_10074851 3300006852 Bacteria 2980
79 Ga0075433_10183362 3300006852 Bacteria 1863
80 Ga0075433_10208736 3300006852 Bacteria 1736
81 Ga0075433_10477786 3300006852 Bacteria 1098
82 Ga0075434_100022093 3300006871 Bacteria 6196
83 Ga0075434_100027371 3300006871 Bacteria 5597
84 Ga0075434_100063008 3300006871 Bacteria 3691
85 Ga0075434_100154214 3300006871 Bacteria 2317
86 Ga0075434_100181677 3300006871 Bacteria 2124
87 Ga0075434_100388222 3300006871 Bacteria 1417
88 Ga0075429_100000097 3300006880 Bacteria 47892
89 Ga0075429_100009023 3300006880 Bacteria 8665
90 Ga0075429_100013171 3300006880 Bacteria 7174
91 Ga0075429_100014740 3300006880 Bacteria 6775
92 Ga0075429_100027559 3300006880 Bacteria 4931
93 Ga0075429_100032633 3300006880 Bacteria 4525
94 Ga0075429_100061413 3300006880 Bacteria 3274
95 Ga0075429_100313491 3300006880 Bacteria 1373
96 Ga0075436_100186772 3300006914 Bacteria 1466
97 Ga0097620_100085162 3300006931 Bacteria 3206
98 Ga0097620_100755907 3300006931 Bacteria 1061
99 Ga0075435_100005962 3300007076 Bacteria 8573
100 Ga0075435_100019180 3300007076 Bacteria 5216
101 Ga0075435_100048838 3300007076 Bacteria 3401
102 Ga0075435_100204889 3300007076 Bacteria 1672
103 Ga0111539_10049300 3300009094 Bacteria 5023
104 Ga0111539_10053305 3300009094 Bacteria 4814
105 Ga0111539_10057968 3300009094 Bacteria 4596
106 Ga0111539_10084832 3300009094 Bacteria 3723
107 Ga0111539_10126141 3300009094 Bacteria 2999
108 Ga0111539_10220851 3300009094 Bacteria 2207
109 Ga0114129_10000315 3300009147 Bacteria 56522
110 Ga0114129_10002048 3300009147 Bacteria 27665
111 Ga0114129_10002668 3300009147 Bacteria 24836
112 Ga0114129_10009518 3300009147 Bacteria 13860
113 Ga0114129_10013755 3300009147 Bacteria 11534
114 Ga0114129_10022823 3300009147 Bacteria 8872
115 Ga0114129_10096788 3300009147 Bacteria 4086
116 Ga0114129_10257139 3300009147 Bacteria 2342
117 Ga0114129_10406013 3300009147 Bacteria 1795
118 Ga0114129_10563117 3300009147 Bacteria 1481
119 Ga0114129_10786672 3300009147 Bacteria 1215
120 Ga0105243_10018065 3300009148 Bacteria 5336
121 Ga0105243_10035334 3300009148 Bacteria 3874
122 Ga0105243_10509958 3300009148 Bacteria 1142
123 Ga0105243_10536921 3300009148 Archaea 1115
124 Ga0105248_10139276 3300009177 Bacteria 2737
125 Ga0105249_10064767 3300009553 Bacteria 3361
126 Ga0157378_10160344 3300013297 Bacteria 2103
127 Ga0157375_10186034 3300013308 Bacteria 2230
128 Ga0163161_10072748 3300017792 Bacteria 2517
129 Ga0207684_10028283 3300025910 Bacteria 4776
130 Ga0207684_10034024 3300025910 Bacteria 4333
131 Ga0207684_10035055 3300025910 Bacteria 4261
132 Ga0207684_10158130 3300025910 Bacteria 1951
133 Ga0207684_10183042 3300025910 Bacteria 1807
134 Ga0207654_10290022 3300025911 Bacteria 1109
135 Ga0207707_10058387 3300025912 Bacteria 3358
136 Ga0207693_10183683 3300025915 Bacteria 1646
137 Ga0207660_10014776 3300025917 Bacteria 5145
138 Ga0207646_10022647 3300025922 Bacteria 5785
139 Ga0207646_10074679 3300025922 Bacteria 3028
140 Ga0207646_10394214 3300025922 Bacteria 1251
141 Ga0207681_10011128 3300025923 Bacteria 5526
142 Ga0207681_10133563 3300025923 Bacteria 1838
143 Ga0207706_10017905 3300025933 Bacteria 6376
144 Ga0207706_10115794 3300025933 Bacteria 2357
145 Ga0207709_10067218 3300025935 Bacteria 2261
146 Ga0207704_10415755 3300025938 Bacteria 1065
147 Ga0207691_10054687 3300025940 Bacteria 3641
148 Ga0207689_10164726 3300025942 Bacteria 1827
149 Ga0207689_10233626 3300025942 Bacteria 1520
150 Ga0207668_10211572 3300025972 Bacteria 1551
151 Ga0207668_10211621 3300025972 Bacteria 1551
152 Ga0207708_10013513 3300026075 Bacteria 6105
153 Ga0207641_10299186 3300026088 Bacteria 1519
154 Ga0207641_10592624 3300026088 Bacteria 1084
155 Ga0207674_10017323 3300026116 Bacteria 7860
156 Ga0207675_100205684 3300026118 Bacteria 1892
157 Ga0207675_100210125 3300026118 Bacteria 1871
158 Ga0207428_10001338 3300027907 Bacteria 26213
159 Ga0207428_10038926 3300027907 Bacteria 3862
160 Ga0207428_10059792 3300027907 Bacteria 3020
161 Ga0207428_10260047 3300027907 Bacteria 1293
