F396670

General Info

Members Datasets Scaffolds Average Seq Length
302 188 253 280

Family's Representative Sequence

Representative Sequence 3300046538|Ga0495609_0000014|Ga0495609_0000014_15768_16706
Length 312
Sequence MEFKFHSHQECLIAKTLQKQKPQEPPMSAALDLSSSFAGRYYIVTGSTQGLGAAVALTLAQRGAAGLIICGRSRDKGEQQARQLSELGCQVHFVQADMENVDDCRRVVAAAKQHFGTVHGLVNCAGMSDRGSILDTSPELFDRIFAVNVRAPFFLMQDTLKLMIAGGVEGAIVNIQSVSGHGGQSFLSAYASSKGALTILTKNVAFSALHNRIRVNGLNIGWMDTPHEDEIQRKYHGAGDDWLSTAEAKSPFGRLLKPQEVADSVAFLLSDQSGMMTGSVIDLEQGVFGCGDGSTPRPDAPLTLKAANGAGR

Samples

Sample ID Description Type Environment
1 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
2 2506520008 Serratia plymuthica AS12 Isolate Unclassified
3 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
4 2511231021 Pseudomonas sp. GM78 Isolate Nodule
5 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
6 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
7 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
8 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
9 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
10 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
11 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
12 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
13 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
14 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
15 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
16 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
17 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
18 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
19 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
20 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
21 2643221610 Ensifer sp. Root74 Isolate Unclassified
22 2643221618 Ensifer sp. Root231 Isolate Unclassified
23 2643221629 Devosia sp. Root105 Isolate Unclassified
24 2643221662 Devosia sp. Root413D1 Isolate Unclassified
25 2643221675 Ensifer sp. Root1298 Isolate Unclassified
26 2643221680 Ensifer sp. Root1312 Isolate Unclassified
27 2643221688 Rhizobium sp. Root482 Isolate Unclassified
28 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
29 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
30 2643221726 Ensifer sp. Root954 Isolate Unclassified
31 2643221733 Bosea sp. Root381 Isolate Unclassified
32 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
33 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
34 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
35 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
36 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
37 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
38 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
39 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
40 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
41 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
42 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
43 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
44 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
45 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
46 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
47 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
48 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
49 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
50 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
51 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
52 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
53 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
54 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
55 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
56 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
57 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
58 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
59 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
60 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
61 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
62 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
77 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
78 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
79 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
91 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
94 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
95 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
107 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
108 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
109 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
110 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
111 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
112 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
115 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
116 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
117 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
118 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
119 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
120 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
121 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
122 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
123 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
124 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
125 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
126 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
127 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
128 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
129 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
130 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
131 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
132 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
133 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
134 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
135 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
136 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
137 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
138 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
139 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
140 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
141 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
142 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
143 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
144 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
145 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
146 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
147 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
148 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
149 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
150 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
151 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
152 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
155 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
156 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
157 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
158 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
159 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
160 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
161 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
162 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
163 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
164 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
165 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
166 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
167 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
168 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
170 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
171 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
172 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
173 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
174 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
175 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
176 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
177 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
178 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
179 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
180 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
181 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
182 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
183 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
184 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
185 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
186 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
187 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
188 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.77
Metatranscriptomes 0
Isolates 16.23

