F396749

General Info

Members Datasets Scaffolds Average Seq Length
302 225 604 211

Family's Representative Sequence

Representative Sequence 3300053103|Ga0500555_000822|Ga0500555_000822_5322_6026
Length 234
Sequence MRHGWFDPRLSFRALSGGKVFIRVTRMSAYQLYCFGESGNSYKAALMLELCRLDWQPIWVDYFGSQTRSPEYRSEINEMGEVPVLVFGGRKLTQSGVILDYLAEQTGKFGPANADERREILRWMLFDNHKFTSYIATLRFMVSLAKTGETPVTEFLRQRFINAPKIVDGHLARQPFLIGDRATIADLSLCGYMFYGEEIPLPLTPYPHVLEWLERIKALPGWKHPYDLVPRAKA

Samples

Sample ID Description Type Environment
1 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
39 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
72 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
101 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
102 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
103 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
104 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
105 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
106 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
107 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
108 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
109 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
110 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
111 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
114 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
115 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
116 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
117 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
118 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
119 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
120 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
122 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
124 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
125 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
128 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
134 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
137 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
138 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
139 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
140 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
141 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
142 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
143 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
144 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
145 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
146 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
147 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
150 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
151 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
152 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
153 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
154 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
155 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
156 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
157 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
158 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
159 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
160 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
161 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
162 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
163 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
164 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
165 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
166 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
167 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
168 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
169 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
170 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
171 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
