F396901

General Info

Members Datasets Scaffolds Average Seq Length
303 185 606 169

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100625028|Ga0070698_1006250282
Length 193
Sequence MAVTRADKETELQMLEGVFKDADAAFLIDYKGINVPQVTELRAQLRKARAGYKVVKNTLAKRALKGTAYESFAPHFEGTTALAYTDDDAVVLAKTITTFLKSTPTLQIKIKAAVVQGQAIKPAQVADLANMPGRPELYGRLLGVMQAPMVNLVRVLSAVPRDLMSVLVQYERKRSEGADGATSAEGAASPQSA

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
103 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
108 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
111 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
112 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
113 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
116 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
117 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
118 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
119 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
120 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
121 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
122 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
123 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
124 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
125 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
126 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
127 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
128 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
129 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
130 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
131 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
132 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
133 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
134 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
135 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
136 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
137 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
138 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
145 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
153 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
154 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
155 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
156 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
157 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
158 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
159 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
160 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
161 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
162 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
163 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
164 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
165 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
166 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
167 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
168 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
169 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
170 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
171 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
172 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
173 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
174 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
175 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
176 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
177 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
178 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
179 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
180 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
181 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
182 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
183 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
185 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0.33
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.61
Nodule 0
Rhizoplane 2.97
Rhizosphere 90.76
Stem 0
Stem Tuber 0
Unclassified 11.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100625028 3300005471 Bacteria 1018
2 Ga0065712_10188815 3300005290 Bacteria 1147
3 Ga0070676_10825968 3300005328 Bacteria 685
4 Ga0070690_100161899 3300005330 Bacteria 1534
5 Ga0070690_100429243 3300005330 Bacteria 976
6 Ga0070670_100390883 3300005331 Bacteria 1226
7 Ga0070670_100473473 3300005331 Bacteria 1112
8 Ga0070677_10221275 3300005333 Unclassified 925
9 Ga0068869_100136188 3300005334 Bacteria 1892
10 Ga0068869_100158264 3300005334 Bacteria 1762
11 Ga0070666_10737076 3300005335 Unclassified 724
12 Ga0068868_100218523 3300005338 Bacteria 1595
13 Ga0070691_10021653 3300005341 Bacteria 2976
14 Ga0070687_100895340 3300005343 Unclassified 636
15 Ga0070669_100038635 3300005353 Bacteria 3466
16 Ga0070669_100414339 3300005353 Bacteria 1105
17 Ga0070669_100832604 3300005353 Bacteria 785
18 Ga0070671_100159531 3300005355 Bacteria 1906
19 Ga0070671_100647498 3300005355 Bacteria 915
20 Ga0070673_101389074 3300005364 Bacteria 661
21 Ga0070673_101784047 3300005364 Unclassified 583
22 Ga0070688_100278021 3300005365 Bacteria 1202
23 Ga0070667_100603154 3300005367 Bacteria 1012
24 Ga0070700_100266554 3300005441 Bacteria 1235
25 Ga0070694_100169871 3300005444 Bacteria 1605
26 Ga0070694_101007468 3300005444 Bacteria 692
27 Ga0070708_101046509 3300005445 Bacteria 765
28 Ga0070708_101107314 3300005445 Bacteria 742
29 Ga0070678_100363448 3300005456 Bacteria 1248
30 Ga0070678_100748798 3300005456 Bacteria 884
31 Ga0068867_100448430 3300005459 Bacteria 1099
32 Ga0070706_100796498 3300005467 Bacteria 875
33 Ga0070707_100453081 3300005468 Bacteria 1244
34 Ga0070698_100164546 3300005471 Bacteria 2161
35 Ga0070698_100810392 3300005471 Unclassified 880
36 Ga0070699_100101493 3300005518 Bacteria 2522
37 Ga0070699_100382059 3300005518 Bacteria 1272
38 Ga0070697_100260826 3300005536 Bacteria 1484
39 Ga0070672_100131380 3300005543 Bacteria 2058
40 Ga0070672_100276868 3300005543 Bacteria 1418
41 Ga0070672_100906842 3300005543 Unclassified 779
42 Ga0070695_100844181 3300005545 Bacteria 737
43 Ga0070665_100269441 3300005548 Bacteria 1704
44 Ga0070704_100648983 3300005549 Bacteria 932
45 Ga0068857_100526434 3300005577 Bacteria 1111
46 Ga0070702_100192661 3300005615 Bacteria 1343
47 Ga0068859_100281606 3300005617 Bacteria 1755
48 Ga0068859_100842985 3300005617 Bacteria 1003
49 Ga0068870_10069254 3300005840 Bacteria 1919
50 Ga0068863_100906259 3300005841 Unclassified 882
51 Ga0068858_100007765 3300005842 Bacteria 10357
52 Ga0068858_100351646 3300005842 Bacteria 1411
53 Ga0068860_100499140 3300005843 Bacteria 1215
54 Ga0068860_100750455 3300005843 Bacteria 987
55 Ga0068862_101069327 3300005844 Bacteria 801
56 Ga0081539_10075046 3300005985 Bacteria 1798
57 Ga0075368_10013121 3300006042 Bacteria 3040
58 Ga0075364_10020198 3300006051 Bacteria 4189