Biome Distribution

Category Percentage (%)
Aerial Root 0.33
Bulb 0
Endosphere 13.25
Nodule 2.98
Rhizoplane 3.31
Rhizosphere 60.26
Stem 0
Stem Tuber 0
Unclassified 19.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1001329 3300002705 Bacteria 10658
2 JGI25158J39367_1000032 3300002739 Bacteria 30976
3 JGI25157J39369_1000053 3300002741 Bacteria 110228
4 JGI25152J39213_1005339 3300002773 Bacteria 3777
5 JGI25152J39213_1010253 3300002773 Bacteria 2160
6 JGI25159J45721_1000007 3300002987 Bacteria 176362
7 JGI25159J45721_1000276 3300002987 Bacteria 24129
8 JGI25151J46595_10023367 3300003187 Bacteria 2547
9 JGI25153J46596_10010883 3300003215 Bacteria 4071
10 rootH2_10031613 3300003320 Bacteria 4270
11 Ga0055524_1000494 3300003775 Bacteria 30914
12 Ga0065712_10073562 3300005290 Bacteria 4347
13 Ga0070709_10087314 3300005434 Bacteria 2049
14 Ga0070708_100433753 3300005445 Bacteria 1239
15 Ga0070662_100001139 3300005457 Bacteria 16278
16 Ga0070707_100008824 3300005468 Bacteria 9348
17 Ga0070699_100021831 3300005518 Bacteria 5518
18 Ga0068853_100002210 3300005539 Bacteria 14530
19 Ga0070665_100166001 3300005548 Bacteria 2210
20 Ga0068851_10000338 3300005834 Bacteria 21202
21 Ga0075365_10016760 3300006038 Bacteria 4466
22 Ga0075365_10034642 3300006038 Bacteria 3261
23 Ga0075365_10099878 3300006038 Bacteria 1986
24 Ga0075365_10139281 3300006038 Bacteria 1684
25 Ga0075368_10008124 3300006042 Bacteria 3726
26 Ga0075363_100091098 3300006048 Bacteria 1678
27 Ga0075363_100100630 3300006048 Bacteria 1599
28 Ga0075364_10004542 3300006051 Bacteria 7993
29 Ga0075364_10156664 3300006051 Bacteria 1536
30 Ga0075364_10208509 3300006051 Bacteria 1325
31 Ga0075364_10245827 3300006051 Bacteria 1216
32 Ga0075369_10022188 3300006186 Bacteria 2616
33 Ga0075370_10076726 3300006353 Bacteria 1917
34 Ga0075370_10196992 3300006353 Bacteria 1188
35 Ga0075430_100314563 3300006846 Bacteria 1295
36 Ga0075433_10002480 3300006852 Bacteria 14037
37 Ga0075434_100113475 3300006871 Bacteria 2722
38 Ga0075434_100197541 3300006871 Bacteria 2031
39 Ga0075429_100195107 3300006880 Bacteria 1773
40 Ga0099795_10008085 3300007788 Bacteria 2979
41 Ga0105251_10000001 3300009011 Bacteria 466643
42 Ga0105251_10000292 3300009011 Bacteria 50581
43 Ga0105251_10000966 3300009011 Bacteria 25549
44 Ga0105251_10009223 3300009011 Bacteria 5849
45 Ga0105244_10001777 3300009036 Bacteria 16927
46 Ga0105244_10004704 3300009036 Bacteria 9295
47 Ga0105244_10017659 3300009036 Bacteria 4027
48 Ga0105244_10043783 3300009036 Bacteria 2307
49 Ga0105250_10000088 3300009092 Bacteria 80904
50 Ga0105250_10009771 3300009092 Bacteria 4027
51 Ga0105240_10001849 3300009093 Bacteria 35407
52 Ga0105240_10007209 3300009093 Bacteria 16191
53 Ga0099796_10143590 3300010159 Bacteria 935
54 Ga0105239_10141139 3300010375 Bacteria 2684
55 Ga0105246_10000279 3300011119 Bacteria 26696
56 Ga0105246_10000765 3300011119 Bacteria 18300
57 Ga0157373_10025573 3300013100 Bacteria 4269
58 Ga0157369_10064588 3300013105 Bacteria 3941
59 Ga0171463_1008 3300013249 Bacteria 299022
60 Ga0157372_10193459 3300013307 Bacteria 2356
61 Ga0157375_10000050 3300013308 Bacteria 134913
62 Ga0182008_10000598 3300014497 Bacteria 26495
63 Ga0182005_1036109 3300015265 Bacteria 1344
64 Ga0183363_1260 3300015690 Bacteria 8635
65 Ga0163161_10009003 3300017792 Bacteria 6903
66 Ga0163161_10023587 3300017792 Bacteria 4342
67 Ga0163161_10046384 3300017792 Bacteria 3135
68 Ga0163161_10151008 3300017792 Bacteria 1766
69 Ga0163161_10169079 3300017792 Bacteria 1670
70 Ga0214544_1000691 3300021320 Bacteria 64943
71 Ga0209026_1000002 3300025250 Bacteria 1136158
72 Ga0209759_1000179 3300025256 Bacteria 105045
73 Ga0207656_10000156 3300025321 Bacteria 25322
74 Ga0207696_1000091 3300025711 Bacteria 187999
75 Ga0207696_1007537 3300025711 Bacteria 4248
76 Ga0207655_1000037 3300025728 Bacteria 354473
77 Ga0207655_1010605 3300025728 Bacteria 5572
78 Ga0207655_1048720 3300025728 Bacteria 1736
79 Ga0207713_1000002 3300025735 Bacteria 1061749
80 Ga0207713_1000117 3300025735 Bacteria 129339
81 Ga0207713_1000345 3300025735 Bacteria 50910
82 Ga0207713_1000569 3300025735 Bacteria 36636
83 Ga0207713_1004863 3300025735 Bacteria 8611
84 Ga0207699_10155227 3300025906 Bacteria 1518
85 Ga0207695_10022442 3300025913 Bacteria 7162
86 Ga0207706_10000935 3300025933 Bacteria 29879
87 Ga0207639_10002914 3300026041 Bacteria 11506
88 Ga0209371_1000033 3300027312 Bacteria 381084
89 Ga0209179_1002505 3300027512 Bacteria 2494
90 Ga0307515_10235212 3300028794 Bacteria 1615
91 Ga0268256_1005932 3300030500 Bacteria 4670
92 Ga0307513_10066345 3300031456 Bacteria 3793
93 Ga0307408_100358243 3300031548 Bacteria 1240
94 Ga0307516_10010979 3300031730 Bacteria 9900
95 Ga0307405_10000958 3300031731 Bacteria 11551
96 Ga0307412_10320962 3300031911 Bacteria 1232
97 Ga0307412_10554601 3300031911 Unclassified 966
98 Ga0307416_100141069 3300032002 Bacteria 2190
99 Ga0439466_0005212 3300041411 Bacteria 4974
100 Ga0439463_012328 3300042016 Bacteria 2101
101 Ga0450898_000679 3300042134 Bacteria 4100
102 Ga0450899_003032 3300042135 Bacteria 1810
103 Ga0466967_0189319 3300045976 Bacteria 1944
104 Ga0495627_003174 3300046453 Bacteria 7403
105 Ga0495591_001248 3300046458 Bacteria 16341
106 Ga0495591_002680 3300046458 Bacteria 9664
107 Ga0495591_015955 3300046458 Bacteria 2634
108 Ga0495638_0004333 3300046460 Bacteria 10755
109 Ga0495650_0000034 3300046471 Bacteria 410132
110 Ga0495650_0003554 3300046471 Bacteria 11281
111 Ga0495605_0000001 3300046474 Bacteria 614538
112 Ga0495605_0007127 3300046474 Bacteria 6363
113 Ga0495605_0044252 3300046474 Bacteria 2202
114 Ga0495584_0054490 3300046491 Bacteria 2013
115 Ga0495607_0000018 3300046501 Bacteria 167673
116 Ga0495607_0002243 3300046501 Bacteria 15953
117 Ga0495607_0003863 3300046501 Bacteria 11286
118 Ga0495607_0004950 3300046501 Bacteria 9674
119 Ga0495607_0094209 3300046501 Bacteria 1616
120 Ga0495583_0000651 3300046506 Bacteria 45809
121 Ga0495583_0002032 3300046506 Bacteria 18425
122 Ga0495583_0002095 3300046506 Bacteria 17997
123 Ga0495583_0003281 3300046506 Bacteria 12567
124 Ga0495606_0000794 3300046507 Bacteria 48239
125 Ga0495606_0001255 3300046507 Bacteria 35408