172 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
173 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
174 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
175 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
176 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
177 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
178 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
179 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
180 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
181 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
182 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
183 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
194 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
195 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
202 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
203 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
204 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
205 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
206 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
207 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
208 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
209 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
210 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
211 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
212 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
213 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
214 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
217 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
218 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
219 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
220 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
221 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
222 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
223 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
224 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
225 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.63
Nodule 0
Rhizoplane 4.3
Rhizosphere 87.75
Stem 0
Stem Tuber 0
Unclassified 5.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500555_000822 3300053103 Bacteria 11113
2 JGI25405J52794_10035237 3300003911 Bacteria 1048
3 Ga0070670_100398633 3300005331 Bacteria 1215
4 Ga0068869_100105176 3300005334 Bacteria 2140
5 Ga0070666_10608311 3300005335 Bacteria 798
6 Ga0070682_100034728 3300005337 Bacteria 3073
7 Ga0070689_100538513 3300005340 Bacteria 1005
8 Ga0070689_100874400 3300005340 Bacteria 794
9 Ga0070668_100051131 3300005347 Bacteria 3183
10 Ga0070674_100104430 3300005356 Bacteria 2070
11 Ga0070673_100072243 3300005364 Bacteria 2774
12 Ga0070659_100016128 3300005366 Bacteria 5606
13 Ga0070659_100736324 3300005366 Bacteria 854
14 Ga0070714_100412378 3300005435 Unclassified 1279
15 Ga0070713_100797743 3300005436 Bacteria 905
16 Ga0070710_10148223 3300005437 Bacteria 1445
17 Ga0070711_100120510 3300005439 Bacteria 1939
18 Ga0070708_100497375 3300005445 Bacteria 1150
19 Ga0070678_100571870 3300005456 Bacteria 1006
20 Ga0070681_10068850 3300005458 Bacteria 3505
21 Ga0068867_100149686 3300005459 Bacteria 1832
22 Ga0070685_10127459 3300005466 Bacteria 1588
23 Ga0070706_100692774 3300005467 Bacteria 945
24 Ga0070707_100012308 3300005468 Bacteria 7988
25 Ga0070698_100083072 3300005471 Bacteria 3194
26 Ga0070698_100116390 3300005471 Bacteria 2636
27 Ga0070699_100187311 3300005518 Bacteria 1838
28 Ga0070679_100081996 3300005530 Bacteria 3215
29 Ga0070679_100338767 3300005530 Bacteria 1452
30 Ga0070679_101109133 3300005530 Unclassified 736
31 Ga0068853_100014659 3300005539 Bacteria 6429
32 Ga0070693_100011192 3300005547 Bacteria 4515
33 Ga0068855_100107385 3300005563 Bacteria 3207
34 Ga0068857_100103277 3300005577 Bacteria 2559
35 Ga0068857_100658400 3300005577 Bacteria 993
36 Ga0070702_100264504 3300005615 Bacteria 1173