59 Ga0075364_10350280 3300006051 Bacteria 1007
60 Ga0075362_10012980 3300006177 Bacteria 3323
61 Ga0075367_10085222 3300006178 Bacteria 1917
62 Ga0075366_10098154 3300006195 Bacteria 1757
63 Ga0075366_10403223 3300006195 Bacteria 842
64 Ga0097621_100224273 3300006237 Bacteria 1639
65 Ga0075370_10539707 3300006353 Bacteria 705
66 Ga0075428_100059187 3300006844 Bacteria 4195
67 Ga0075428_100866265 3300006844 Bacteria 959
68 Ga0075431_100063145 3300006847 Bacteria 3822
69 Ga0075431_100081544 3300006847 Bacteria 3340
70 Ga0075431_101031347 3300006847 Unclassified 789
71 Ga0075433_10210122 3300006852 Bacteria 1729
72 Ga0075434_100023274 3300006871 Bacteria 6034
73 Ga0075434_100625423 3300006871 Bacteria 1095
74 Ga0075429_100022950 3300006880 Bacteria 5409
75 Ga0075429_100066027 3300006880 Bacteria 3149
76 Ga0075436_100008616 3300006914 Bacteria 6971
77 Ga0075436_100013829 3300006914 Bacteria 5527
78 Ga0097620_100281600 3300006931 Bacteria 1755
79 Ga0075435_100013746 3300007076 Bacteria 6032
80 Ga0075435_100018121 3300007076 Bacteria 5344
81 Ga0111539_10470115 3300009094 Bacteria 1464
82 Ga0111539_10474606 3300009094 Bacteria 1457
83 Ga0105245_10104890 3300009098 Bacteria 2621
84 Ga0105247_10041508 3300009101 Bacteria 2816
85 Ga0105247_10217754 3300009101 Bacteria 1291
86 Ga0114129_10494632 3300009147 Bacteria 1598
87 Ga0114129_10694929 3300009147 Bacteria 1308
88 Ga0114129_10764114 3300009147 Bacteria 1236
89 Ga0105243_10331446 3300009148 Bacteria 1390
90 Ga0105243_11420825 3300009148 Bacteria 715
91 Ga0105242_10535391 3300009176 Bacteria 1120
92 Ga0105242_10811269 3300009176 Bacteria 927
93 Ga0105242_11365385 3300009176 Bacteria 735
94 Ga0105248_10187951 3300009177 Bacteria 2328
95 Ga0105248_10215929 3300009177 Bacteria 2160
96 Ga0105248_10317939 3300009177 Bacteria 1753
97 Ga0105248_10365531 3300009177 Bacteria 1624
98 Ga0105248_10866404 3300009177 Bacteria 1020
99 Ga0105249_11715777 3300009553 Bacteria 700
100 Ga0157374_10196172 3300013296 Bacteria 1976
101 Ga0157374_10741229 3300013296 Bacteria 997
102 Ga0157378_10898910 3300013297 Bacteria 916
103 Ga0163162_10309798 3300013306 Bacteria 1711
104 Ga0163162_10450490 3300013306 Bacteria 1419
105 Ga0157375_10098051 3300013308 Bacteria 3007
106 Ga0157375_10503614 3300013308 Bacteria 1375
107 Ga0157375_10727758 3300013308 Bacteria 1145
108 Ga0157375_11108077 3300013308 Unclassified 927
109 Ga0163163_10164359 3300014325 Bacteria 2265
110 Ga0157380_10093036 3300014326 Bacteria 2493
111 Ga0157380_10316339 3300014326 Bacteria 1445
112 Ga0157380_11087742 3300014326 Bacteria 838
113 Ga0157377_10136886 3300014745 Bacteria 1502
114 Ga0157379_10130058 3300014968 Bacteria 2265
115 Ga0157379_10523017 3300014968 Bacteria 1101
116 Ga0157379_10978335 3300014968 Unclassified 806
117 Ga0157376_10334712 3300014969 Bacteria 1444
118 Ga0207710_10016649 3300025900 Bacteria 3112
119 Ga0207710_10031951 3300025900 Bacteria 2305
120 Ga0207688_10400535 3300025901 Bacteria 851
121 Ga0207645_10391728 3300025907 Unclassified 933
122 Ga0207643_10397333 3300025908 Bacteria 871
123 Ga0207660_10500152 3300025917 Bacteria 986
124 Ga0207662_10312280 3300025918 Bacteria 1047
125 Ga0207649_10451512 3300025920 Bacteria 970
126 Ga0207646_10707406 3300025922 Bacteria 901
127 Ga0207646_11097354 3300025922 Unclassified 700
128 Ga0207681_10066259 3300025923 Bacteria 2500
129 Ga0207681_10215588 3300025923 Bacteria 1482
130 Ga0207681_10453526 3300025923 Unclassified 1044