126 Ga0495606_0001289 3300046507 Bacteria 34720
127 Ga0495606_0010536 3300046507 Bacteria 7655
128 Ga0495610_0000940 3300046512 Bacteria 27024
129 Ga0495610_0006348 3300046512 Bacteria 8167
130 Ga0495610_0029805 3300046512 Bacteria 2867
131 Ga0495610_0042704 3300046512 Bacteria 2265
132 Ga0495616_0093394 3300046513 Bacteria 1421
133 Ga0495620_0000265 3300046515 Bacteria 38741
134 Ga0495620_0001338 3300046515 Bacteria 14966
135 Ga0495620_0012368 3300046515 Bacteria 4413
136 Ga0495631_0008440 3300046518 Bacteria 5191
137 Ga0495632_0001475 3300046519 Bacteria 19528
138 Ga0495632_0003819 3300046519 Bacteria 10482
139 Ga0495637_0000202 3300046520 Bacteria 46505
140 Ga0495637_0015082 3300046520 Bacteria 3632
141 Ga0495637_0016112 3300046520 Bacteria 3497
142 Ga0495643_0035759 3300046522 Bacteria 2733
143 Ga0495644_0003896 3300046523 Bacteria 5874
144 Ga0495644_0010079 3300046523 Bacteria 3641
145 Ga0495648_0002590 3300046524 Bacteria 16563
146 Ga0495648_0007696 3300046524 Bacteria 8589
147 Ga0495648_0011783 3300046524 Bacteria 6561
148 Ga0495648_0014774 3300046524 Bacteria 5690
149 Ga0495648_0023812 3300046524 Bacteria 4183
150 Ga0495654_0000119 3300046530 Bacteria 88217
151 Ga0495654_0000549 3300046530 Bacteria 30258
152 Ga0495654_0003370 3300046530 Bacteria 9843
153 Ga0495654_0004292 3300046530 Bacteria 8504
154 Ga0495654_0017249 3300046530 Bacteria 3799
155 Ga0495654_0071813 3300046530 Bacteria 1639
156 Ga0495609_0000014 3300046538 Bacteria 326023
157 Ga0495609_0000067 3300046538 Bacteria 130284
158 Ga0495609_0059563 3300046538 Bacteria 1688
159 Ga0495622_0003196 3300046557 Bacteria 7760
160 Ga0495611_0000175 3300046648 Bacteria 46491
161 Ga0495611_0000950 3300046648 Bacteria 15530
162 Ga0495611_0007803 3300046648 Bacteria 4545
163 Ga0495661_0000010 3300046665 Bacteria 284261
164 Ga0495661_0000051 3300046665 Bacteria 140353
165 Ga0495661_0000191 3300046665 Bacteria 71123
166 Ga0495661_0000698 3300046665 Bacteria 33395
167 Ga0495670_0101875 3300046691 Bacteria 1479
168 Ga0495671_0000586 3300046692 Bacteria 26926
169 Ga0495589_0000377 3300046794 Bacteria 34084
170 Ga0495589_0007570 3300046794 Bacteria 5689
171 Ga0495660_0000020 3300046810 Bacteria 304768
172 Ga0495672_0000011 3300047320 Bacteria 535362
173 Ga0495672_0046669 3300047320 Bacteria 2582
174 Ga0495676_0000006 3300047321 Bacteria 280508
175 Ga0495676_0043269 3300047321 Bacteria 3688
176 Ga0495683_0009392 3300047323 Bacteria 5211
177 Ga0495683_0018762 3300047323 Bacteria 3573
178 Ga0495679_000226 3300047446 Bacteria 47732
179 Ga0495679_000427 3300047446 Bacteria 31171
180 Ga0495679_001677 3300047446 Bacteria 12308
181 Ga0495679_008977 3300047446 Bacteria 4031
182 Ga0495673_0000020 3300047469 Bacteria 548327
183 Ga0495673_0000279 3300047469 Bacteria 69195
184 Ga0495673_0006065 3300047469 Bacteria 7177
185 Ga0495673_0007161 3300047469 Bacteria 6455
186 Ga0495673_0024340 3300047469 Bacteria 2928
187 Ga0495686_0007049 3300047472 Bacteria 8478
188 Ga0496101_0100854 3300048904 Bacteria 2160
189 Ga0496104_0375255 3300048907 Bacteria 1335
190 Ga0496116_0000129 3300048919 Bacteria 158284
191 Ga0496116_0047481 3300048919 Bacteria 2889
192 Ga0496117_0000153 3300048920 Bacteria 147065
193 Ga0496117_0007078 3300048920 Bacteria 11091
194 Ga0496117_0009688 3300048920 Bacteria 8907
195 Ga0496117_0020499 3300048920 Bacteria 5386
196 Ga0496118_0000269 3300048921 Bacteria 91110
197 Ga0496118_0030106 3300048921 Bacteria 4539
198 Ga0496119_0002224 3300048922 Bacteria 21627
199 Ga0496119_0006413 3300048922 Bacteria 10913
200 Ga0496119_0019177 3300048922 Bacteria 5052
201 Ga0496120_0000010 3300048923 Bacteria 385791
202 Ga0496120_0000024 3300048923 Bacteria 236853
203 Ga0496120_0004700 3300048923 Bacteria 11265
204 Ga0496120_0030834 3300048923 Bacteria 3254
205 Ga0496121_0000055 3300048924 Bacteria 304572
206 Ga0496121_0005397 3300048924 Bacteria 16415
207 Ga0496121_0017703 3300048924 Bacteria 7253
208 Ga0496122_0000327 3300048925 Bacteria 103468
209 Ga0496122_0005708 3300048925 Bacteria 14671
210 Ga0496122_0028631 3300048925 Bacteria 4720
211 Ga0496122_0030429 3300048925 Bacteria 4522
212 Ga0496123_0000115 3300048926 Bacteria 163097
213 Ga0496123_0001974 3300048926 Bacteria 26588
214 Ga0496123_0009858 3300048926 Bacteria 8530
215 Ga0496123_0130931 3300048926 Bacteria 1390
216 Ga0496124_0054486 3300048927 Bacteria 3384
217 Ga0496125_0000245 3300048928 Bacteria 111310
218 Ga0496125_0001265 3300048928 Bacteria 37668
219 Ga0496125_0004266 3300048928 Bacteria 16636
220 Ga0496125_0024665 3300048928 Bacteria 5524
221 Ga0496126_0015283 3300048929 Bacteria 7727
222 Ga0496126_0079521 3300048929 Bacteria 2902
223 Ga0495678_000072 3300049459 Bacteria 128270
224 Ga0495678_001747 3300049459 Bacteria 16132
225 Ga0495682_0000022 3300049460 Bacteria 183265
226 Ga0495682_0000361 3300049460 Bacteria 33190
227 Ga0501298_036534 3300049521 Bacteria 983
228 Ga0501034_0016771 3300049571 Bacteria 7510
229 Ga0501034_0045800 3300049571 Bacteria 4419
230 Ga0501280_002468 3300049776 Bacteria 3068
231 nmdc:mga03683_133830_c1 3300050489 Bacteria 1111
232 nmdc:mga03683_95628_c1 3300050489 Bacteria 1300
233 nmdc:mga03n38_36108_c1 3300050490 Bacteria 2123
234 nmdc:mga00v17_295945_c1 3300050491 Bacteria 1051
235 nmdc:mga00v17_41137_c1 3300050491 Bacteria 2775
236 nmdc:mga00v17_77138_c1 3300050491 Bacteria 2074
237 nmdc:mga0yw44_16822_c1 3300050492 Bacteria 3962
238 nmdc:mga0yw44_210170_c1 3300050492 Unclassified 1287
239 nmdc:mga07m45_98387_c1 3300050496 Bacteria 1095
240 nmdc:mga05p37_126170_c1 3300050507 Bacteria 3143
241 nmdc:mga0qj67_255252_c1 3300050509 Bacteria 1422
242 nmdc:mga0n895_195061_c1 3300050512 Bacteria 2056
243 nmdc:mga0n895_197526_c1 3300050512 Unclassified 2043
244 nmdc:mga0a205_2412_c1 3300050515 Bacteria 16485
245 Ga0500556_0000452 3300053104 Bacteria 29198
246 Ga0500556_0001244 3300053104 Bacteria 11774
247 Ga0500618_000521 3300053125 Bacteria 24233
248 Ga0500621_000009 3300053126 Bacteria 173209
249 Ga0500559_0092276 3300053136 Bacteria 1387
250 Ga0500568_0071581 3300053139 Bacteria 1327
251 Ga0500616_0014844 3300053153 Bacteria 4465
252 Ga0500622_0000548 3300053156 Bacteria 34530
253 Ga0500634_0000568 3300053161 Bacteria 12224

