F396634

General Info

Members Datasets Scaffolds Average Seq Length
302 175 604 225

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0098537|Ga0466969_0098537_552_1307
Length 251
Sequence MTQSQGHEFLLKLTALNYHLATMIRHSELLPEPLPSEPLVTVNRWLAEAWQHRHQPNPNAMVLATADRNGRPSARVVLCKELVPQPGFLVFYTNYLSHKGRQLKENPRAAAVLHWDQLHRQVRVEGPVVQAPAADSDAYFASRPWQSRVGAWASAQSEAVASRELLQEAVTQTAQRFGTPLPGHPGAENDLDIVIPRPAHWGGYHLWAETVELWVEGEARIHDRAQWTRKLTPQANGFFEAGPWTATRLQP

Samples

Sample ID Description Type Environment
1 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
112 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
113 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
114 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
115 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
116 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
117 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
118 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
119 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
120 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
121 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
122 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
125 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
126 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
127 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
128 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
129 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
132 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
133 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
134 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
135 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
136 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
137 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
138 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
139 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
140 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
141 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
142 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
143 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
144 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
145 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
146 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
147 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
148 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
149 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
150 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
151 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
152 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
153 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
154 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
155 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
156 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
157 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
158 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
163 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
164 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
165 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
166 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
167 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
168 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
171 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
172 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