37 Ga0068859_100137211 3300005617 Bacteria 2519
38 Ga0068864_100322779 3300005618 Bacteria 1450
39 Ga0068861_100257463 3300005719 Bacteria 1492
40 Ga0068861_100788109 3300005719 Bacteria 891
41 Ga0068863_100408789 3300005841 Bacteria 1328
42 Ga0081455_10007979 3300005937 Bacteria 11070
43 Ga0081539_10174901 3300005985 Bacteria 1011
44 Ga0070717_10064117 3300006028 Bacteria 3051
45 Ga0070717_10408305 3300006028 Unclassified 1221
46 Ga0075368_10212328 3300006042 Bacteria 821
47 Ga0075363_100114925 3300006048 Bacteria 1498
48 Ga0075363_100248033 3300006048 Unclassified 1025
49 Ga0070715_10083754 3300006163 Unclassified 1453
50 Ga0070712_100138530 3300006175 Bacteria 1854
51 Ga0070712_100166239 3300006175 Bacteria 1708
52 Ga0070712_100287707 3300006175 Unclassified 1326
53 Ga0075362_10013881 3300006177 Bacteria 3236
54 Ga0075362_10088499 3300006177 Bacteria 1435
55 Ga0075366_10066476 3300006195 Bacteria 2145
56 Ga0075366_10134519 3300006195 Bacteria 1493
57 Ga0075430_100095828 3300006846 Bacteria 2480
58 Ga0075431_100243250 3300006847 Bacteria 1830
59 Ga0075433_10515608 3300006852 Bacteria 1052
60 Ga0075434_100020462 3300006871 Bacteria 6419
61 Ga0075434_100026349 3300006871 Bacteria 5695
62 Ga0097620_100137233 3300006931 Bacteria 2519
63 Ga0075435_100050684 3300007076 Bacteria 3342
64 Ga0105240_10576789 3300009093 Bacteria 1241
65 Ga0111539_10023989 3300009094 Bacteria 7493
66 Ga0105245_10028661 3300009098 Bacteria 4913
67 Ga0105247_10064309 3300009101 Bacteria 2279
68 Ga0114129_10317334 3300009147 Bacteria 2072
69 Ga0105243_10110495 3300009148 Bacteria 2299
70 Ga0105243_10214550 3300009148 Bacteria 1697
71 Ga0105241_10334085 3300009174 Bacteria 1311
72 Ga0105241_10361147 3300009174 Bacteria 1264
73 Ga0105248_11640331 3300009177 Bacteria 729
74 Ga0105237_10139393 3300009545 Bacteria 2419
75 Ga0105237_10283944 3300009545 Bacteria 1658
76 Ga0105237_10404930 3300009545 Bacteria 1369
77 Ga0105237_10941431 3300009545 Bacteria 871
78 Ga0105238_10072413 3300009551 Bacteria 3441
79 Ga0105238_10277992 3300009551 Bacteria 1655
80 Ga0105238_10749371 3300009551 Bacteria 990
81 Ga0105238_11138058 3300009551 Bacteria 804
82 Ga0105249_11620720 3300009553 Bacteria 720
83 Ga0105239_10191985 3300010375 Bacteria 2286
84 Ga0105239_10737951 3300010375 Bacteria 1127
85 Ga0105246_10093156 3300011119 Bacteria 2176
86 Ga0157373_10211803 3300013100 Bacteria 1366
87 Ga0157370_10623277 3300013104 Bacteria 987
88 Ga0157378_10040107 3300013297 Bacteria 4152
89 Ga0157372_10013752 3300013307 Bacteria 8649
90 Ga0157372_10266766 3300013307 Bacteria 1988
91 Ga0157375_11803075 3300013308 Bacteria 725
92 Ga0163163_10563683 3300014325 Bacteria 1202
93 Ga0157379_10269933 3300014968 Bacteria 1547
94 Ga0163161_10157095 3300017792 Bacteria 1732
95 Ga0213876_10015098 3300021384 Bacteria 4094
96 Ga0207710_10053560 3300025900 Bacteria 1815
97 Ga0207684_10662121 3300025910 Bacteria 889
98 Ga0207654_10239763 3300025911 Bacteria 1211
99 Ga0207654_10246783 3300025911 Bacteria 1195
100 Ga0207707_10108707 3300025912 Bacteria 2424
101 Ga0207707_10847486 3300025912 Bacteria 759
102 Ga0207693_10026627 3300025915 Bacteria 4575
103 Ga0207693_10214704 3300025915 Bacteria 1512
104 Ga0207663_10128408 3300025916 Bacteria 1747
105 Ga0207652_10020032 3300025921 Bacteria 5508
106 Ga0207652_10164178 3300025921 Bacteria 1991
107 Ga0207652_10508607 3300025921 Bacteria 1084
108 Ga0207646_10007906 3300025922 Bacteria 10732
109 Ga0207687_10066082 3300025927 Bacteria 2570
110 Ga0207690_10090216 3300025932 Bacteria 2163
111 Ga0207706_10141007 3300025933 Bacteria 2120
112 Ga0207689_10100139 3300025942 Bacteria 2381
113 Ga0207667_10101539 3300025949 Bacteria 2967
114 Ga0207651_10092960 3300025960 Bacteria 2213
115 Ga0207712_10495706 3300025961 Bacteria 1043
116 Ga0207668_10141397 3300025972 Bacteria 1851
117 Ga0207668_10909581 3300025972 Bacteria 783
118 Ga0207658_10067881 3300025986 Bacteria 2688
119 Ga0207639_10055942 3300026041 Bacteria 3021