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049571 Ga0501034_0016771 Ga0501034_0016771_3180_4007 233
2 3300009093 Ga0105240_10007209 Ga0105240_100072096 236
3 3300025913 Ga0207695_10022442 Ga0207695_100224428 236
4 3300027512 Ga0209179_1002505 Ga0209179_10025052 250
5 3300007788 Ga0099795_10008085 Ga0099795_100080853 252
6 3300050512 nmdc:mga0n895_197526_c1 nmdc:mga0n895_197526_c1_722_1483 252
7 iso_pu_bacteria 2643221697 2644536908 252
8 iso_pu_bacteria 2984592036 2984594155 252
9 3300005434 Ga0070709_10087314 Ga0070709_100873142 258
10 3300005539 Ga0068853_100002210 Ga0068853_1000022108 258
11 3300009036 Ga0105244_10043783 Ga0105244_100437832 258
12 3300025906 Ga0207699_10155227 Ga0207699_101552272 258
13 3300026041 Ga0207639_10002914 Ga0207639_100029146 258
14 3300048907 Ga0496104_0375255 Ga0496104_0375255_218_1000 258
15 iso_pu_bacteria 2643221733 2644730336 258
16 3300003320 rootH2_10031613 rootH2_100316133 259
17 3300028794 Ga0307515_10235212 Ga0307515_102352122 262
18 3300006871 Ga0075434_100113475 Ga0075434_1001134753 264
19 3300049571 Ga0501034_0045800 Ga0501034_0045800_1968_2777 264
20 3300031911 Ga0307412_10554601 Ga0307412_105546011 265
21 3300053104 Ga0500556_0001244 Ga0500556_0001244_7675_8478 265
22 iso_pu_bacteria 2643221610 2644067662 265
23 iso_pu_bacteria 2643221675 2644418716 265
24 iso_pu_bacteria 2643221680 2644452082 265
25 iso_pu_bacteria 2643221726 2644690845 265
26 3300009093 Ga0105240_10001849 Ga0105240_100018497 266
27 3300006846 Ga0075430_100314563 Ga0075430_1003145632 267
28 3300006852 Ga0075433_10002480 Ga0075433_100024803 267
29 3300006871 Ga0075434_100197541 Ga0075434_1001975412 267
30 3300006880 Ga0075429_100195107 Ga0075429_1001951072 267
31 3300049521 Ga0501298_036534 Ga0501298_036534_135_950 267
32 3300050507 nmdc:mga05p37_126170_c1 nmdc:mga05p37_126170_c1_1334_2212 267
33 3300050509 nmdc:mga0qj67_255252_c1 nmdc:mga0qj67_255252_c1_326_1141 267
34 3300050512 nmdc:mga0n895_195061_c1 nmdc:mga0n895_195061_c1_955_1833 267
35 3300050515 nmdc:mga0a205_2412_c1 nmdc:mga0a205_2412_c1_14522_15400 267
36 3300053153 Ga0500616_0014844 Ga0500616_0014844_1301_2146 267
37 iso_pu_bacteria 2937822353 2937828000 267
38 3300002739 JGI25158J39367_1000032 JGI25158J39367_100003213 268
39 3300002773 JGI25152J39213_1005339 JGI25152J39213_10053393 268
40 3300002773 JGI25152J39213_1010253 JGI25152J39213_10102532 268
41 3300002987 JGI25159J45721_1000007 JGI25159J45721_100000728 268
42 3300002987 JGI25159J45721_1000276 JGI25159J45721_10002766 268
43 3300003187 JGI25151J46595_10023367 JGI25151J46595_100233672 268
44 3300003215 JGI25153J46596_10010883 JGI25153J46596_100108832 268
45 3300003775 Ga0055524_1000494 Ga0055524_100049417 268
46 3300005457 Ga0070662_100001139 Ga0070662_1000011396 268
47 3300005834 Ga0068851_10000338 Ga0068851_1000033810 268
48 3300006038 Ga0075365_10016760 Ga0075365_100167604 268
49 3300006038 Ga0075365_10099878 Ga0075365_100998782 268
50 3300006038 Ga0075365_10139281 Ga0075365_101392812 268
51 3300006042 Ga0075368_10008124 Ga0075368_100081243 268
52 3300006048 Ga0075363_100091098 Ga0075363_1000910982 268
53 3300006048 Ga0075363_100100630 Ga0075363_1001006302 268
54 3300006051 Ga0075364_10004542 Ga0075364_100045426 268
55 3300006051 Ga0075364_10156664 Ga0075364_101566642 268
56 3300006353 Ga0075370_10076726 Ga0075370_100767262 268
57 3300006353 Ga0075370_10196992 Ga0075370_101969921 268
58 3300009011 Ga0105251_10000966 Ga0105251_1000096622 268
59 3300010159 Ga0099796_10143590 Ga0099796_101435901 268
60 3300010375 Ga0105239_10141139 Ga0105239_101411395 268
61 3300013100 Ga0157373_10025573 Ga0157373_100255733 268
62 3300013249 Ga0171463_1008 Ga0171463_1008253 268
63 3300014497 Ga0182008_10000598 Ga0182008_1000059814 268
64 3300015690 Ga0183363_1260 Ga0183363_12604 268
65 3300021320 Ga0214544_1000691 Ga0214544_100069120 268
66 3300025321 Ga0207656_10000156 Ga0207656_1000015613 268
67 3300025735 Ga0207713_1004863 Ga0207713_10048633 268
68 3300025933 Ga0207706_10000935 Ga0207706_1000093518 268
69 3300031456 Ga0307513_10066345 Ga0307513_100663452 268
70 3300042016 Ga0439463_012328 Ga0439463_012328_454_1344 268
71 3300045976 Ga0466967_0189319 Ga0466967_0189319_884_1693 268
72 3300046519 Ga0495632_0001475 Ga0495632_0001475_12712_13533 268
73 3300046522 Ga0495643_0035759 Ga0495643_0035759_1323_2144 268
74 3300046530 Ga0495654_0017249 Ga0495654_0017249_1166_2074 268
75 3300047472 Ga0495686_0007049 Ga0495686_0007049_4006_4827 268
76 3300048920 Ga0496117_0007078 Ga0496117_0007078_5782_6672 268
77 3300048922 Ga0496119_0006413 Ga0496119_0006413_4049_4939 268