162 Ga0268265_10665235 3300028380 Bacteria 1002
163 Ga0268265_10674863 3300028380 Archaea 996
164 Ga0268264_10132395 3300028381 Bacteria 2212
165 Ga0268264_10505594 3300028381 Bacteria 1179
166 Ga0265338_10026775 3300028800 Bacteria 5804
167 Ga0265339_10007634 3300031249 Bacteria 6965
168 Ga0307408_100247576 3300031548 Bacteria 1468
169 Ga0307412_10153879 3300031911 Bacteria 1700
170 Ga0307409_100053705 3300031995 Bacteria 3098
171 Ga0307416_100032050 3300032002 Bacteria 3966
172 Ga0307416_100131079 3300032002 Bacteria 2257
173 Ga0307414_10301024 3300032004 Bacteria 1357
174 Ga0307411_10036442 3300032005 Bacteria 3082
175 Ga0373931_0059463 3300035691 Bacteria 2055
176 Ga0395899_0026155 3300037312 Bacteria 4404
177 Ga0395898_0048561 3300037466 Bacteria 4161
178 Ga0395905_0284928 3300037471 Bacteria 1539
179 Ga0395901_0006112 3300038443 Bacteria 12201
180 Ga0395901_0020327 3300038443 Bacteria 6797
181 Ga0400489_08393 3300039093 Unclassified 1094
182 Ga0451577_0003639 3300042876 Bacteria 16933
183 Ga0453683_0021589 3300044673 Bacteria 4110
184 Ga0453684_0011340 3300044712 Bacteria 14980
185 Ga0451576_0014533 3300045051 Bacteria 8755
186 Ga0451576_0055952 3300045051 Bacteria 4127
187 Ga0495642_0062636 3300046528 Bacteria 1545
188 Ga0495669_0006603 3300046684 Bacteria 4851
189 Ga0496102_0016300 3300048905 Bacteria 6491
190 Ga0496109_0277318 3300048912 Bacteria 1580
191 Ga0501031_0066465 3300049568 Bacteria 2349
192 Ga0501036_0026829 3300049572 Bacteria 4867
193 Ga0501037_0200060 3300049573 Bacteria 1412
194 Ga0501039_0304377 3300049575 Bacteria 1253
195 Ga0501040_0028470 3300049576 Bacteria 3767
196 Ga0501040_0096958 3300049576 Bacteria 2054
197 Ga0501042_0040856 3300049578 Bacteria 3297
198 Ga0501042_0351333 3300049578 Bacteria 1066
199 Ga0501043_0399582 3300049579 Bacteria 1039
200 Ga0501046_0053121 3300049580 Bacteria 3192
201 Ga0501068_0037375 3300049584 Bacteria 2907
202 Ga0501068_0105053 3300049584 Bacteria 1753
203 Ga0501068_0266557 3300049584 Bacteria 1093
204 Ga0501071_0118025 3300049587 Bacteria 1965
205 Ga0501071_0491639 3300049587 Bacteria 941
206 Ga0501072_0012559 3300049588 Bacteria 6476
207 Ga0501072_0021606 3300049588 Bacteria 4990
208 Ga0501072_0255270 3300049588 Bacteria 1396
209 Ga0501073_0245340 3300049589 Bacteria 1237
210 Ga0501074_0078254 3300049590 Bacteria 2373
211 Ga0501075_0055473 3300049591 Bacteria 2981
212 Ga0501075_0158351 3300049591 Bacteria 1727
213 Ga0501075_0255620 3300049591 Bacteria 1335
214 Ga0501076_0003820 3300049592 Bacteria 10608
215 Ga0501076_0012261 3300049592 Bacteria 6410
216 Ga0501076_0020302 3300049592 Bacteria 5085
217 Ga0501076_0237031 3300049592 Bacteria 1492
218 Ga0501077_0005369 3300049593 Bacteria 7794
219 Ga0501077_0041722 3300049593 Bacteria 2920
220 Ga0501077_0271800 3300049593 Bacteria 1078
221 Ga0501079_0115375 3300049741 Bacteria 2087
222 Ga0501079_0268577 3300049741 Bacteria 1333
223 Ga0501079_0272082 3300049741 Bacteria 1324
224 Ga0501080_0372155 3300049742 Bacteria 1288
225 Ga0501081_0004632 3300049743 Bacteria 8835
226 Ga0501081_0006108 3300049743 Bacteria 7808
227 Ga0501081_0024485 3300049743 Bacteria 4053
228 Ga0501081_0050145 3300049743 Bacteria 2876
229 Ga0501081_0090821 3300049743 Bacteria 2147
230 Ga0501081_0096727 3300049743 Bacteria 2083
231 Ga0501035_0075378 3300049822 Bacteria 2984
232 nmdc:mga05p37_11152_c1 3300050507 Bacteria 10680
233 nmdc:mga05p37_123200_c1 3300050507 Bacteria 3184
234 nmdc:mga05p37_148330_c1 3300050507 Bacteria 2871
235 nmdc:mga05p37_15238_c1 3300050507 Bacteria 9234
236 nmdc:mga05p37_1615_c2 3300050507 Bacteria 9502
237 nmdc:mga05p37_1641_c1 3300050507 Bacteria 25943
238 nmdc:mga05p37_22784_c1 3300050507 Bacteria 7596
239 nmdc:mga05p37_502_c1 3300050507 Bacteria 43047
240 nmdc:mga05p37_9585_c1 3300050507 Bacteria 11470
241 nmdc:mga09592_270296_c1 3300050508 Bacteria 1474
242 nmdc:mga09592_41349_c1 3300050508 Bacteria 3876
243 nmdc:mga09592_4278_c1 3300050508 Bacteria 11534
244 nmdc:mga09592_47271_c1 3300050508 Bacteria 3627