131 Ga0207650_10586447 3300025925 Bacteria 936
132 Ga0207650_10640846 3300025925 Unclassified 895
133 Ga0207659_10002281 3300025926 Bacteria 11427
134 Ga0207659_10629072 3300025926 Bacteria 916
135 Ga0207706_10538143 3300025933 Bacteria 1006
136 Ga0207670_10530791 3300025936 Bacteria 959
137 Ga0207704_10829121 3300025938 Bacteria 774
138 Ga0207691_10089812 3300025940 Bacteria 2754
139 Ga0207691_10693397 3300025940 Bacteria 859
140 Ga0207711_10062536 3300025941 Bacteria 3211
141 Ga0207711_10137311 3300025941 Bacteria 2197
142 Ga0207711_10322037 3300025941 Bacteria 1429
143 Ga0207711_10558120 3300025941 Bacteria 1068
144 Ga0207689_10097667 3300025942 Bacteria 2413
145 Ga0207689_10211222 3300025942 Bacteria 1603
146 Ga0207651_10927081 3300025960 Bacteria 776
147 Ga0207712_10417353 3300025961 Bacteria 1131
148 Ga0207712_10844625 3300025961 Bacteria 807
149 Ga0207658_10542408 3300025986 Bacteria 1040
150 Ga0207658_11114988 3300025986 Bacteria 721
151 Ga0207703_10026689 3300026035 Bacteria 4549
152 Ga0207703_10208025 3300026035 Bacteria 1743
153 Ga0207703_10316842 3300026035 Bacteria 1427
154 Ga0207639_11395410 3300026041 Bacteria 657
155 Ga0207708_10130286 3300026075 Bacteria 1966
156 Ga0207708_10184539 3300026075 Bacteria 1657
157 Ga0207641_10323131 3300026088 Bacteria 1464
158 Ga0207641_10398233 3300026088 Bacteria 1321
159 Ga0207648_11030557 3300026089 Unclassified 771
160 Ga0207674_10184835 3300026116 Bacteria 2035
161 Ga0207675_100251201 3300026118 Bacteria 1712
162 Ga0207683_10110168 3300026121 Bacteria 2465
163 Ga0207683_10112116 3300026121 Bacteria 2443
164 Ga0207683_10684309 3300026121 Bacteria 951
165 Ga0209969_1005823 3300027360 Bacteria 1735
166 Ga0209968_1011632 3300027526 Bacteria 1366
167 Ga0209998_10052608 3300027717 Bacteria 946
168 Ga0209813_10033641 3300027866 Bacteria 1525
169 Ga0209974_10045685 3300027876 Bacteria 1463
170 Ga0207428_10018712 3300027907 Bacteria 5912
171 Ga0207428_10019499 3300027907 Bacteria 5780
172 Ga0207428_10222223 3300027907 Bacteria 1415
173 Ga0268265_10035104 3300028380 Bacteria 3660
174 Ga0268265_10209142 3300028380 Bacteria 1699
175 Ga0268264_10251037 3300028381 Bacteria 1643
176 Ga0268264_11332475 3300028381 Bacteria 728
177 Ga0307408_100177761 3300031548 Bacteria 1704
178 Ga0307407_10405458 3300031903 Unclassified 979
179 Ga0307416_100802706 3300032002 Bacteria 1037
180 Ga0307416_100943480 3300032002 Bacteria 964
181 Ga0307416_101201150 3300032002 Unclassified 864
182 Ga0307411_10085700 3300032005 Bacteria 2183
183 Ga0373923_0113798 3300035111 Bacteria 1204
184 Ga0373939_0123263 3300035114 Unclassified 917
185 Ga0373955_0187826 3300035172 Bacteria 1228
186 Ga0373937_0496476 3300036401 Bacteria 1159
187 Ga0436363_0673022 3300039450 Bacteria 841
188 Ga0451807_0808391 3300041486 Bacteria 1059
189 Ga0451853_0084445 3300041512 Unclassified 717
190 Ga0439431_0056134 3300041997 Bacteria 1029
191 Ga0439457_057309 3300042014 Bacteria 880
192 Ga0439462_0033374 3300042015 Bacteria 1365
193 Ga0439446_0046851 3300042156 Bacteria 1285
194 Ga0439446_0112291 3300042156 Bacteria 870
195 Ga0439446_0165727 3300042156 Bacteria 733
196 Ga0439434_0007527 3300042435 Bacteria 3191
197 Ga0439435_0007587 3300042436 Bacteria 2488
198 Ga0439444_0005614 3300042437 Bacteria 1870
199 Ga0439444_0033197 3300042437 Bacteria 980
200 Ga0466960_0327211 3300044901 Bacteria 869
201 Ga0451576_1395051 3300045051 Unclassified 729
202 Ga0495639_0271174 3300046475 Bacteria 842
203 Ga0495630_0080260 3300046517 Bacteria 2461