120 Ga0207678_10169110 3300026067 Bacteria 1866
121 Ga0207641_10255856 3300026088 Bacteria 1637
122 Ga0207648_10173179 3300026089 Bacteria 1908
123 Ga0207674_10069706 3300026116 Bacteria 3536
124 Ga0207683_10648277 3300026121 Bacteria 978
125 Ga0207698_11170893 3300026142 Bacteria 782
126 Ga0209969_1022005 3300027360 Bacteria 953
127 Ga0209813_10103219 3300027866 Bacteria 973
128 Ga0268266_10000508 3300028379 Bacteria 54988
129 Ga0268266_10258297 3300028379 Bacteria 1614
130 Ga0268265_11129567 3300028380 Bacteria 779
131 Ga0265325_10050444 3300031241 Bacteria 2143
132 Ga0265339_10039200 3300031249 Bacteria 2639
133 Ga0265331_10018752 3300031250 Bacteria 3580
134 Ga0265331_10031047 3300031250 Bacteria 2657
135 Ga0307513_10091903 3300031456 Bacteria 3091
136 Ga0265313_10022890 3300031595 Bacteria 3378
137 Ga0307508_10119366 3300031616 Bacteria 2239
138 Ga0316575_10050584 3300031665 Bacteria 1654
139 Ga0316579_10002462 3300031691 Bacteria 6997
140 Ga0316576_10016751 3300031727 Bacteria 4962
141 Ga0307405_10524182 3300031731 Unclassified 954
142 Ga0316577_10342220 3300031733 Bacteria 849
143 Ga0307406_10386627 3300031901 Bacteria 1105
144 Ga0307416_100065244 3300032002 Bacteria 2991
145 Ga0316583_10022612 3300032133 Bacteria 2250
146 Ga0373934_0000062 3300035086 Bacteria 37020
147 Ga0373923_0214473 3300035111 Bacteria 893
148 Ga0373953_0006003 3300035117 Bacteria 3976
149 Ga0373953_0013252 3300035117 Bacteria 2941
150 Ga0373954_0020127 3300035118 Bacteria 3016
151 Ga0373956_0000016 3300035119 Bacteria 52042
152 Ga0373956_0030500 3300035119 Bacteria 2357
153 Ga0373957_0054588 3300035120 Bacteria 1535
154 Ga0373924_0041282 3300035410 Bacteria 1890
155 Ga0373931_0116749 3300035691 Bacteria 1521
156 Ga0373935_0041130 3300035692 Bacteria 2903
157 Ga0373927_0036837 3300035695 Bacteria 3180
158 Ga0373927_0123538 3300035695 Bacteria 1690
159 Ga0373933_0002271 3300035724 Bacteria 10956
160 Ga0373933_0025648 3300035724 Bacteria 3381
161 Ga0373947_0033940 3300035725 Bacteria 3017
162 Ga0373947_0082217 3300035725 Bacteria 1996
163 Ga0373947_0141633 3300035725 Bacteria 1542
164 Ga0373937_0002427 3300036401 Bacteria 15503
165 Ga0373937_0004022 3300036401 Bacteria 12454
166 Ga0373937_0522680 3300036401 Bacteria 1128
167 Ga0373937_0832754 3300036401 Bacteria 871
168 Ga0316582_0024290 3300036647 Bacteria 3626
169 Ga0316584_0055471 3300036712 Bacteria 2967
170 Ga0373925_0021025 3300037068 Bacteria 4755
171 Ga0373925_0202783 3300037068 Bacteria 1578
172 Ga0395899_0003955 3300037312 Bacteria 11677
173 Ga0395899_0042172 3300037312 Bacteria 3407
174 Ga0395900_0002788 3300037418 Bacteria 19101
175 Ga0395898_0003037 3300037466 Bacteria 19014
176 Ga0395898_0015423 3300037466 Bacteria 7835
177 Ga0316581_0009286 3300037588 Bacteria 2700
178 Ga0436364_1460237 3300037853 Unclassified 1522
179 Ga0395901_0003727 3300038443 Bacteria 15356
180 Ga0436365_0276782 3300039437 Bacteria 1951
181 Ga0436363_1641747 3300039450 Bacteria 3569
182 Ga0451800_0068175 3300041459 Unclassified 726
183 Ga0439448_0133121 3300042005 Bacteria 858
184 Ga0450902_001695 3300042137 Bacteria 3036
185 Ga0450905_000194 3300042142 Bacteria 6874
186 Ga0439459_0042148 3300042438 Bacteria 974
187 Ga0439464_0162021 3300042439 Bacteria 703
188 Ga0450901_001773 3300042533 Bacteria 2425
189 Ga0466963_0071798 3300044694 Bacteria 2331
190 Ga0466963_0090683 3300044694 Bacteria 2081
191 Ga0466964_0324045 3300044706 Bacteria 784
192 Ga0466957_0040629 3300044842 Bacteria 2810
193 Ga0466957_0094064 3300044842 Bacteria 1882
194 Ga0451576_0175750 3300045051 Bacteria 2235
195 Ga0466967_0482528 3300045976 Bacteria 1215
196 Ga0495592_0001653 3300046454 Bacteria 15634
197 Ga0495592_0546202 3300046454 Unclassified 713
198 Ga0495629_0060489 3300046459 Bacteria 2647
199 Ga0495651_0000851 3300046462 Bacteria 23699
200 Ga0495651_0002582 3300046462 Bacteria 14000
201 Ga0495651_0152649 3300046462 Unclassified 1663