78 3300048923 Ga0496120_0004700 Ga0496120_0004700_5815_6705 268
79 3300048924 Ga0496121_0017703 Ga0496121_0017703_2608_3513 268
80 3300048925 Ga0496122_0030429 Ga0496122_0030429_945_1835 268
81 3300048926 Ga0496123_0009858 Ga0496123_0009858_4141_5031 268
82 3300048927 Ga0496124_0054486 Ga0496124_0054486_506_1396 268
83 3300048928 Ga0496125_0004266 Ga0496125_0004266_5810_6700 268
84 3300050489 nmdc:mga03683_133830_c1 nmdc:mga03683_133830_c1_165_1001 268
85 3300050489 nmdc:mga03683_95628_c1 nmdc:mga03683_95628_c1_284_1120 268
86 3300050490 nmdc:mga03n38_36108_c1 nmdc:mga03n38_36108_c1_95_943 268
87 3300050491 nmdc:mga00v17_41137_c1 nmdc:mga00v17_41137_c1_1751_2599 268
88 3300050491 nmdc:mga00v17_77138_c1 nmdc:mga00v17_77138_c1_732_1568 268
89 3300050492 nmdc:mga0yw44_16822_c1 nmdc:mga0yw44_16822_c1_499_1347 268
90 3300050492 nmdc:mga0yw44_210170_c1 nmdc:mga0yw44_210170_c1_212_1060 268
91 3300050496 nmdc:mga07m45_98387_c1 nmdc:mga07m45_98387_c1_181_1029 268
92 3300053136 Ga0500559_0092276 Ga0500559_0092276_318_1154 268
93 3300053139 Ga0500568_0071581 Ga0500568_0071581_228_1064 268
94 3300053156 Ga0500622_0000548 Ga0500622_0000548_1434_2270 268
95 iso_pu_bacteria 2510917030 2511197323 268
96 iso_pu_bacteria 2513237103 2513710910 268
97 iso_pu_bacteria 2513237159 2513997176 268
98 iso_pu_bacteria 2524023209 2524459280 268
99 iso_pu_bacteria 2599185167 2599398566 268
100 iso_pu_bacteria 2599185179 2599450619 268
101 iso_pu_bacteria 2599185190 2599513050 268
102 iso_pu_bacteria 2599185191 2599520743 268
103 iso_pu_bacteria 2599185290 2599891727 268
104 iso_pu_bacteria 2643221618 2644107813 268
105 iso_pu_bacteria 2643221629 2644165071 268
106 iso_pu_bacteria 2643221662 2644345660 268
107 iso_pu_bacteria 2643221688 2644491718 268
108 iso_pu_bacteria 2842205361 2842208434 268
109 iso_pu_bacteria 2842509118 2842513755 268
110 iso_pu_bacteria 2852387548 2852395068 268
111 iso_pu_bacteria 2931390751 2931393699 268
112 iso_pu_bacteria 2945928738 2945933241 268
113 iso_pu_bacteria 8046767195 8046768944 268
114 iso_pu_bacteria 8057575449 8057576329 268
115 3300005290 Ga0065712_10073562 Ga0065712_100735624 270
116 3300006051 Ga0075364_10208509 Ga0075364_102085092 270
117 3300006051 Ga0075364_10245827 Ga0075364_102458271 270
118 3300009011 Ga0105251_10000001 Ga0105251_10000001205 270
119 3300009011 Ga0105251_10000292 Ga0105251_100002923 270
120 3300009011 Ga0105251_10009223 Ga0105251_100092233 270
121 3300009036 Ga0105244_10001777 Ga0105244_1000177712 270
122 3300009036 Ga0105244_10004704 Ga0105244_100047042 270
123 3300009036 Ga0105244_10017659 Ga0105244_100176592 270
124 3300009092 Ga0105250_10000088 Ga0105250_1000008841 270
125 3300009092 Ga0105250_10009771 Ga0105250_100097714 270
126 3300011119 Ga0105246_10000279 Ga0105246_100002795 270
127 3300011119 Ga0105246_10000765 Ga0105246_100007658 270
128 3300013105 Ga0157369_10064588 Ga0157369_100645883 270
129 3300013307 Ga0157372_10193459 Ga0157372_101934592 270
130 3300013308 Ga0157375_10000050 Ga0157375_10000050105 270
131 3300015265 Ga0182005_1036109 Ga0182005_10361092 270
132 3300017792 Ga0163161_10009003 Ga0163161_100090033 270
133 3300017792 Ga0163161_10023587 Ga0163161_100235873 270
134 3300017792 Ga0163161_10046384 Ga0163161_100463843 270
135 3300017792 Ga0163161_10151008 Ga0163161_101510082 270
136 3300017792 Ga0163161_10169079 Ga0163161_101690792 270
137 3300025711 Ga0207696_1000091 Ga0207696_1000091117 270
138 3300025711 Ga0207696_1007537 Ga0207696_10075374 270
139 3300025728 Ga0207655_1000037 Ga0207655_1000037345 270
140 3300025728 Ga0207655_1010605 Ga0207655_10106055 270
141 3300025728 Ga0207655_1048720 Ga0207655_10487202 270
142 3300025735 Ga0207713_1000002 Ga0207713_1000002232 270
143 3300025735 Ga0207713_1000117 Ga0207713_1000117118 270
144 3300025735 Ga0207713_1000345 Ga0207713_10003453 270
145 3300025735 Ga0207713_1000569 Ga0207713_100056914 270
146 3300027312 Ga0209371_1000033 Ga0209371_100003310 270
147 3300030500 Ga0268256_1005932 Ga0268256_10059324 270
148 3300031548 Ga0307408_100358243 Ga0307408_1003582431 270
149 3300031731 Ga0307405_10000958 Ga0307405_1000095811 270
150 3300031911 Ga0307412_10320962 Ga0307412_103209621 270
151 3300032002 Ga0307416_100141069 Ga0307416_1001410692 270
152 3300041411 Ga0439466_0005212 Ga0439466_0005212_2662_3492 270
153 3300042134 Ga0450898_000679 Ga0450898_000679_671_1513 270
154 3300042135 Ga0450899_003032 Ga0450899_003032_101_943 270
155 3300046453 Ga0495627_003174 Ga0495627_003174_4247_5098 270
156 3300046458 Ga0495591_001248 Ga0495591_001248_8841_9692 270