204 Ga0495663_0208008 3300046525 Unclassified 685
205 Ga0495621_0093752 3300046539 Bacteria 1135
206 Ga0495645_0439233 3300046543 Bacteria 825
207 Ga0495647_0070095 3300046681 Bacteria 1402
208 Ga0495647_0138156 3300046681 Bacteria 1038
209 Ga0495658_0736594 3300046683 Bacteria 631
210 Ga0495613_0259647 3300046689 Bacteria 1211
211 Ga0495624_0090061 3300046690 Bacteria 1893
212 Ga0495600_0116145 3300046809 Bacteria 1742
213 Ga0495676_0322378 3300047321 Bacteria 1038
214 Ga0495680_0794231 3300047322 Unclassified 619
215 Ga0496104_0353011 3300048907 Bacteria 1383
216 Ga0496105_0131209 3300048908 Bacteria 2066
217 Ga0496108_0078990 3300048911 Bacteria 2785
218 Ga0496108_0528539 3300048911 Bacteria 1030
219 Ga0496109_0140963 3300048912 Bacteria 2254
220 Ga0496112_0038948 3300048915 Bacteria 4643
221 Ga0496112_0263146 3300048915 Bacteria 1674
222 Ga0496113_0123458 3300048916 Bacteria 2026
223 Ga0501031_0223894 3300049568 Bacteria 1225
224 Ga0501031_0557701 3300049568 Unclassified 738
225 Ga0501033_0074524 3300049570 Bacteria 2492
226 Ga0501033_0380842 3300049570 Bacteria 986
227 Ga0501036_0216712 3300049572 Bacteria 1608
228 Ga0501036_0221398 3300049572 Bacteria 1589
229 Ga0501036_0309042 3300049572 Bacteria 1322
230 Ga0501036_0382754 3300049572 Bacteria 1174
231 Ga0501036_0742154 3300049572 Bacteria 810
232 Ga0501040_1025417 3300049576 Unclassified 598
233 Ga0501041_0653782 3300049577 Unclassified 672
234 Ga0501042_0369292 3300049578 Bacteria 1038
235 Ga0501048_0406586 3300049582 Bacteria 973
236 Ga0501069_0375987 3300049585 Bacteria 839
237 Ga0501071_0163348 3300049587 Bacteria 1665
238 Ga0501071_0767574 3300049587 Bacteria 743
239 Ga0501071_0807013 3300049587 Bacteria 723
240 Ga0501072_0659476 3300049588 Bacteria 823
241 Ga0501073_0005689 3300049589 Bacteria 9324
242 Ga0501074_0206907 3300049590 Bacteria 1398
243 Ga0501075_0232013 3300049591 Bacteria 1407
244 Ga0501075_0274406 3300049591 Bacteria 1285
245 Ga0501075_0455336 3300049591 Unclassified 976
246 Ga0501076_0221799 3300049592 Bacteria 1545
247 Ga0501076_0273505 3300049592 Bacteria 1383
248 Ga0501076_0651467 3300049592 Bacteria 869
249 Ga0501079_0411514 3300049741 Bacteria 1061
250 Ga0501079_0707722 3300049741 Unclassified 793
251 Ga0501080_1010525 3300049742 Unclassified 721
252 Ga0501081_0364237 3300049743 Bacteria 1067
253 Ga0501081_0900245 3300049743 Unclassified 667
254 Ga0501045_0167803 3300049824 Bacteria 1635
255 Ga0501045_0336528 3300049824 Bacteria 1123
256 Ga0501045_0371255 3300049824 Bacteria 1065
257 nmdc:mga03683_152131_c1 3300050489 Bacteria 1044
258 nmdc:mga03683_795_c1 3300050489 Bacteria 9025
259 nmdc:mga00v17_465075_c1 3300050491 Bacteria 821
260 nmdc:mga00v17_7196_c1 3300050491 Bacteria 5930
261 nmdc:mga0k408_29262_c1 3300050493 Bacteria 3135
262 nmdc:mga06z11_63326_c1 3300050494 Bacteria 1935
263 nmdc:mga04h51_20491_c1 3300050495 Bacteria 1553
264 nmdc:mga05p37_146498_c1 3300050507 Bacteria 2891
265 nmdc:mga05p37_597273_c1 3300050507 Bacteria 1247
266 nmdc:mga05p37_654530_c1 3300050507 Bacteria 1176
267 nmdc:mga09592_130065_c1 3300050508 Bacteria 2166
268 nmdc:mga09592_190902_c1 3300050508 Bacteria 1773
269 nmdc:mga09592_981564_c1 3300050508 Unclassified 707
270 nmdc:mga0qj67_1172429_c1 3300050509 Unclassified 598
271 nmdc:mga0qj67_708665_c1 3300050509 Unclassified 800
272 nmdc:mga06r32_406823_c1 3300050510 Bacteria 1343
273 nmdc:mga06r32_539666_c1 3300050510 Bacteria 1141
274 nmdc:mga06r32_540931_c1 3300050510 Bacteria 1139