202 Ga0495653_0029526 3300046463 Bacteria 4376
203 Ga0495608_0005525 3300046511 Bacteria 9029
204 Ga0495608_0196720 3300046511 Unclassified 1271
205 Ga0495618_0000969 3300046514 Bacteria 19742
206 Ga0495628_0019981 3300046516 Bacteria 5531
207 Ga0495630_0074774 3300046517 Bacteria 2552
208 Ga0495652_0001428 3300046529 Bacteria 26489
209 Ga0495652_0329865 3300046529 Bacteria 1100
210 Ga0495640_0002306 3300046533 Bacteria 15309
211 Ga0495587_0000553 3300046536 Bacteria 25822
212 Ga0495598_0007805 3300046537 Bacteria 2469
213 Ga0495645_0023772 3300046543 Bacteria 4441
214 Ga0495667_0002294 3300046559 Bacteria 12825
215 Ga0495634_0026347 3300046642 Bacteria 4058
216 Ga0495634_0100605 3300046642 Unclassified 1868
217 Ga0495634_0130563 3300046642 Bacteria 1602
218 Ga0495635_0014171 3300046663 Bacteria 5578
219 Ga0495657_0047557 3300046675 Bacteria 2899
220 Ga0495657_0167684 3300046675 Bacteria 1354
221 Ga0495599_0024095 3300046678 Bacteria 3806
222 Ga0495623_0001878 3300046679 Bacteria 14096
223 Ga0495658_0100485 3300046683 Bacteria 1726
224 Ga0495613_0215417 3300046689 Bacteria 1349
225 Ga0495624_0517942 3300046690 Unclassified 713
226 Ga0495600_0262222 3300046809 Unclassified 1097
227 Ga0495581_0027866 3300047315 Bacteria 3276
228 Ga0495604_0000445 3300047317 Bacteria 36642
229 Ga0495674_0008941 3300047319 Bacteria 9519
230 Ga0495674_0491620 3300047319 Bacteria 982
231 Ga0495672_0237708 3300047320 Bacteria 891
232 Ga0495676_0035976 3300047321 Bacteria 4139
233 Ga0495680_0028318 3300047322 Bacteria 4594
234 Ga0495680_0204455 3300047322 Bacteria 1416
235 Ga0495675_0006303 3300047444 Bacteria 7265
236 Ga0495685_080754 3300047447 Bacteria 1083
237 Ga0495684_0180475 3300047471 Unclassified 1565
238 Ga0495602_0006632 3300048088 Bacteria 12137
239 Ga0495615_0057044 3300048090 Bacteria 1021
240 Ga0496101_0132643 3300048904 Bacteria 1893
241 Ga0496102_0648792 3300048905 Bacteria 979
242 Ga0496102_0846282 3300048905 Bacteria 837
243 Ga0496104_0000588 3300048907 Bacteria 31033
244 Ga0496104_0233016 3300048907 Bacteria 1753
245 Ga0496105_0006806 3300048908 Bacteria 8794
246 Ga0496109_0150914 3300048912 Bacteria 2176
247 Ga0496110_0134595 3300048913 Bacteria 2233
248 Ga0496111_0525256 3300048914 Bacteria 870
249 Ga0496112_0187554 3300048915 Bacteria 2031
250 Ga0496113_0085023 3300048916 Bacteria 2430
251 Ga0496115_0529726 3300048918 Bacteria 944
252 Ga0496118_0045273 3300048921 Bacteria 3437
253 Ga0501033_0161505 3300049570 Bacteria 1613
254 Ga0501037_0261193 3300049573 Bacteria 1210
255 Ga0501039_0035775 3300049575 Bacteria 3833
256 Ga0501039_0071967 3300049575 Bacteria 2687
257 Ga0501039_0452976 3300049575 Bacteria 1008
258 Ga0501039_0537580 3300049575 Bacteria 917
259 Ga0501040_0666207 3300049576 Bacteria 752
260 Ga0501042_0195472 3300049578 Bacteria 1459
261 Ga0501046_0107913 3300049580 Bacteria 2129
262 Ga0501071_0112062 3300049587 Bacteria 2017
263 Ga0501071_0199498 3300049587 Bacteria 1503
264 Ga0501071_0224573 3300049587 Bacteria 1414
265 Ga0501072_0001644 3300049588 Bacteria 16715
266 Ga0501072_0121034 3300049588 Bacteria 2085
267 Ga0501072_0344179 3300049588 Bacteria 1184
268 Ga0501076_0253538 3300049592 Bacteria 1440
269 Ga0501076_0529404 3300049592 Bacteria 972
270 Ga0501079_0021691 3300049741 Bacteria 4916
271 Ga0501079_0443509 3300049741 Bacteria 1019
272 Ga0501080_0186817 3300049742 Bacteria 1905
273 Ga0501081_0172611 3300049743 Bacteria 1561
274 Ga0501045_0379052 3300049824 Bacteria 1053
275 nmdc:mga03683_182652_c1 3300050489 Bacteria 957
276 nmdc:mga03683_45874_c1 3300050489 Bacteria 1810
277 nmdc:mga03n38_13853_c1 3300050490 Bacteria 3074
278 nmdc:mga03n38_231877_c1 3300050490 Unclassified 968
279 nmdc:mga0k408_108330_c1 3300050493 Bacteria 1641
280 nmdc:mga0k408_267502_c1 3300050493 Unclassified 1021
281 nmdc:mga05p37_24316_c1 3300050507 Bacteria 7361
282 nmdc:mga09592_34056_c1 3300050508 Bacteria 4257
283 nmdc:mga0qj67_184646_c1 3300050509 Bacteria 1694