245 nmdc:mga09592_53538_c1 3300050508 Bacteria 3408
246 nmdc:mga09592_6732_c1 3300050508 Bacteria 9349
247 nmdc:mga09592_821_c1 3300050508 Bacteria 24038
248 nmdc:mga09592_8741_c1 3300050508 Bacteria 8242
249 nmdc:mga0qj67_208820_c1 3300050509 Bacteria 1586
250 nmdc:mga0qj67_392557_c1 3300050509 Bacteria 1120
251 nmdc:mga0qj67_4456_c1 3300050509 Bacteria 10146
252 nmdc:mga0qj67_632_c1 3300050509 Bacteria 24182
253 nmdc:mga0qj67_68781_c1 3300050509 Bacteria 2823
254 nmdc:mga06r32_105737_c1 3300050510 Bacteria 2765
255 nmdc:mga06r32_11580_c1 3300050510 Bacteria 7943
256 nmdc:mga06r32_1465_c1 3300050510 Bacteria 21248
257 nmdc:mga06r32_1523_c1 3300050510 Bacteria 20829
258 nmdc:mga06r32_241961_c1 3300050510 Bacteria 1792
259 nmdc:mga06r32_3673_c1 3300050510 Bacteria 13707
260 nmdc:mga06r32_4293_c1 3300050510 Bacteria 12768
261 nmdc:mga06r32_696986_c1 3300050510 Bacteria 981
262 nmdc:mga06r32_751978_c1 3300050510 Bacteria 938
263 nmdc:mga06r32_7912_c1 3300050510 Bacteria 9557
264 nmdc:mga06r32_82618_c1 3300050510 Bacteria 3129
265 nmdc:mga06r32_9359_c1 3300050510 Bacteria 8835
266 nmdc:mga08y16_12432_c1 3300050511 Bacteria 8958
267 nmdc:mga08y16_156924_c1 3300050511 Bacteria 2365
268 nmdc:mga08y16_168318_c1 3300050511 Bacteria 2277
269 nmdc:mga08y16_194267_c1 3300050511 Bacteria 2104
270 nmdc:mga08y16_3120_c1 3300050511 Bacteria 17157
271 nmdc:mga08y16_95351_c1 3300050511 Bacteria 3099
272 nmdc:mga0n895_10199_c1 3300050512 Bacteria 8277
273 nmdc:mga0n895_12544_c1 3300050512 Bacteria 7603
274 nmdc:mga0n895_19713_c1 3300050512 Bacteria 6272
275 nmdc:mga0n895_209245_c1 3300050512 Bacteria 1981
276 nmdc:mga0n895_26123_c1 3300050512 Bacteria 5525
277 nmdc:mga0n895_273789_c1 3300050512 Bacteria 1712
278 nmdc:mga0n895_324012_c1 3300050512 Bacteria 1561
279 nmdc:mga0n895_559360_c1 3300050512 Bacteria 1149
280 nmdc:mga0n895_715188_c1 3300050512 Bacteria 997
281 nmdc:mga0rr50_10006_c1 3300050513 Bacteria 5997
282 nmdc:mga0rr50_148814_c1 3300050513 Bacteria 1890
283 nmdc:mga0rr50_160645_c1 3300050513 Bacteria 1823
284 nmdc:mga0rr50_16354_c1 3300050513 Bacteria 4925
285 nmdc:mga0rr50_19176_c1 3300050513 Bacteria 4610
286 nmdc:mga08x19_169789_c1 3300050514 Bacteria 1485
287 nmdc:mga08x19_38348_c1 3300050514 Bacteria 3044
288 nmdc:mga0a205_17511_c2 3300050515 Bacteria 3701
289 nmdc:mga0a205_429_c1 3300050515 Bacteria 29130
290 nmdc:mga0a205_49246_c1 3300050515 Bacteria 4066
291 nmdc:mga0a205_58891_c1 3300050515 Bacteria 3710
292 nmdc:mga0a205_59712_c1 3300050515 Bacteria 1823
293 nmdc:mga0a205_6386_c1 3300050515 Bacteria 10649
294 Ga0501084_0006176 3300054114 Bacteria 9852
295 Ga0501084_0008426 3300054114 Bacteria 8518
296 Ga0501084_0077992 3300054114 Bacteria 2777
297 Ga0501084_0101299 3300054114 Bacteria 2419
298 Ga0501084_0331640 3300054114 Bacteria 1285
299 Ga0590075_022045 3300059424 Bacteria 1592
300 Ga0501082_0026352 3300060353 Bacteria 5009
301 Ga0501082_0028132 3300060353 Bacteria 4844
302 Ga0530510_0031197 3300061734 Bacteria 3832
303 Ga0530510_0051066 3300061734 Bacteria 2987

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025942 Ga0207689_10164726 Ga0207689_101647262 247
2 3300032002 Ga0307416_100131079 Ga0307416_1001310792 247
3 3300005353 Ga0070669_100054287 Ga0070669_1000542873 248
4 3300025923 Ga0207681_10133563 Ga0207681_101335632 248
5 3300005334 Ga0068869_100019029 Ga0068869_1000190292 249
6 3300005457 Ga0070662_100028778 Ga0070662_1000287783 251
7 3300005844 Ga0068862_100688349 Ga0068862_1006883492 251
8 3300006844 Ga0075428_100221130 Ga0075428_1002211302 251
9 3300006852 Ga0075433_10074851 Ga0075433_100748512 251
10 3300009094 Ga0111539_10053305 Ga0111539_100533056 251
11 3300009147 Ga0114129_10406013 Ga0114129_104060132 251
12 3300025933 Ga0207706_10017905 Ga0207706_100179053 251
13 3300027907 Ga0207428_10001338 Ga0207428_100013386 251
14 3300028380 Ga0268265_10665235 Ga0268265_106652352 251
15 3300042876 Ga0451577_0003639 Ga0451577_0003639_3380_4213 251
16 3300044712 Ga0453684_0011340 Ga0453684_0011340_12345_13178 251