275 nmdc:mga06r32_558184_c1 3300050510 Bacteria 1118
276 nmdc:mga06r32_59131_c1 3300050510 Bacteria 3685
277 nmdc:mga08y16_21970_c1 3300050511 Bacteria 6736
278 nmdc:mga08y16_252863_c1 3300050511 Bacteria 1821
279 nmdc:mga08y16_31371_c1 3300050511 Bacteria 5166
280 nmdc:mga08y16_473260_c1 3300050511 Bacteria 1275
281 nmdc:mga08y16_8798_c1 3300050511 Bacteria 10598
282 nmdc:mga0n895_227_c1 3300050512 Bacteria 35542
283 nmdc:mga0rr50_12816_c1 3300050513 Bacteria 5433
284 nmdc:mga0rr50_9834_c1 3300050513 Bacteria 6041
285 nmdc:mga08x19_1177_c1 3300050514 Bacteria 16391
286 nmdc:mga08x19_238304_c1 3300050514 Bacteria 1254
287 nmdc:mga08x19_78190_c1 3300050514 Bacteria 2168
288 nmdc:mga0a205_275974_c1 3300050515 Bacteria 1557
289 Ga0500646_0112093 3300053090 Unclassified 868
290 Ga0501084_0853326 3300054114 Bacteria 766
291 Ga0590071_000639 3300059421 Bacteria 9941
292 Ga0590071_003207 3300059421 Bacteria 4039
293 Ga0590074_000990 3300059423 Bacteria 4468
294 Ga0590075_000405 3300059424 Bacteria 11801
295 Ga0590075_046280 3300059424 Bacteria 1114
296 Ga0590075_076380 3300059424 Bacteria 866
297 Ga0590077_000732 3300059426 Bacteria 8606
298 Ga0590077_002487 3300059426 Bacteria 3925
299 Ga0587066_062159 3300059490 Bacteria 765
300 Ga0501082_0406882 3300060353 Bacteria 1188
301 Ga0530510_0738670 3300061734 Unclassified 750
302 Ga0530510_0742056 3300061734 Unclassified 749
303 Ga0530510_0777456 3300061734 Bacteria 730
304 Ga0070698_100625028
305 Ga0065712_10188815
306 Ga0070676_10825968
307 Ga0070690_100161899
308 Ga0070690_100429243
309 Ga0070670_100390883
310 Ga0070670_100473473
311 Ga0070677_10221275
312 Ga0068869_100136188
313 Ga0068869_100158264
314 Ga0070666_10737076
315 Ga0068868_100218523
316 Ga0070691_10021653
317 Ga0070687_100895340
318 Ga0070669_100038635
319 Ga0070669_100414339
320 Ga0070669_100832604
321 Ga0070671_100159531
322 Ga0070671_100647498
323 Ga0070673_101389074
324 Ga0070673_101784047
325 Ga0070688_100278021
326 Ga0070667_100603154
327 Ga0070700_100266554
328 Ga0070694_100169871
329 Ga0070694_101007468
330 Ga0070708_101046509
331 Ga0070708_101107314
332 Ga0070678_100363448
333 Ga0070678_100748798
334 Ga0068867_100448430
335 Ga0070706_100796498
336 Ga0070707_100453081
337 Ga0070698_100164546
338 Ga0070698_100810392
339 Ga0070699_100101493
340 Ga0070699_100382059
341 Ga0070697_100260826
342 Ga0070672_100131380
343 Ga0070672_100276868
344 Ga0070672_100906842
345 Ga0070695_100844181
346 Ga0070665_100269441
347 Ga0070704_100648983
348 Ga0068857_100526434
349 Ga0070702_100192661
350 Ga0068859_100281606
351 Ga0068859_100842985
352 Ga0068870_10069254
353 Ga0068863_100906259
354 Ga0068858_100007765
355 Ga0068858_100351646
356 Ga0068860_100499140
357 Ga0068860_100750455
358 Ga0068862_101069327
359 Ga0081539_10075046
360 Ga0075368_10013121
361 Ga0075364_10020198
362 Ga0075364_10350280
363 Ga0075362_10012980
364 Ga0075367_10085222
365 Ga0075366_10098154
366 Ga0075366_10403223
367 Ga0097621_100224273
368 Ga0075370_10539707
369 Ga0075428_100059187
370 Ga0075428_100866265
371 Ga0075431_100063145
372 Ga0075431_100081544
373 Ga0075431_101031347
374 Ga0075433_10210122
375 Ga0075434_100023274
376 Ga0075434_100625423
377 Ga0075429_100022950
378 Ga0075429_100066027
379 Ga0075436_100008616
380 Ga0075436_100013829
381 Ga0097620_100281600
382 Ga0075435_100013746
383 Ga0075435_100018121
384 Ga0111539_10470115
385 Ga0111539_10474606
386 Ga0105245_10104890
387 Ga0105247_10041508
388 Ga0105247_10217754