173 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
174 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
175 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0.33
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.99
Nodule 0
Rhizoplane 2.32
Rhizosphere 90.73
Stem 0
Stem Tuber 0
Unclassified 19.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466969_0098537 3300044656 Bacteria 1378
2 Ga0065707_10082388 3300005295 Bacteria 15766
3 Ga0070658_10222700 3300005327 Unclassified 1596
4 Ga0070690_100303903 3300005330 Unclassified 1145
5 Ga0070670_100144063 3300005331 Bacteria 2061
6 Ga0068869_100168472 3300005334 Bacteria 1710
7 Ga0070666_10077153 3300005335 Bacteria 2274
8 Ga0070666_10189022 3300005335 Unclassified 1447
9 Ga0070680_100002922 3300005336 Bacteria 12702
10 Ga0070680_100012663 3300005336 Bacteria 6555
11 Ga0070680_100129698 3300005336 Bacteria 2109
12 Ga0070682_100095865 3300005337 Unclassified 1949
13 Ga0070682_100190176 3300005337 Unclassified 1441
14 Ga0070682_100297424 3300005337 Unclassified 1183
15 Ga0070682_100572514 3300005337 Bacteria 887
16 Ga0070689_100000320 3300005340 Bacteria 28007
17 Ga0070689_100305702 3300005340 Bacteria 1325
18 Ga0070687_100065024 3300005343 Bacteria 1939
19 Ga0070661_100022319 3300005344 Bacteria 4531
20 Ga0070675_100017039 3300005354 Bacteria 5775
21 Ga0070675_100499568 3300005354 Bacteria 1096
22 Ga0070671_100588988 3300005355 Bacteria 961
23 Ga0070674_100003174 3300005356 Bacteria 9158
24 Ga0070674_100053012 3300005356 Bacteria 2799
25 Ga0070673_100016275 3300005364 Bacteria 5253
26 Ga0070673_100285628 3300005364 Unclassified 1448
27 Ga0070688_100039997 3300005365 Bacteria 2871
28 Ga0070667_100000465 3300005367 Bacteria 41668
29 Ga0070710_10124215 3300005437 Unclassified 1566
30 Ga0070701_10014272 3300005438 Bacteria 3639
31 Ga0070705_100011259 3300005440 Bacteria 4506
32 Ga0070700_100307452 3300005441 Unclassified 1160
33 Ga0070694_100037736 3300005444 Bacteria 3206
34 Ga0070663_100550832 3300005455 Unclassified 964
35 Ga0070678_100009306 3300005456 Bacteria 5942
36 Ga0070681_10007547 3300005458 Bacteria 10627
37 Ga0070681_10009243 3300005458 Bacteria 9688
38 Ga0070681_10012223 3300005458 Bacteria 8512
39 Ga0070681_10018465 3300005458 Bacteria 6971
40 Ga0070681_10078074 3300005458 Bacteria 3268
41 Ga0070681_10135117 3300005458 Bacteria 2397
42 Ga0070681_10190715 3300005458 Bacteria 1969
43 Ga0070681_10280097 3300005458 Bacteria 1578
44 Ga0070685_10253468 3300005466 Bacteria 1167
45 Ga0070679_100000821 3300005530 Bacteria 26983
46 Ga0070679_100012360 3300005530 Bacteria 8155
47 Ga0070679_100029547 3300005530 Bacteria 5409
48 Ga0070679_100033304 3300005530 Bacteria 5102
49 Ga0070679_100176762 3300005530 Bacteria 2107
50 Ga0070684_100034196 3300005535 Bacteria 4345
51 Ga0070672_100088794 3300005543 Unclassified 2489
52 Ga0070686_100079359 3300005544 Unclassified 2169
53 Ga0070686_100292963 3300005544 Bacteria 1204
54 Ga0070686_100348971 3300005544 Bacteria 1111
55 Ga0070665_100005809 3300005548 Bacteria 12655
56 Ga0070665_100079358 3300005548 Unclassified 3287
57 Ga0070665_100079428 3300005548 Bacteria 3286
58 Ga0068855_100002601 3300005563 Bacteria 22253
59 Ga0068855_100004359 3300005563 Bacteria 17300
60 Ga0068855_100106985 3300005563 Bacteria 3214
61 Ga0068855_100296683 3300005563 Bacteria 1791
62 Ga0070664_100362693 3300005564 Bacteria 1320
63 Ga0068854_100253282 3300005578 Bacteria 1407
64 Ga0068856_100303002 3300005614 Unclassified 1616
65 Ga0068856_100703498 3300005614 Bacteria 1031