17 3300045051 Ga0451576_0014533 Ga0451576_0014533_4317_5150 251
18 3300049584 Ga0501068_0266557 Ga0501068_0266557_175_987 251
19 3300049591 Ga0501075_0158351 Ga0501075_0158351_554_1366 251
20 3300049743 Ga0501081_0096727 Ga0501081_0096727_170_982 251
21 3300050511 nmdc:mga08y16_12432_c1 nmdc:mga08y16_12432_c1_4700_5533 251
22 3300050515 nmdc:mga0a205_429_c1 nmdc:mga0a205_429_c1_26932_27765 251
23 3300054114 Ga0501084_0331640 Ga0501084_0331640_362_1174 251
24 3300006852 Ga0075433_10017646 Ga0075433_100176465 252
25 3300007076 Ga0075435_100048838 Ga0075435_1000488382 252
26 3300009094 Ga0111539_10057968 Ga0111539_100579683 252
27 3300027907 Ga0207428_10059792 Ga0207428_100597922 252
28 3300028800 Ga0265338_10026775 Ga0265338_100267755 252
29 3300031249 Ga0265339_10007634 Ga0265339_100076346 252
30 3300049588 Ga0501072_0255270 Ga0501072_0255270_472_1278 252
31 3300049743 Ga0501081_0024485 Ga0501081_0024485_2162_2968 252
32 3300050507 nmdc:mga05p37_123200_c1 nmdc:mga05p37_123200_c1_1682_2518 252
33 3300050511 nmdc:mga08y16_95351_c1 nmdc:mga08y16_95351_c1_511_1347 252
34 3300050513 nmdc:mga0rr50_10006_c1 nmdc:mga0rr50_10006_c1_5022_5858 252
35 3300050515 nmdc:mga0a205_6386_c1 nmdc:mga0a205_6386_c1_4412_5248 252
36 3300006871 Ga0075434_100022093 Ga0075434_1000220932 253
37 3300039093 Ga0400489_08393 Ga0400489_08393_107_919 253
38 3300050512 nmdc:mga0n895_12544_c1 nmdc:mga0n895_12544_c1_5520_6359 253
39 3300005468 Ga0070707_100231193 Ga0070707_1002311932 254
40 3300025922 Ga0207646_10074679 Ga0207646_100746791 254
41 3300005546 Ga0070696_100236835 Ga0070696_1002368352 256
42 3300050512 nmdc:mga0n895_559360_c1 nmdc:mga0n895_559360_c1_326_1135 257
43 3300005937 Ga0081455_10077366 Ga0081455_100773663 258
44 3300049575 Ga0501039_0304377 Ga0501039_0304377_282_1115 258
45 3300049592 Ga0501076_0012261 Ga0501076_0012261_5461_6246 258
46 3300049593 Ga0501077_0271800 Ga0501077_0271800_170_1003 258
47 3300049741 Ga0501079_0115375 Ga0501079_0115375_77_862 258
48 3300049743 Ga0501081_0006108 Ga0501081_0006108_2273_3058 258
49 3300054114 Ga0501084_0101299 Ga0501084_0101299_286_1071 258
50 3300060353 Ga0501082_0026352 Ga0501082_0026352_1366_2151 258
51 3300061734 Ga0530510_0031197 Ga0530510_0031197_1536_2321 258
52 3300037466 Ga0395898_0048561 Ga0395898_0048561_3313_4119 262
53 3300049587 Ga0501071_0491639 Ga0501071_0491639_45_854 262
54 3300054114 Ga0501084_0077992 Ga0501084_0077992_300_1109 262
55 3300005545 Ga0070695_100013918 Ga0070695_1000139183 263
56 3300006844 Ga0075428_100092280 Ga0075428_1000922804 263
57 3300006844 Ga0075428_100734386 Ga0075428_1007343862 263
58 3300006847 Ga0075431_100020474 Ga0075431_1000204742 263
59 3300006852 Ga0075433_10477786 Ga0075433_104777861 263
60 3300006880 Ga0075429_100009023 Ga0075429_1000090233 263
61 3300009147 Ga0114129_10009518 Ga0114129_100095189 263
62 3300049568 Ga0501031_0066465 Ga0501031_0066465_313_1167 263
63 3300049573 Ga0501037_0200060 Ga0501037_0200060_433_1287 263
64 3300049576 Ga0501040_0096958 Ga0501040_0096958_1042_1896 263
65 3300050507 nmdc:mga05p37_22784_c1 nmdc:mga05p37_22784_c1_4489_5295 263
66 3300050508 nmdc:mga09592_41349_c1 nmdc:mga09592_41349_c1_1874_2680 263
67 3300050511 nmdc:mga08y16_194267_c1 nmdc:mga08y16_194267_c1_609_1466 263
68 3300050515 nmdc:mga0a205_58891_c1 nmdc:mga0a205_58891_c1_950_1756 263
69 3300005439 Ga0070711_100190137 Ga0070711_1001901372 264
70 3300005445 Ga0070708_100016671 Ga0070708_1000166714 264
71 3300005445 Ga0070708_100039454 Ga0070708_1000394543 264
72 3300005445 Ga0070708_100110200 Ga0070708_1001102003 264
73 3300005518 Ga0070699_100010889 Ga0070699_1000108892 264
74 3300005549 Ga0070704_100077658 Ga0070704_1000776581 264
75 3300005841 Ga0068863_100144025 Ga0068863_1001440253 264
76 3300005844 Ga0068862_100490716 Ga0068862_1004907161 264
77 3300006175 Ga0070712_100014746 Ga0070712_1000147464 264
78 3300006871 Ga0075434_100154214 Ga0075434_1001542143 264
79 3300007076 Ga0075435_100005962 Ga0075435_1000059622 264
80 3300009148 Ga0105243_10536921 Ga0105243_105369211 264