284 nmdc:mga0qj67_53808_c1 3300050509 Bacteria 3187
285 nmdc:mga06r32_1204162_c1 3300050510 Bacteria 704
286 nmdc:mga06r32_74135_c1 3300050510 Bacteria 3298
287 nmdc:mga08y16_54800_c1 3300050511 Bacteria 4167
288 nmdc:mga0rr50_384479_c1 3300050513 Bacteria 1184
289 nmdc:mga0rr50_99169_c1 3300050513 Bacteria 2285
290 nmdc:mga0sz30_14063_c1 3300050516 Bacteria 3143
291 Ga0495601_0021312 3300053077 Bacteria 3968
292 Ga0495601_0040320 3300053077 Bacteria 2925
293 Ga0495601_0163638 3300053077 Bacteria 1454
294 Ga0495612_0001042 3300053078 Bacteria 11344
295 Ga0495595_0000719 3300053084 Bacteria 12613
296 Ga0495595_0034371 3300053084 Bacteria 2292
297 Ga0495619_0000431 3300053085 Bacteria 28460
298 Ga0495619_0022450 3300053085 Bacteria 4039
299 Ga0500595_015101 3300053119 Bacteria 2905
300 Ga0501084_0113706 3300054114 Bacteria 2275
301 Ga0501082_0002418 3300060353 Bacteria 16386
302 Ga0530510_0034130 3300061734 Bacteria 3664
303 Ga0500555_000822
304 JGI25405J52794_10035237
305 Ga0070670_100398633
306 Ga0068869_100105176
307 Ga0070666_10608311
308 Ga0070682_100034728
309 Ga0070689_100538513
310 Ga0070689_100874400
311 Ga0070668_100051131
312 Ga0070674_100104430
313 Ga0070673_100072243
314 Ga0070659_100016128
315 Ga0070659_100736324
316 Ga0070714_100412378
317 Ga0070713_100797743
318 Ga0070710_10148223
319 Ga0070711_100120510
320 Ga0070708_100497375
321 Ga0070678_100571870
322 Ga0070681_10068850
323 Ga0068867_100149686
324 Ga0070685_10127459
325 Ga0070706_100692774
326 Ga0070707_100012308
327 Ga0070698_100083072
328 Ga0070698_100116390
329 Ga0070699_100187311
330 Ga0070679_100081996
331 Ga0070679_100338767
332 Ga0070679_101109133
333 Ga0068853_100014659
334 Ga0070693_100011192
335 Ga0068855_100107385
336 Ga0068857_100103277
337 Ga0068857_100658400
338 Ga0070702_100264504
339 Ga0068859_100137211
340 Ga0068864_100322779
341 Ga0068861_100257463
342 Ga0068861_100788109
343 Ga0068863_100408789
344 Ga0081455_10007979
345 Ga0081539_10174901
346 Ga0070717_10064117
347 Ga0070717_10408305
348 Ga0075368_10212328
349 Ga0075363_100114925
350 Ga0075363_100248033
351 Ga0070715_10083754
352 Ga0070712_100138530
353 Ga0070712_100166239
354 Ga0070712_100287707
355 Ga0075362_10013881
356 Ga0075362_10088499
357 Ga0075366_10066476
358 Ga0075366_10134519
359 Ga0075430_100095828
360 Ga0075431_100243250
361 Ga0075433_10515608
362 Ga0075434_100020462
363 Ga0075434_100026349
364 Ga0097620_100137233
365 Ga0075435_100050684
366 Ga0105240_10576789
367 Ga0111539_10023989
368 Ga0105245_10028661
369 Ga0105247_10064309
370 Ga0114129_10317334
371 Ga0105243_10110495
372 Ga0105243_10214550
373 Ga0105241_10334085
374 Ga0105241_10361147
375 Ga0105248_11640331
376 Ga0105237_10139393
377 Ga0105237_10283944
378 Ga0105237_10404930
379 Ga0105237_10941431
380 Ga0105238_10072413
381 Ga0105238_10277992
382 Ga0105238_10749371
383 Ga0105238_11138058
384 Ga0105249_11620720
385 Ga0105239_10191985
386 Ga0105239_10737951
387 Ga0105246_10093156
388 Ga0157373_10211803
389 Ga0157370_10623277
390 Ga0157378_10040107
391 Ga0157372_10013752
392 Ga0157372_10266766
393 Ga0157375_11803075
394 Ga0163163_10563683
395 Ga0157379_10269933
396 Ga0163161_10157095
397 Ga0213876_10015098
398 Ga0207710_10053560
399 Ga0207684_10662121
400 Ga0207654_10239763
401 Ga0207654_10246783
402 Ga0207707_10108707
403 Ga0207707_10847486
404 Ga0207693_10026627
405 Ga0207693_10214704
406 Ga0207663_10128408
407 Ga0207652_10020032
408 Ga0207652_10164178
409 Ga0207652_10508607
410 Ga0207646_10007906
411 Ga0207687_10066082
412 Ga0207690_10090216
413 Ga0207706_10141007
414 Ga0207689_10100139
415 Ga0207667_10101539
416 Ga0207651_10092960
417 Ga0207712_10495706
418 Ga0207668_10141397
419 Ga0207668_10909581
420 Ga0207658_10067881
421 Ga0207639_10055942
422 Ga0207678_10169110
423 Ga0207641_10255856
424 Ga0207648_10173179
425 Ga0207674_10069706
426 Ga0207683_10648277
427 Ga0207698_11170893
428 Ga0209969_1022005
429 Ga0209813_10103219
430 Ga0268266_10000508