66 Ga0070702_100004304 3300005615 Bacteria 6488
67 Ga0068859_100021523 3300005617 Bacteria 6472
68 Ga0068859_100463210 3300005617 Unclassified 1363
69 Ga0068866_10244441 3300005718 Unclassified 1095
70 Ga0068861_100028301 3300005719 Bacteria 4088
71 Ga0068861_100044200 3300005719 Bacteria 3348
72 Ga0068861_100054978 3300005719 Bacteria 3034
73 Ga0068861_100110994 3300005719 Bacteria 2197
74 Ga0068870_10006746 3300005840 Bacteria 5085
75 Ga0068863_100017447 3300005841 Bacteria 6883
76 Ga0068863_100093126 3300005841 Bacteria 2860
77 Ga0068863_100666728 3300005841 Bacteria 1032
78 Ga0068858_100003212 3300005842 Bacteria 16317
79 Ga0068858_100333646 3300005842 Bacteria 1451
80 Ga0068858_100516462 3300005842 Bacteria 1155
81 Ga0068860_100044952 3300005843 Bacteria 4209
82 Ga0068860_100106687 3300005843 Bacteria 2676
83 Ga0075365_10112716 3300006038 Bacteria 1870
84 Ga0075364_10013937 3300006051 Bacteria 4955
85 Ga0068871_100126753 3300006358 Unclassified 2161
86 Ga0068871_100299134 3300006358 Bacteria 1412
87 Ga0075430_100608934 3300006846 Bacteria 901
88 Ga0068865_100029107 3300006881 Bacteria 3661
89 Ga0068865_100197797 3300006881 Bacteria 1559
90 Ga0097620_100021519 3300006931 Bacteria 6472
91 Ga0097620_100463196 3300006931 Unclassified 1363
92 Ga0105250_10047514 3300009092 Bacteria 1721
93 Ga0105240_10003362 3300009093 Bacteria 24885
94 Ga0105240_10071452 3300009093 Bacteria 4292
95 Ga0105240_10073808 3300009093 Bacteria 4212
96 Ga0105240_10095433 3300009093 Bacteria 3626
97 Ga0105240_10097651 3300009093 Bacteria 3579
98 Ga0105240_10261885 3300009093 Bacteria 1994
99 Ga0105240_10270833 3300009093 Bacteria 1955
100 Ga0105247_10006932 3300009101 Bacteria 6977
101 Ga0105242_10020231 3300009176 Bacteria 5218
102 Ga0105248_10080364 3300009177 Bacteria 3664
103 Ga0105237_10051595 3300009545 Bacteria 4131
104 Ga0105237_10120303 3300009545 Bacteria 2620
105 Ga0105237_10582779 3300009545 Unclassified 1125
106 Ga0105237_11090551 3300009545 Bacteria 805
107 Ga0105238_10002269 3300009551 Bacteria 19366
108 Ga0105238_10134495 3300009551 Bacteria 2450
109 Ga0105238_10234024 3300009551 Bacteria 1814
110 Ga0105249_10114672 3300009553 Bacteria 2552
111 Ga0105249_10763760 3300009553 Bacteria 1029
112 Ga0105239_10332226 3300010375 Bacteria 1715
113 Ga0157370_10002673 3300013104 Bacteria 21358
114 Ga0157370_10597853 3300013104 Bacteria 1010
115 Ga0157369_10006474 3300013105 Bacteria 13573
116 Ga0157369_10050610 3300013105 Bacteria 4498
117 Ga0157369_10084376 3300013105 Unclassified 3396
118 Ga0157369_11231675 3300013105 Bacteria 763
119 Ga0163162_10082468 3300013306 Bacteria 3288
120 Ga0157372_11032438 3300013307 Unclassified 952
121 Ga0157375_10796640 3300013308 Unclassified 1094
122 Ga0163163_10025746 3300014325 Bacteria 5611
123 Ga0163163_10046679 3300014325 Bacteria 4255
124 Ga0163163_10051406 3300014325 Bacteria 4064
125 Ga0163163_10107330 3300014325 Unclassified 2819
126 Ga0163163_10472882 3300014325 Unclassified 1314
127 Ga0157380_10145605 3300014326 Bacteria 2041
128 Ga0157380_10259856 3300014326 Unclassified 1577
129 Ga0157380_10329008 3300014326 Bacteria 1420
130 Ga0157379_10041121 3300014968 Bacteria 4126
131 Ga0157379_10066902 3300014968 Bacteria 3213
132 Ga0157379_10145768 3300014968 Bacteria 2135
133 Ga0157379_10242524 3300014968 Bacteria 1635
134 Ga0157379_10539402 3300014968 Bacteria 1084
135 Ga0163161_10072098 3300017792 Bacteria 2529
136 Ga0206356_10048077 3300020070 Bacteria 1808
137 Ga0207682_10001322 3300025893 Bacteria 11398