81 3300009177 Ga0105248_10139276 Ga0105248_101392762 264
82 3300025910 Ga0207684_10034024 Ga0207684_100340242 264
83 3300025915 Ga0207693_10183683 Ga0207693_101836831 264
84 3300025922 Ga0207646_10394214 Ga0207646_103942141 264
85 3300026088 Ga0207641_10592624 Ga0207641_105926241 264
86 3300028380 Ga0268265_10674863 Ga0268265_106748632 264
87 3300028381 Ga0268264_10132395 Ga0268264_101323952 264
88 3300050512 nmdc:mga0n895_209245_c1 nmdc:mga0n895_209245_c1_428_1237 264
89 3300050512 nmdc:mga0n895_273789_c1 nmdc:mga0n895_273789_c1_230_1039 264
90 3300050513 nmdc:mga0rr50_160645_c1 nmdc:mga0rr50_160645_c1_64_873 264
91 3300050513 nmdc:mga0rr50_16354_c1 nmdc:mga0rr50_16354_c1_132_941 264
92 3300050514 nmdc:mga08x19_38348_c1 nmdc:mga08x19_38348_c1_2125_2934 264
93 3300005467 Ga0070706_100208975 Ga0070706_1002089752 265
94 3300006844 Ga0075428_100089807 Ga0075428_1000898074 265
95 3300006871 Ga0075434_100388222 Ga0075434_1003882222 265
96 3300006880 Ga0075429_100027559 Ga0075429_1000275595 265
97 3300007076 Ga0075435_100204889 Ga0075435_1002048891 265
98 3300009094 Ga0111539_10084832 Ga0111539_100848323 265
99 3300009147 Ga0114129_10096788 Ga0114129_100967881 265
100 3300009147 Ga0114129_10257139 Ga0114129_102571392 265
101 3300025910 Ga0207684_10158130 Ga0207684_101581301 265
102 3300025922 Ga0207646_10022647 Ga0207646_100226473 265
103 3300025972 Ga0207668_10211621 Ga0207668_102116212 265
104 3300027907 Ga0207428_10260047 Ga0207428_102600472 265
105 3300044673 Ga0453683_0021589 Ga0453683_0021589_3266_4093 265
106 3300045051 Ga0451576_0055952 Ga0451576_0055952_3037_3870 265
107 3300050507 nmdc:mga05p37_148330_c1 nmdc:mga05p37_148330_c1_42_845 265
108 3300050508 nmdc:mga09592_47271_c1 nmdc:mga09592_47271_c1_222_1025 265
109 3300050510 nmdc:mga06r32_696986_c1 nmdc:mga06r32_696986_c1_133_936 265
110 3300050511 nmdc:mga08y16_156924_c1 nmdc:mga08y16_156924_c1_1543_2346 265
111 3300050512 nmdc:mga0n895_715188_c1 nmdc:mga0n895_715188_c1_34_861 265
112 3300050513 nmdc:mga0rr50_148814_c1 nmdc:mga0rr50_148814_c1_491_1318 265
113 3300006847 Ga0075431_100047115 Ga0075431_1000471153 266
114 3300006852 Ga0075433_10183362 Ga0075433_101833622 266
115 3300006880 Ga0075429_100313491 Ga0075429_1003134912 266
116 3300009094 Ga0111539_10220851 Ga0111539_102208512 266
117 3300050510 nmdc:mga06r32_105737_c1 nmdc:mga06r32_105737_c1_1449_2291 266
118 3300050515 nmdc:mga0a205_17511_c2 nmdc:mga0a205_17511_c2_935_1777 266
119 3300005336 Ga0070680_100020727 Ga0070680_1000207274 267
120 3300005336 Ga0070680_100131465 Ga0070680_1001314652 267
121 3300005341 Ga0070691_10012049 Ga0070691_100120492 267
122 3300005406 Ga0070703_10002042 Ga0070703_100020424 267
123 3300005438 Ga0070701_10006508 Ga0070701_100065085 267
124 3300005440 Ga0070705_100034604 Ga0070705_1000346043 267
125 3300005440 Ga0070705_100082717 Ga0070705_1000827172 267
126 3300005440 Ga0070705_100261743 Ga0070705_1002617432 267
127 3300005444 Ga0070694_100032921 Ga0070694_1000329212 267
128 3300005444 Ga0070694_100321715 Ga0070694_1003217151 267
129 3300005458 Ga0070681_10061145 Ga0070681_100611454 267
130 3300005518 Ga0070699_100180003 Ga0070699_1001800032 267
131 3300005545 Ga0070695_100003851 Ga0070695_1000038513 267
132 3300005546 Ga0070696_100018116 Ga0070696_1000181164 267
133 3300005546 Ga0070696_100031948 Ga0070696_1000319482 267
134 3300005549 Ga0070704_100080231 Ga0070704_1000802312 267
135 3300005577 Ga0068857_100037652 Ga0068857_1000376522 267
136 3300005617 Ga0068859_100085162 Ga0068859_1000851623 267
137 3300005617 Ga0068859_100755968 Ga0068859_1007559682 267
138 3300006844 Ga0075428_100000277 Ga0075428_1000002778 267
139 3300006846 Ga0075430_100006731 Ga0075430_1000067318 267
140 3300006846 Ga0075430_100158992 Ga0075430_1001589922 267
141 3300006847 Ga0075431_100001294 Ga0075431_10000129420 267
142 3300006847 Ga0075431_100001572 Ga0075431_10000157212 267
143 3300006871 Ga0075434_100181677 Ga0075434_1001816773 267
144 3300006880 Ga0075429_100000097 Ga0075429_1000000974 267
145 3300006931 Ga0097620_100085162 Ga0097620_1000851623 267