389 Ga0114129_10494632
390 Ga0114129_10694929
391 Ga0114129_10764114
392 Ga0105243_10331446
393 Ga0105243_11420825
394 Ga0105242_10535391
395 Ga0105242_10811269
396 Ga0105242_11365385
397 Ga0105248_10187951
398 Ga0105248_10215929
399 Ga0105248_10317939
400 Ga0105248_10365531
401 Ga0105248_10866404
402 Ga0105249_11715777
403 Ga0157374_10196172
404 Ga0157374_10741229
405 Ga0157378_10898910
406 Ga0163162_10309798
407 Ga0163162_10450490
408 Ga0157375_10098051
409 Ga0157375_10503614
410 Ga0157375_10727758
411 Ga0157375_11108077
412 Ga0163163_10164359
413 Ga0157380_10093036
414 Ga0157380_10316339
415 Ga0157380_11087742
416 Ga0157377_10136886
417 Ga0157379_10130058
418 Ga0157379_10523017
419 Ga0157379_10978335
420 Ga0157376_10334712
421 Ga0207710_10016649
422 Ga0207710_10031951
423 Ga0207688_10400535
424 Ga0207645_10391728
425 Ga0207643_10397333
426 Ga0207660_10500152
427 Ga0207662_10312280
428 Ga0207649_10451512
429 Ga0207646_10707406
430 Ga0207646_11097354
431 Ga0207681_10066259
432 Ga0207681_10215588
433 Ga0207681_10453526
434 Ga0207650_10586447
435 Ga0207650_10640846
436 Ga0207659_10002281
437 Ga0207659_10629072
438 Ga0207706_10538143
439 Ga0207670_10530791
440 Ga0207704_10829121
441 Ga0207691_10089812
442 Ga0207691_10693397
443 Ga0207711_10062536
444 Ga0207711_10137311
445 Ga0207711_10322037
446 Ga0207711_10558120
447 Ga0207689_10097667
448 Ga0207689_10211222
449 Ga0207651_10927081
450 Ga0207712_10417353
451 Ga0207712_10844625
452 Ga0207658_10542408
453 Ga0207658_11114988
454 Ga0207703_10026689
455 Ga0207703_10208025
456 Ga0207703_10316842
457 Ga0207639_11395410
458 Ga0207708_10130286
459 Ga0207708_10184539
460 Ga0207641_10323131
461 Ga0207641_10398233
462 Ga0207648_11030557
463 Ga0207674_10184835
464 Ga0207675_100251201
465 Ga0207683_10110168
466 Ga0207683_10112116
467 Ga0207683_10684309
468 Ga0209969_1005823
469 Ga0209968_1011632
470 Ga0209998_10052608
471 Ga0209813_10033641
472 Ga0209974_10045685
473 Ga0207428_10018712
474 Ga0207428_10019499
475 Ga0207428_10222223
476 Ga0268265_10035104
477 Ga0268265_10209142
478 Ga0268264_10251037
479 Ga0268264_11332475
480 Ga0307408_100177761
481 Ga0307407_10405458
482 Ga0307416_100802706
483 Ga0307416_100943480
484 Ga0307416_101201150
485 Ga0307411_10085700
486 Ga0373923_0113798
487 Ga0373939_0123263
488 Ga0373955_0187826
489 Ga0373937_0496476
490 Ga0436363_0673022
491 Ga0451807_0808391
492 Ga0451853_0084445
493 Ga0439431_0056134
494 Ga0439457_057309
495 Ga0439462_0033374
496 Ga0439446_0046851
497 Ga0439446_0112291
498 Ga0439446_0165727
499 Ga0439434_0007527
500 Ga0439435_0007587
501 Ga0439444_0005614
502 Ga0439444_0033197
503 Ga0466960_0327211
504 Ga0451576_1395051
505 Ga0495639_0271174
506 Ga0495630_0080260
507 Ga0495663_0208008
508 Ga0495621_0093752
509 Ga0495645_0439233
510 Ga0495647_0070095
511 Ga0495647_0138156
512 Ga0495658_0736594
513 Ga0495613_0259647
514 Ga0495624_0090061
515 Ga0495600_0116145
516 Ga0495676_0322378
517 Ga0495680_0794231
518 Ga0496104_0353011
519 Ga0496105_0131209
520 Ga0496108_0078990
521 Ga0496108_0528539
522 Ga0496109_0140963
523 Ga0496112_0038948
524 Ga0496112_0263146
525 Ga0496113_0123458
526 Ga0501031_0223894
527 Ga0501031_0557701
528 Ga0501033_0074524
529 Ga0501033_0380842
530 Ga0501036_0216712
531 Ga0501036_0221398
532 Ga0501036_0309042
533 Ga0501036_0382754
534 Ga0501036_0742154
535 Ga0501040_1025417
536 Ga0501041_0653782
537 Ga0501042_0369292
538 Ga0501048_0406586
539 Ga0501069_0375987
540 Ga0501071_0163348