138 Ga0207692_10026500 3300025898 Unclassified 2720
139 Ga0207642_10187263 3300025899 Unclassified 1133
140 Ga0207688_10258410 3300025901 Bacteria 1056
141 Ga0207680_10059090 3300025903 Bacteria 2327
142 Ga0207645_10288915 3300025907 Unclassified 1090
143 Ga0207643_10006190 3300025908 Bacteria 6404
144 Ga0207707_10001109 3300025912 Bacteria 25562
145 Ga0207707_10002590 3300025912 Bacteria 16201
146 Ga0207707_10009848 3300025912 Bacteria 8286
147 Ga0207707_10009956 3300025912 Bacteria 8243
148 Ga0207707_10177233 3300025912 Bacteria 1862
149 Ga0207707_10224529 3300025912 Bacteria 1635
150 Ga0207695_10002304 3300025913 Bacteria 28458
151 Ga0207695_10063938 3300025913 Bacteria 3791
152 Ga0207695_10083961 3300025913 Bacteria 3216
153 Ga0207695_10169716 3300025913 Bacteria 2108
154 Ga0207695_10170622 3300025913 Bacteria 2101
155 Ga0207695_10214472 3300025913 Bacteria 1834
156 Ga0207671_10184831 3300025914 Unclassified 1623
157 Ga0207660_10002241 3300025917 Bacteria 12775
158 Ga0207660_10106925 3300025917 Bacteria 2098
159 Ga0207660_10598571 3300025917 Bacteria 898
160 Ga0207662_10109829 3300025918 Bacteria 1718
161 Ga0207649_10021780 3300025920 Bacteria 3696
162 Ga0207652_10002344 3300025921 Bacteria 16042
163 Ga0207652_10041665 3300025921 Bacteria 3905
164 Ga0207652_10302191 3300025921 Unclassified 1444
165 Ga0207681_10159077 3300025923 Unclassified 1700
166 Ga0207694_10072587 3300025924 Bacteria 2691
167 Ga0207694_10188509 3300025924 Bacteria 1675
168 Ga0207694_10361246 3300025924 Bacteria 1203
169 Ga0207650_10166978 3300025925 Unclassified 1747
170 Ga0207659_10015969 3300025926 Bacteria 4878
171 Ga0207659_10035111 3300025926 Bacteria 3463
172 Ga0207669_10027994 3300025937 Bacteria 3094
173 Ga0207669_10124349 3300025937 Unclassified 1758
174 Ga0207704_10032098 3300025938 Bacteria 2967
175 Ga0207691_10004058 3300025940 Bacteria 14197
176 Ga0207691_10029123 3300025940 Bacteria 5166
177 Ga0207711_10031781 3300025941 Bacteria 4459
178 Ga0207689_10060753 3300025942 Bacteria 3108
179 Ga0207689_10138665 3300025942 Bacteria 2003
180 Ga0207661_10017977 3300025944 Bacteria 5247
181 Ga0207679_10026301 3300025945 Bacteria 4011
182 Ga0207679_10408335 3300025945 Unclassified 1196
183 Ga0207667_10002957 3300025949 Bacteria 21094
184 Ga0207667_10003279 3300025949 Bacteria 19978
185 Ga0207667_10040864 3300025949 Bacteria 4936
186 Ga0207651_10007926 3300025960 Bacteria 5693
187 Ga0207651_10025151 3300025960 Bacteria 3697
188 Ga0207712_10066545 3300025961 Unclassified 2576
189 Ga0207668_10231130 3300025972 Unclassified 1491
190 Ga0207640_10170969 3300025981 Bacteria 1619
191 Ga0207658_10001938 3300025986 Bacteria 15448
192 Ga0207658_10092576 3300025986 Bacteria 2348
193 Ga0207658_10227582 3300025986 Unclassified 1572
194 Ga0207678_10056212 3300026067 Bacteria 3388
195 Ga0207678_10159011 3300026067 Bacteria 1929
196 Ga0207708_10052480 3300026075 Bacteria 3106
197 Ga0207702_10665408 3300026078 Bacteria 1025
198 Ga0207641_10052723 3300026088 Unclassified 3446
199 Ga0207648_10627899 3300026089 Bacteria 992
200 Ga0207675_100039411 3300026118 Bacteria 4409
201 Ga0207675_100045464 3300026118 Bacteria 4101
202 Ga0207675_100084418 3300026118 Unclassified 2980
203 Ga0207675_100090351 3300026118 Bacteria 2879
204 Ga0207675_100687915 3300026118 Bacteria 1031
205 Ga0207683_10007592 3300026121 Bacteria 9287
206 Ga0207683_10045065 3300026121 Bacteria 3856
207 Ga0268266_10002220 3300028379 Bacteria 21210
208 Ga0268266_10010338 3300028379 Bacteria 8164
209 Ga0268266_10075481 3300028379 Bacteria 2928