146 3300006931 Ga0097620_100755907 Ga0097620_1007559072 267
147 3300007076 Ga0075435_100019180 Ga0075435_1000191804 267
148 3300009094 Ga0111539_10126141 Ga0111539_101261412 267
149 3300009147 Ga0114129_10002048 Ga0114129_100020488 267
150 3300009147 Ga0114129_10786672 Ga0114129_107866722 267
151 3300009148 Ga0105243_10035334 Ga0105243_100353342 267
152 3300009148 Ga0105243_10509958 Ga0105243_105099582 267
153 3300009553 Ga0105249_10064767 Ga0105249_100647672 267
154 3300013297 Ga0157378_10160344 Ga0157378_101603442 267
155 3300025912 Ga0207707_10058387 Ga0207707_100583874 267
156 3300025917 Ga0207660_10014776 Ga0207660_100147764 267
157 3300025938 Ga0207704_10415755 Ga0207704_104157552 267
158 3300025942 Ga0207689_10233626 Ga0207689_102336261 267
159 3300026075 Ga0207708_10013513 Ga0207708_100135134 267
160 3300026116 Ga0207674_10017323 Ga0207674_100173236 267
161 3300026118 Ga0207675_100210125 Ga0207675_1002101252 267
162 3300035691 Ga0373931_0059463 Ga0373931_0059463_892_1710 267
163 3300037312 Ga0395899_0026155 Ga0395899_0026155_3232_4122 267
164 3300038443 Ga0395901_0006112 Ga0395901_0006112_5399_6289 267
165 3300046528 Ga0495642_0062636 Ga0495642_0062636_517_1344 267
166 3300048905 Ga0496102_0016300 Ga0496102_0016300_2282_3100 267
167 3300048912 Ga0496109_0277318 Ga0496109_0277318_498_1328 267
168 3300049591 Ga0501075_0255620 Ga0501075_0255620_437_1264 267
169 3300049743 Ga0501081_0050145 Ga0501081_0050145_479_1306 267
170 3300050507 nmdc:mga05p37_1641_c1 nmdc:mga05p37_1641_c1_13229_14116 267
171 3300050508 nmdc:mga09592_270296_c1 nmdc:mga09592_270296_c1_379_1269 267
172 3300050508 nmdc:mga09592_821_c1 nmdc:mga09592_821_c1_15443_16330 267
173 3300050509 nmdc:mga0qj67_208820_c1 nmdc:mga0qj67_208820_c1_346_1188 267
174 3300050509 nmdc:mga0qj67_632_c1 nmdc:mga0qj67_632_c1_7929_8816 267
175 3300050510 nmdc:mga06r32_11580_c1 nmdc:mga06r32_11580_c1_5794_6636 267
176 3300050510 nmdc:mga06r32_1523_c1 nmdc:mga06r32_1523_c1_9149_10036 267
177 3300050510 nmdc:mga06r32_82618_c1 nmdc:mga06r32_82618_c1_731_1564 267
178 3300050511 nmdc:mga08y16_168318_c1 nmdc:mga08y16_168318_c1_83_904 267
179 3300050512 nmdc:mga0n895_19713_c1 nmdc:mga0n895_19713_c1_4137_4958 267
180 3300050513 nmdc:mga0rr50_19176_c1 nmdc:mga0rr50_19176_c1_1611_2432 267
181 3300050515 nmdc:mga0a205_49246_c1 nmdc:mga0a205_49246_c1_2390_3211 267
182 3300003203 JGI25406J46586_10007134 JGI25406J46586_100071343 268
183 3300005340 Ga0070689_100363194 Ga0070689_1003631942 268
184 3300005347 Ga0070668_100146591 Ga0070668_1001465912 268
185 3300005353 Ga0070669_100000928 Ga0070669_1000009288 268
186 3300005467 Ga0070706_100627158 Ga0070706_1006271581 268
187 3300005467 Ga0070706_100627161 Ga0070706_1006271611 268
188 3300005468 Ga0070707_100086664 Ga0070707_1000866644 268
189 3300005518 Ga0070699_100129688 Ga0070699_1001296882 268
190 3300005518 Ga0070699_100255151 Ga0070699_1002551512 268
191 3300005536 Ga0070697_100056293 Ga0070697_1000562932 268
192 3300005543 Ga0070672_100046327 Ga0070672_1000463272 268
193 3300005546 Ga0070696_100069486 Ga0070696_1000694862 268
194 3300005841 Ga0068863_100341091 Ga0068863_1003410912 268
195 3300005843 Ga0068860_100617967 Ga0068860_1006179672 268
196 3300005985 Ga0081539_10000920 Ga0081539_1000092031 268
197 3300006844 Ga0075428_100004521 Ga0075428_10000452116 268
198 3300006844 Ga0075428_100007434 Ga0075428_1000074342 268
199 3300006844 Ga0075428_100014308 Ga0075428_1000143087 268
200 3300006846 Ga0075430_100044005 Ga0075430_1000440054 268
201 3300006846 Ga0075430_100046028 Ga0075430_1000460283 268
202 3300006846 Ga0075430_100079631 Ga0075430_1000796312 268
203 3300006846 Ga0075430_100233806 Ga0075430_1002338062 268
204 3300006847 Ga0075431_100000902 Ga0075431_1000009027 268
205 3300006847 Ga0075431_100001042 Ga0075431_1000010422 268
206 3300006847 Ga0075431_100003209 Ga0075431_10000320911 268
207 3300006847 Ga0075431_100019588 Ga0075431_1000195885 268
208 3300006847 Ga0075431_100032999 Ga0075431_1000329994 268