157 3300046458 Ga0495591_002680 Ga0495591_002680_8273_9175 270
158 3300046458 Ga0495591_015955 Ga0495591_015955_747_1592 270
159 3300046471 Ga0495650_0000034 Ga0495650_0000034_91199_92029 270
160 3300046471 Ga0495650_0003554 Ga0495650_0003554_6288_7136 270
161 3300046474 Ga0495605_0000001 Ga0495605_0000001_598252_599112 270
162 3300046474 Ga0495605_0007127 Ga0495605_0007127_2429_3289 270
163 3300046474 Ga0495605_0044252 Ga0495605_0044252_502_1332 270
164 3300046491 Ga0495584_0054490 Ga0495584_0054490_200_1102 270
165 3300046501 Ga0495607_0000018 Ga0495607_0000018_141312_142214 270
166 3300046501 Ga0495607_0002243 Ga0495607_0002243_613_1443 270
167 3300046501 Ga0495607_0003863 Ga0495607_0003863_7147_8001 270
168 3300046501 Ga0495607_0004950 Ga0495607_0004950_7872_8717 270
169 3300046501 Ga0495607_0094209 Ga0495607_0094209_678_1538 270
170 3300046506 Ga0495583_0000651 Ga0495583_0000651_12072_12971 270
171 3300046506 Ga0495583_0002032 Ga0495583_0002032_1681_2529 270
172 3300046506 Ga0495583_0002095 Ga0495583_0002095_12839_13771 270
173 3300046506 Ga0495583_0003281 Ga0495583_0003281_11684_12544 270
174 3300046507 Ga0495606_0000794 Ga0495606_0000794_35719_36564 270
175 3300046507 Ga0495606_0001255 Ga0495606_0001255_17395_18243 270
176 3300046507 Ga0495606_0001289 Ga0495606_0001289_8815_9717 270
177 3300046507 Ga0495606_0010536 Ga0495606_0010536_2915_3760 270
178 3300046512 Ga0495610_0000940 Ga0495610_0000940_16557_17402 270
179 3300046512 Ga0495610_0006348 Ga0495610_0006348_3645_4520 270
180 3300046512 Ga0495610_0029805 Ga0495610_0029805_754_1602 270
181 3300046512 Ga0495610_0042704 Ga0495610_0042704_425_1300 270
182 3300046513 Ga0495616_0093394 Ga0495616_0093394_460_1290 270
183 3300046515 Ga0495620_0000265 Ga0495620_0000265_36263_37165 270
184 3300046515 Ga0495620_0001338 Ga0495620_0001338_10981_11910 270
185 3300046515 Ga0495620_0012368 Ga0495620_0012368_1430_2305 270
186 3300046518 Ga0495631_0008440 Ga0495631_0008440_553_1428 270
187 3300046519 Ga0495632_0003819 Ga0495632_0003819_1432_2280 270
188 3300046520 Ga0495637_0000202 Ga0495637_0000202_35078_36010 270
189 3300046520 Ga0495637_0015082 Ga0495637_0015082_387_1235 270
190 3300046520 Ga0495637_0016112 Ga0495637_0016112_1208_2062 270
191 3300046523 Ga0495644_0003896 Ga0495644_0003896_3582_4484 270
192 3300046523 Ga0495644_0010079 Ga0495644_0010079_243_1073 270
193 3300046524 Ga0495648_0002590 Ga0495648_0002590_9986_10918 270
194 3300046524 Ga0495648_0007696 Ga0495648_0007696_4566_5411 270
195 3300046524 Ga0495648_0011783 Ga0495648_0011783_2043_2945 270
196 3300046524 Ga0495648_0014774 Ga0495648_0014774_2890_3720 270
197 3300046524 Ga0495648_0023812 Ga0495648_0023812_1253_2083 270
198 3300046530 Ga0495654_0000119 Ga0495654_0000119_49839_50738 270
199 3300046530 Ga0495654_0000549 Ga0495654_0000549_23183_24013 270
200 3300046530 Ga0495654_0003370 Ga0495654_0003370_4123_4968 270
201 3300046530 Ga0495654_0004292 Ga0495654_0004292_1524_2456 270
202 3300046530 Ga0495654_0071813 Ga0495654_0071813_610_1512 270
203 3300046538 Ga0495609_0000014 Ga0495609_0000014_15768_16706 270
204 3300046538 Ga0495609_0000067 Ga0495609_0000067_2059_2961 270
205 3300046538 Ga0495609_0059563 Ga0495609_0059563_567_1427 270
206 3300046557 Ga0495622_0003196 Ga0495622_0003196_6532_7434 270
207 3300046648 Ga0495611_0000175 Ga0495611_0000175_34585_35487 270
208 3300046648 Ga0495611_0000950 Ga0495611_0000950_10217_11149 270
209 3300046648 Ga0495611_0007803 Ga0495611_0007803_2481_3323 270
210 3300046665 Ga0495661_0000010 Ga0495661_0000010_272453_273286 270
211 3300046665 Ga0495661_0000051 Ga0495661_0000051_39844_40692 270
212 3300046665 Ga0495661_0000191 Ga0495661_0000191_16520_17368 270
213 3300046665 Ga0495661_0000698 Ga0495661_0000698_27649_28494 270
214 3300046691 Ga0495670_0101875 Ga0495670_0101875_500_1402 270
215 3300046692 Ga0495671_0000586 Ga0495671_0000586_11945_12775 270
216 3300046794 Ga0495589_0000377 Ga0495589_0000377_3872_4717 270
217 3300046794 Ga0495589_0007570 Ga0495589_0007570_2458_3303 270
218 3300046810 Ga0495660_0000020 Ga0495660_0000020_235117_235947 270
219 3300047320 Ga0495672_0000011 Ga0495672_0000011_114620_115450 270
220 3300047320 Ga0495672_0046669 Ga0495672_0046669_1675_2532 270
221 3300047321 Ga0495676_0000006 Ga0495676_0000006_82226_83128 270
222 3300047321 Ga0495676_0043269 Ga0495676_0043269_1440_2294 270
223 3300047323 Ga0495683_0009392 Ga0495683_0009392_1632_2462 270
224 3300047323 Ga0495683_0018762 Ga0495683_0018762_1112_1942 270
225 3300047446 Ga0495679_000226 Ga0495679_000226_31783_32658 270
226 3300047446 Ga0495679_000427 Ga0495679_000427_1642_2544 270