541 Ga0501071_0767574
542 Ga0501071_0807013
543 Ga0501072_0659476
544 Ga0501073_0005689
545 Ga0501074_0206907
546 Ga0501075_0232013
547 Ga0501075_0274406
548 Ga0501075_0455336
549 Ga0501076_0221799
550 Ga0501076_0273505
551 Ga0501076_0651467
552 Ga0501079_0411514
553 Ga0501079_0707722
554 Ga0501080_1010525
555 Ga0501081_0364237
556 Ga0501081_0900245
557 Ga0501045_0167803
558 Ga0501045_0336528
559 Ga0501045_0371255
560 nmdc:mga03683_152131_c1
561 nmdc:mga03683_795_c1
562 nmdc:mga00v17_465075_c1
563 nmdc:mga00v17_7196_c1
564 nmdc:mga0k408_29262_c1
565 nmdc:mga06z11_63326_c1
566 nmdc:mga04h51_20491_c1
567 nmdc:mga05p37_146498_c1
568 nmdc:mga05p37_597273_c1
569 nmdc:mga05p37_654530_c1
570 nmdc:mga09592_130065_c1
571 nmdc:mga09592_190902_c1
572 nmdc:mga09592_981564_c1
573 nmdc:mga0qj67_1172429_c1
574 nmdc:mga0qj67_708665_c1
575 nmdc:mga06r32_406823_c1
576 nmdc:mga06r32_539666_c1
577 nmdc:mga06r32_540931_c1
578 nmdc:mga06r32_558184_c1
579 nmdc:mga06r32_59131_c1
580 nmdc:mga08y16_21970_c1
581 nmdc:mga08y16_252863_c1
582 nmdc:mga08y16_31371_c1
583 nmdc:mga08y16_473260_c1
584 nmdc:mga08y16_8798_c1
585 nmdc:mga0n895_227_c1
586 nmdc:mga0rr50_12816_c1
587 nmdc:mga0rr50_9834_c1
588 nmdc:mga08x19_1177_c1
589 nmdc:mga08x19_238304_c1
590 nmdc:mga08x19_78190_c1
591 nmdc:mga0a205_275974_c1
592 Ga0500646_0112093
593 Ga0501084_0853326
594 Ga0590071_000639
595 Ga0590071_003207
596 Ga0590074_000990
597 Ga0590075_000405
598 Ga0590075_046280
599 Ga0590075_076380
600 Ga0590077_000732
601 Ga0590077_002487
602 Ga0587066_062159
603 Ga0501082_0406882
604 Ga0530510_0738670
605 Ga0530510_0742056
606 Ga0530510_0777456

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00466

Ribosomal_L10

Ribosomal protein L10

3

101

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ug7-assembly1.cif.gz_LJ 70s ribosome complex in an intermediate state of translocation bound to ef-g(gdp) stalled by argyrin b 0.9633 1 129
7ug7-assembly1.cif.gz_LJ 70s ribosome complex in an intermediate state of translocation bound to ef-g(gdp) stalled by argyrin b 0.9561 1 129
5gad-assembly1.cif.gz_I rnc-srp-sr complex early state 0.9447 2 125
5zeb-assembly1.cif.gz_I m. smegmatis p/p state 70s ribosome structure 0.9432 4 129
7unu-assembly1.cif.gz_I pseudomonas aeruginosa 70s ribosome initiation complex bound to compact if2-gdp (composite structure i-b) 0.9426 2 118
ID Description Score Start End Superfamily
af_Q8I1U9_104_236_3.30.70.1730 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain 0.9238 4 129 3.30.70.1730
af_Q9FY50_43_174_3.30.70.1730 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain 0.9222 3 132 3.30.70.1730
1zaxA01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain 0.9213 5 129 3.30.70.1730
af_Q9FY50_43_174_3.30.70.1730 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain 0.9025 3 132 3.30.70.1730
6dzpI00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain 0.8933 4 129 3.30.70.1730
ID Description Score Start End GO Terms
AF-A0A378BFA1-F1-model_v4 Large ribosomal subunit protein uL10 0.9687 1 132 GO:0003735
GO:0006412
GO:0015934
GO:0070180
AF-A0A7V5X184-F1-model_v4 50S ribosomal protein L10 0.9687 5 112 GO:0003735
GO:0006412
GO:0015934
AF-A0A6L3XU50-F1-model_v4 50S ribosomal protein L10 0.9675 1 122 GO:0003735
GO:0006412
GO:0015934
AF-A0A7Z9WDZ0-F1-model_v4 50S ribosomal protein L10 0.9651 5 127 GO:0003735
GO:0006412
GO:0015934
AF-A0A4Q6BZD9-F1-model_v4 50S ribosomal protein L10 0.9632 1 119 GO:0003735
GO:0006412
GO:0015934

Map