431 Ga0268266_10258297
432 Ga0268265_11129567
433 Ga0265325_10050444
434 Ga0265339_10039200
435 Ga0265331_10018752
436 Ga0265331_10031047
437 Ga0307513_10091903
438 Ga0265313_10022890
439 Ga0307508_10119366
440 Ga0316575_10050584
441 Ga0316579_10002462
442 Ga0316576_10016751
443 Ga0307405_10524182
444 Ga0316577_10342220
445 Ga0307406_10386627
446 Ga0307416_100065244
447 Ga0316583_10022612
448 Ga0373934_0000062
449 Ga0373923_0214473
450 Ga0373953_0006003
451 Ga0373953_0013252
452 Ga0373954_0020127
453 Ga0373956_0000016
454 Ga0373956_0030500
455 Ga0373957_0054588
456 Ga0373924_0041282
457 Ga0373931_0116749
458 Ga0373935_0041130
459 Ga0373927_0036837
460 Ga0373927_0123538
461 Ga0373933_0002271
462 Ga0373933_0025648
463 Ga0373947_0033940
464 Ga0373947_0082217
465 Ga0373947_0141633
466 Ga0373937_0002427
467 Ga0373937_0004022
468 Ga0373937_0522680
469 Ga0373937_0832754
470 Ga0316582_0024290
471 Ga0316584_0055471
472 Ga0373925_0021025
473 Ga0373925_0202783
474 Ga0395899_0003955
475 Ga0395899_0042172
476 Ga0395900_0002788
477 Ga0395898_0003037
478 Ga0395898_0015423
479 Ga0316581_0009286
480 Ga0436364_1460237
481 Ga0395901_0003727
482 Ga0436365_0276782
483 Ga0436363_1641747
484 Ga0451800_0068175
485 Ga0439448_0133121
486 Ga0450902_001695
487 Ga0450905_000194
488 Ga0439459_0042148
489 Ga0439464_0162021
490 Ga0450901_001773
491 Ga0466963_0071798
492 Ga0466963_0090683
493 Ga0466964_0324045
494 Ga0466957_0040629
495 Ga0466957_0094064
496 Ga0451576_0175750
497 Ga0466967_0482528
498 Ga0495592_0001653
499 Ga0495592_0546202
500 Ga0495629_0060489
501 Ga0495651_0000851
502 Ga0495651_0002582
503 Ga0495651_0152649
504 Ga0495653_0029526
505 Ga0495608_0005525
506 Ga0495608_0196720
507 Ga0495618_0000969
508 Ga0495628_0019981
509 Ga0495630_0074774
510 Ga0495652_0001428
511 Ga0495652_0329865
512 Ga0495640_0002306
513 Ga0495587_0000553
514 Ga0495598_0007805
515 Ga0495645_0023772
516 Ga0495667_0002294
517 Ga0495634_0026347
518 Ga0495634_0100605
519 Ga0495634_0130563
520 Ga0495635_0014171
521 Ga0495657_0047557
522 Ga0495657_0167684
523 Ga0495599_0024095
524 Ga0495623_0001878
525 Ga0495658_0100485
526 Ga0495613_0215417
527 Ga0495624_0517942
528 Ga0495600_0262222
529 Ga0495581_0027866
530 Ga0495604_0000445
531 Ga0495674_0008941
532 Ga0495674_0491620
533 Ga0495672_0237708
534 Ga0495676_0035976
535 Ga0495680_0028318
536 Ga0495680_0204455
537 Ga0495675_0006303
538 Ga0495685_080754
539 Ga0495684_0180475
540 Ga0495602_0006632
541 Ga0495615_0057044
542 Ga0496101_0132643
543 Ga0496102_0648792
544 Ga0496102_0846282
545 Ga0496104_0000588
546 Ga0496104_0233016
547 Ga0496105_0006806
548 Ga0496109_0150914
549 Ga0496110_0134595
550 Ga0496111_0525256
551 Ga0496112_0187554
552 Ga0496113_0085023
553 Ga0496115_0529726
554 Ga0496118_0045273
555 Ga0501033_0161505
556 Ga0501037_0261193
557 Ga0501039_0035775
558 Ga0501039_0071967
559 Ga0501039_0452976
560 Ga0501039_0537580
561 Ga0501040_0666207
562 Ga0501042_0195472
563 Ga0501046_0107913
564 Ga0501071_0112062
565 Ga0501071_0199498
566 Ga0501071_0224573
567 Ga0501072_0001644
568 Ga0501072_0121034
569 Ga0501072_0344179
570 Ga0501076_0253538
571 Ga0501076_0529404
572 Ga0501079_0021691
573 Ga0501079_0443509
574 Ga0501080_0186817
575 Ga0501081_0172611
576 Ga0501045_0379052
577 nmdc:mga03683_182652_c1
578 nmdc:mga03683_45874_c1
579 nmdc:mga03n38_13853_c1
580 nmdc:mga03n38_231877_c1
581 nmdc:mga0k408_108330_c1
582 nmdc:mga0k408_267502_c1
583 nmdc:mga05p37_24316_c1
584 nmdc:mga09592_34056_c1
585 nmdc:mga0qj67_184646_c1
586 nmdc:mga0qj67_53808_c1
587 nmdc:mga06r32_1204162_c1
588 nmdc:mga06r32_74135_c1
589 nmdc:mga08y16_54800_c1
590 nmdc:mga0rr50_384479_c1
591 nmdc:mga0rr50_99169_c1
592 nmdc:mga0sz30_14063_c1
593 Ga0495601_0021312
594 Ga0495601_0040320
595 Ga0495601_0163638
596 Ga0495612_0001042
597 Ga0495595_0000719
598 Ga0495595_0034371
599 Ga0495619_0000431
600 Ga0495619_0022450
601 Ga0500595_015101
602 Ga0501084_0113706
603 Ga0501082_0002418
604 Ga0530510_0034130