227 3300047446 Ga0495679_001677 Ga0495679_001677_5673_6518 270
228 3300047446 Ga0495679_008977 Ga0495679_008977_577_1422 270
229 3300047469 Ga0495673_0000020 Ga0495673_0000020_101714_102544 270
230 3300047469 Ga0495673_0000279 Ga0495673_0000279_18101_19027 270
231 3300047469 Ga0495673_0006065 Ga0495673_0006065_927_1829 270
232 3300047469 Ga0495673_0007161 Ga0495673_0007161_4029_4967 270
233 3300047469 Ga0495673_0024340 Ga0495673_0024340_863_1693 270
234 3300048904 Ga0496101_0100854 Ga0496101_0100854_654_1484 270
235 3300048919 Ga0496116_0000129 Ga0496116_0000129_26230_27060 270
236 3300048919 Ga0496116_0047481 Ga0496116_0047481_1284_2114 270
237 3300048920 Ga0496117_0000153 Ga0496117_0000153_53804_54634 270
238 3300048920 Ga0496117_0009688 Ga0496117_0009688_3744_4574 270
239 3300048920 Ga0496117_0020499 Ga0496117_0020499_3652_4494 270
240 3300048921 Ga0496118_0000269 Ga0496118_0000269_36476_37306 270
241 3300048921 Ga0496118_0030106 Ga0496118_0030106_1486_2337 270
242 3300048922 Ga0496119_0002224 Ga0496119_0002224_10292_11122 270
243 3300048922 Ga0496119_0019177 Ga0496119_0019177_2696_3538 270
244 3300048923 Ga0496120_0000010 Ga0496120_0000010_294783_295664 270
245 3300048923 Ga0496120_0000024 Ga0496120_0000024_177727_178557 270
246 3300048923 Ga0496120_0030834 Ga0496120_0030834_1744_2586 270
247 3300048924 Ga0496121_0000055 Ga0496121_0000055_152962_153792 270
248 3300048924 Ga0496121_0005397 Ga0496121_0005397_7246_8097 270
249 3300048925 Ga0496122_0000327 Ga0496122_0000327_17056_17907 270
250 3300048925 Ga0496122_0005708 Ga0496122_0005708_10840_11685 270
251 3300048925 Ga0496122_0028631 Ga0496122_0028631_179_1024 270
252 3300048926 Ga0496123_0000115 Ga0496123_0000115_123836_124687 270
253 3300048926 Ga0496123_0001974 Ga0496123_0001974_14727_15572 270
254 3300048926 Ga0496123_0130931 Ga0496123_0130931_363_1193 270
255 3300048928 Ga0496125_0000245 Ga0496125_0000245_27372_28217 270
256 3300048928 Ga0496125_0001265 Ga0496125_0001265_22097_22942 270
257 3300048928 Ga0496125_0024665 Ga0496125_0024665_1310_2152 270
258 3300048929 Ga0496126_0015283 Ga0496126_0015283_3394_4236 270
259 3300048929 Ga0496126_0079521 Ga0496126_0079521_1812_2642 270
260 3300049459 Ga0495678_000072 Ga0495678_000072_93344_94276 270
261 3300049459 Ga0495678_001747 Ga0495678_001747_13442_14272 270
262 3300049460 Ga0495682_0000022 Ga0495682_0000022_103502_104332 270
263 3300049460 Ga0495682_0000361 Ga0495682_0000361_16267_17169 270
264 3300049776 Ga0501280_002468 Ga0501280_002468_699_1559 270
265 3300050491 nmdc:mga00v17_295945_c1 nmdc:mga00v17_295945_c1_183_1025 270
266 3300053104 Ga0500556_0000452 Ga0500556_0000452_15906_16730 270
267 3300053125 Ga0500618_000521 Ga0500618_000521_1230_2084 270
268 3300053126 Ga0500621_000009 Ga0500621_000009_68936_69766 270
269 3300053161 Ga0500634_0000568 Ga0500634_0000568_6437_7282 270
270 iso_pu_bacteria 2506520007 2506578360 270
271 iso_pu_bacteria 2506520008 2506583498 270
272 iso_pu_bacteria 2511231021 2511359757 270
273 iso_pu_bacteria 2511231025 2511378488 270
274 iso_pu_bacteria 2511231156 2511824018 270
275 iso_pu_bacteria 2597489888 2597863654 270
276 iso_pu_bacteria 2597489889 2597869623 270
277 iso_pu_bacteria 2599185189 2599507132 270
278 iso_pu_bacteria 2599185288 2599880306 270
279 iso_pu_bacteria 2600255296 2601692070 270
280 iso_pu_bacteria 2643221571 2643870421 270
281 iso_pu_bacteria 2643221713 2644620979 270
282 iso_pu_bacteria 2738541294 2738806530 270
283 iso_pu_bacteria 2738541309 2738893890 270
284 iso_pu_bacteria 2842826826 2842827137 270
285 iso_pu_bacteria 2842837860 2842843148 270
286 iso_pu_bacteria 2869551831 2869554323 270
287 iso_pu_bacteria 2908669403 2908671640 270
288 iso_pu_bacteria 2945961074 2945964016 270
289 iso_pu_bacteria 2946006987 2946009479 270
290 iso_pu_bacteria 2946027586 2946030720 270
291 3300002705 JGI25156J39149_1001329 JGI25156J39149_10013292 271
292 3300002741 JGI25157J39369_1000053 JGI25157J39369_100005374 271
293 3300005445 Ga0070708_100433753 Ga0070708_1004337531 271
294 3300005468 Ga0070707_100008824 Ga0070707_1000088243 271
295 3300005518 Ga0070699_100021831 Ga0070699_1000218312 271
296 3300005548 Ga0070665_100166001 Ga0070665_1001660012 271
297 3300006038 Ga0075365_10034642 Ga0075365_100346423 271
298 3300006186 Ga0075369_10022188 Ga0075369_100221882 271
299 3300025250 Ga0209026_1000002 Ga0209026_1000002913 271
300 3300025256 Ga0209759_1000179 Ga0209759_100017989 271
301 3300031730 Ga0307516_10010979 Ga0307516_100109794 271
302 3300046460 Ga0495638_0004333 Ga0495638_0004333_8211_9044 271