209 3300006847 Ga0075431_100049784 Ga0075431_1000497841 268
210 3300006852 Ga0075433_10208736 Ga0075433_102087362 268
211 3300006871 Ga0075434_100027371 Ga0075434_1000273714 268
212 3300006871 Ga0075434_100063008 Ga0075434_1000630082 268
213 3300006880 Ga0075429_100013171 Ga0075429_1000131712 268
214 3300006880 Ga0075429_100014740 Ga0075429_1000147401 268
215 3300006880 Ga0075429_100032633 Ga0075429_1000326332 268
216 3300006880 Ga0075429_100061413 Ga0075429_1000614132 268
217 3300006914 Ga0075436_100186772 Ga0075436_1001867721 268
218 3300009094 Ga0111539_10049300 Ga0111539_100493004 268
219 3300009147 Ga0114129_10000315 Ga0114129_1000031553 268
220 3300009147 Ga0114129_10002668 Ga0114129_1000266823 268
221 3300009147 Ga0114129_10013755 Ga0114129_1001375510 268
222 3300009147 Ga0114129_10022823 Ga0114129_100228233 268
223 3300009147 Ga0114129_10563117 Ga0114129_105631172 268
224 3300009148 Ga0105243_10018065 Ga0105243_100180652 268
225 3300013308 Ga0157375_10186034 Ga0157375_101860342 268
226 3300017792 Ga0163161_10072748 Ga0163161_100727481 268
227 3300025910 Ga0207684_10028283 Ga0207684_100282834 268
228 3300025910 Ga0207684_10035055 Ga0207684_100350554 268
229 3300025910 Ga0207684_10183042 Ga0207684_101830422 268
230 3300025911 Ga0207654_10290022 Ga0207654_102900221 268
231 3300025923 Ga0207681_10011128 Ga0207681_100111284 268
232 3300025933 Ga0207706_10115794 Ga0207706_101157942 268
233 3300025935 Ga0207709_10067218 Ga0207709_100672181 268
234 3300025940 Ga0207691_10054687 Ga0207691_100546873 268
235 3300025972 Ga0207668_10211572 Ga0207668_102115721 268
236 3300026088 Ga0207641_10299186 Ga0207641_102991862 268
237 3300026118 Ga0207675_100205684 Ga0207675_1002056842 268
238 3300027907 Ga0207428_10038926 Ga0207428_100389262 268
239 3300028381 Ga0268264_10505594 Ga0268264_105055942 268
240 3300031548 Ga0307408_100247576 Ga0307408_1002475762 268
241 3300031911 Ga0307412_10153879 Ga0307412_101538792 268
242 3300031995 Ga0307409_100053705 Ga0307409_1000537052 268
243 3300032002 Ga0307416_100032050 Ga0307416_1000320502 268
244 3300032004 Ga0307414_10301024 Ga0307414_103010242 268
245 3300032005 Ga0307411_10036442 Ga0307411_100364423 268
246 3300037471 Ga0395905_0284928 Ga0395905_0284928_687_1523 268
247 3300038443 Ga0395901_0020327 Ga0395901_0020327_3096_3932 268
248 3300046684 Ga0495669_0006603 Ga0495669_0006603_537_1367 268
249 3300049572 Ga0501036_0026829 Ga0501036_0026829_1974_2786 268
250 3300049576 Ga0501040_0028470 Ga0501040_0028470_686_1498 268
251 3300049578 Ga0501042_0040856 Ga0501042_0040856_1730_2542 268
252 3300049578 Ga0501042_0351333 Ga0501042_0351333_139_1014 268
253 3300049579 Ga0501043_0399582 Ga0501043_0399582_112_924 268
254 3300049580 Ga0501046_0053121 Ga0501046_0053121_777_1589 268
255 3300049584 Ga0501068_0037375 Ga0501068_0037375_1680_2492 268
256 3300049584 Ga0501068_0105053 Ga0501068_0105053_498_1310 268
257 3300049587 Ga0501071_0118025 Ga0501071_0118025_1091_1903 268
258 3300049588 Ga0501072_0012559 Ga0501072_0012559_1605_2417 268
259 3300049588 Ga0501072_0021606 Ga0501072_0021606_1113_1925 268
260 3300049589 Ga0501073_0245340 Ga0501073_0245340_390_1202 268
261 3300049590 Ga0501074_0078254 Ga0501074_0078254_1410_2222 268
262 3300049591 Ga0501075_0055473 Ga0501075_0055473_876_1688 268
263 3300049592 Ga0501076_0003820 Ga0501076_0003820_4573_5385 268
264 3300049592 Ga0501076_0020302 Ga0501076_0020302_1702_2538 268
265 3300049592 Ga0501076_0237031 Ga0501076_0237031_451_1263 268
266 3300049593 Ga0501077_0005369 Ga0501077_0005369_6447_7259 268
267 3300049593 Ga0501077_0041722 Ga0501077_0041722_1703_2515 268
268 3300049741 Ga0501079_0268577 Ga0501079_0268577_411_1223 268
269 3300049741 Ga0501079_0272082 Ga0501079_0272082_220_1056 268
270 3300049742 Ga0501080_0372155 Ga0501080_0372155_175_987 268
271 3300049743 Ga0501081_0004632 Ga0501081_0004632_2783_3595 268
272 3300049743 Ga0501081_0090821 Ga0501081_0090821_1174_1986 268
273 3300049822 Ga0501035_0075378 Ga0501035_0075378_285_1097 268
274 3300050507 nmdc:mga05p37_11152_c1 nmdc:mga05p37_11152_c1_5874_6710 268