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

135

220

0.92

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

28

104

0.88

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

32

111

0.88

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

38

105

0.87

PF14497

GST_C_3

Glutathione S-transferase, C-terminal domain

136

224

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3m3m-assembly1.cif.gz_A crystal structure of glutathione s-transferase from pseudomonas fluorescens [pf-5] 0.9263 2 200
3m8n-assembly1.cif.gz_A crystal structure of a possible gutathione s-tranferase from rhodopseudomonas palustris 0.9165 2 207
3m8n-assembly1.cif.gz_A crystal structure of a possible gutathione s-tranferase from rhodopseudomonas palustris 0.9122 2 207
3m8n-assembly1.cif.gz_B crystal structure of a possible gutathione s-tranferase from rhodopseudomonas palustris 0.9096 2 207
3m8n-assembly2.cif.gz_D crystal structure of a possible gutathione s-tranferase from rhodopseudomonas palustris 0.9082 2 207
ID Description Score Start End Superfamily
4yh2C01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9375 4 79 3.40.30.10
af_A0A1D6HAW8_13_80_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9314 7 73 3.40.30.10
af_Q8MRM0_3_82_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9258 3 79 3.40.30.10
3zmkC01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9234 4 79 3.40.30.10
af_Q9VHD2_18_96_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9234 7 79 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A6J4P5P9-F1-model_v4 Maleylacetoacetate isomerase / Glutathione S-transferase (EC 5.2.1.2) 0.9822 67 208 GO:0016034
GO:0016740
AF-A0A257LR51-F1-model_v4 Glutathione S-transferase 0.9791 5 208 GO:0016740
AF-A0A512NPG9-F1-model_v4 Glutathione S-transferase 0.9761 1 206 GO:0016740
AF-A0A7T7Y4T2-F1-model_v4 deleted 0.9758 1 207
AF-A0A4V1VAY0-F1-model_v4 deleted 0.9755 3 208

Map