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

40

236

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

46

287

0.94

PF08659

KR

KR domain

40

221

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nim-assembly1.cif.gz_A crystal structure of a short chain dehydrogenase from brucella melitensis 0.9821 3 269
4nim-assembly1.cif.gz_A crystal structure of a short chain dehydrogenase from brucella melitensis 0.9741 3 269
4za2-assembly1.cif.gz_C crystal structure of pectobacterium carotovorum 2-keto-3-deoxy-d-gluconate dehydrogenase complexed with nad+ 0.9602 2 252
3o38-assembly1.cif.gz_B crystal structure of a short chain dehydrogenase from mycobacterium smegmatis 0.9599 1 249
7djs-assembly1.cif.gz_C crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with nad 0.959 4 251
ID Description Score Start End Superfamily
4nimA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9821 3 269 3.40.50.720
4nimA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9741 3 269 3.40.50.720
af_P0AET8_1_255_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9594 2 252 3.40.50.720
5itvD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9556 1 251 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9541 2 189 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A659UM28-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9782 30 202 GO:0016491
AF-A0A7C4SFP5-F1-model_v4 SDR family oxidoreductase 0.977 3 193 GO:0016616
GO:0030497
AF-A0A356WGD0-F1-model_v4 Short-chain dehydrogenase 0.9661 2 239 GO:0016491
AF-A0A2E2PKQ3-F1-model_v4 Short-chain dehydrogenase 0.9637 3 259 GO:0016491
AF-A0A5C7XHG4-F1-model_v4 SDR family oxidoreductase 0.9636 2 192 GO:0016491

Feature Viewer

pLDDT pTM Quality
93.05 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map