275 3300050507 nmdc:mga05p37_15238_c1 nmdc:mga05p37_15238_c1_2779_3591 268
276 3300050507 nmdc:mga05p37_1615_c2 nmdc:mga05p37_1615_c2_5896_6741 268
277 3300050507 nmdc:mga05p37_502_c1 nmdc:mga05p37_502_c1_348_1154 268
278 3300050507 nmdc:mga05p37_9585_c1 nmdc:mga05p37_9585_c1_9922_10728 268
279 3300050508 nmdc:mga09592_4278_c1 nmdc:mga09592_4278_c1_2187_2999 268
280 3300050508 nmdc:mga09592_53538_c1 nmdc:mga09592_53538_c1_671_1483 268
281 3300050508 nmdc:mga09592_6732_c1 nmdc:mga09592_6732_c1_4784_5590 268
282 3300050508 nmdc:mga09592_8741_c1 nmdc:mga09592_8741_c1_4864_5700 268
283 3300050509 nmdc:mga0qj67_392557_c1 nmdc:mga0qj67_392557_c1_67_891 268
284 3300050509 nmdc:mga0qj67_4456_c1 nmdc:mga0qj67_4456_c1_7167_8012 268
285 3300050509 nmdc:mga0qj67_68781_c1 nmdc:mga0qj67_68781_c1_555_1367 268
286 3300050510 nmdc:mga06r32_1465_c1 nmdc:mga06r32_1465_c1_6715_7521 268
287 3300050510 nmdc:mga06r32_241961_c1 nmdc:mga06r32_241961_c1_702_1508 268
288 3300050510 nmdc:mga06r32_3673_c1 nmdc:mga06r32_3673_c1_9721_10533 268
289 3300050510 nmdc:mga06r32_4293_c1 nmdc:mga06r32_4293_c1_1216_2022 268
290 3300050510 nmdc:mga06r32_751978_c1 nmdc:mga06r32_751978_c1_107_919 268
291 3300050510 nmdc:mga06r32_7912_c1 nmdc:mga06r32_7912_c1_3912_4724 268
292 3300050510 nmdc:mga06r32_9359_c1 nmdc:mga06r32_9359_c1_4173_5018 268
293 3300050511 nmdc:mga08y16_3120_c1 nmdc:mga08y16_3120_c1_11885_12715 268
294 3300050512 nmdc:mga0n895_10199_c1 nmdc:mga0n895_10199_c1_4913_5746 268
295 3300050512 nmdc:mga0n895_26123_c1 nmdc:mga0n895_26123_c1_584_1390 268
296 3300050512 nmdc:mga0n895_324012_c1 nmdc:mga0n895_324012_c1_386_1198 268
297 3300050514 nmdc:mga08x19_169789_c1 nmdc:mga08x19_169789_c1_429_1253 268
298 3300050515 nmdc:mga0a205_59712_c1 nmdc:mga0a205_59712_c1_128_934 268
299 3300054114 Ga0501084_0006176 Ga0501084_0006176_1089_1901 268
300 3300054114 Ga0501084_0008426 Ga0501084_0008426_1481_2293 268
301 3300059424 Ga0590075_022045 Ga0590075_022045_691_1503 268
302 3300060353 Ga0501082_0028132 Ga0501082_0028132_1215_2027 268
303 3300061734 Ga0530510_0051066 Ga0530510_0051066_1998_2810 268

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

50

199

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nq2-assembly1.cif.gz_D an inward-facing conformation of a putative metal-chelate type abc transporter. 0.912 1 265
4hzi-assembly1.cif.gz_B crystal structure of the leptospira interrogans atpase subunit of an orphan abc transporter 0.9088 2 264
2ihy-assembly1.cif.gz_A structure of the staphylococcus aureus putative atpase subunit of an atp-binding cassette (abc) transporter 0.9063 2 264
2nq2-assembly1.cif.gz_C an inward-facing conformation of a putative metal-chelate type abc transporter. 0.905 2 266
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.9043 2 231
ID Description Score Start End Superfamily
af_Q57554_4_248_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9598 4 257 3.40.50.300
af_Q58283_1_248_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9503 5 248 3.40.50.300
af_Q57554_4_248_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9484 4 257 3.40.50.300
af_P23878_8_259_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9431 6 262 3.40.50.300
af_P23878_8_259_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.936 6 262 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2N2YX47-F1-model_v4 ABC transporter ATP-binding protein 0.9448 2 264 GO:0005524
GO:0016887
AF-E7QWZ5-F1-model_v4 ABC transporter related protein (Iron complex transport system ATP-binding protein) 0.9405 4 268 GO:0005524
GO:0016887
AF-A0A5P9BGF3-F1-model_v4 Iron(3+)-hydroxamate import ATP-binding protein FhuC 0.9395 55 250 GO:0005524
GO:0016887
AF-A0A2N2YX47-F1-model_v4 ABC transporter ATP-binding protein 0.9376 2 264 GO:0005524
GO:0016887
AF-E7QWZ5-F1-model_v4 ABC transporter related protein (Iron complex transport system ATP-binding protein) 0.9333 4 268 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
92.08 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map