210 Ga0268266_10756668 3300028379 Unclassified 938
211 Ga0268265_10057472 3300028380 Bacteria 2965
212 Ga0268264_10087978 3300028381 Bacteria 2672
213 Ga0268264_10329084 3300028381 Unclassified 1447
214 Ga0265338_10130599 3300028800 Bacteria 1984
215 Ga0307511_10022078 3300030521 Bacteria 5973
216 Ga0307511_10156048 3300030521 Bacteria 1295
217 Ga0265329_10130086 3300031242 Unclassified 810
218 Ga0265340_10012878 3300031247 Bacteria 4408
219 Ga0265340_10052324 3300031247 Unclassified 1975
220 Ga0265331_10002995 3300031250 Bacteria 11112
221 Ga0265331_10117903 3300031250 Unclassified 1214
222 Ga0265316_10062593 3300031344 Bacteria 2887
223 Ga0307513_10019102 3300031456 Bacteria 8168
224 Ga0307513_10022236 3300031456 Bacteria 7458
225 Ga0307509_10000023 3300031507 Bacteria 242310
226 Ga0307509_10001822 3300031507 Bacteria 35268
227 Ga0307509_10201015 3300031507 Bacteria 1830
228 Ga0307508_10079510 3300031616 Unclassified 2860
229 Ga0307413_10011444 3300031824 Bacteria 4364
230 Ga0307410_10013601 3300031852 Bacteria 4755
231 Ga0307407_10006311 3300031903 Bacteria 5249
232 Ga0307409_100014761 3300031995 Bacteria 5096
233 Ga0307411_10004279 3300032005 Bacteria 6809
234 Ga0373955_0169558 3300035172 Bacteria 1291
235 Ga0373924_0114004 3300035410 Bacteria 1170
236 Ga0373927_0168671 3300035695 Unclassified 1435
237 Ga0373933_0199486 3300035724 Bacteria 1280
238 Ga0373947_0196982 3300035725 Bacteria 1317
239 Ga0395898_0025007 3300037466 Bacteria 6020
240 Ga0395898_0218121 3300037466 Bacteria 1820
241 Ga0451798_0581854 3300041458 Unclassified 1783
242 Ga0451802_0041577 3300041460 Bacteria 757
243 Ga0451807_0138761 3300041486 Bacteria 2096
244 Ga0451577_0012331 3300042876 Bacteria 8027
245 Ga0466969_0000360 3300044656 Bacteria 25056
246 Ga0466969_0002731 3300044656 Bacteria 9433
247 Ga0466966_0002415 3300044684 Bacteria 12207
248 Ga0466966_0101104 3300044684 Viruses 1783
249 Ga0466966_0190223 3300044684 Unclassified 1244
250 Ga0466966_0288544 3300044684 Unclassified 986
251 Ga0466961_0004563 3300044693 Bacteria 8686
252 Ga0466964_0000255 3300044706 Bacteria 15405
253 Ga0466971_0000652 3300044719 Bacteria 13757
254 Ga0466968_0092190 3300044735 Bacteria 1344
255 Ga0466970_0000702 3300044765 Bacteria 16370
256 Ga0466957_0191719 3300044842 Bacteria 1339
257 Ga0466959_0000574 3300045049 Bacteria 21410
258 Ga0466959_0021361 3300045049 Bacteria 4774
259 Ga0466959_0022419 3300045049 Bacteria 4669
260 Ga0466959_0080888 3300045049 Unclassified 2341
261 Ga0466959_0272904 3300045049 Unclassified 1162
262 Ga0495590_0001214 3300046457 Bacteria 11247
263 Ga0495638_0025881 3300046460 Bacteria 3809
264 Ga0495638_0485532 3300046460 Unclassified 625
265 Ga0495584_0055215 3300046491 Bacteria 1999
266 Ga0495596_0076513 3300046500 Unclassified 1300
267 Ga0495616_0005801 3300046513 Bacteria 7549
268 Ga0495630_0374779 3300046517 Bacteria 1090
269 Ga0495632_0014805 3300046519 Bacteria 4399
270 Ga0495632_0051773 3300046519 Bacteria 2020
271 Ga0495656_0365315 3300046615 Unclassified 750
272 Ga0495668_0270681 3300046616 Bacteria 930
273 Ga0495625_0005139 3300046660 Bacteria 12079
274 Ga0495625_0086947 3300046660 Bacteria 2168
275 Ga0495625_0222525 3300046660 Unclassified 1236
276 Ga0495613_0472607 3300046689 Unclassified 847
277 Ga0495649_0037650 3300046694 Bacteria 2655
278 Ga0495672_0037514 3300047320 Bacteria 2964
279 Ga0495687_076901 3300047443 Bacteria 1320
280 Ga0495686_0215921 3300047472 Bacteria 1093
281 Ga0495626_0108707 3300048091 Bacteria 1203
282 Ga0496101_0455609 3300048904 Bacteria 1009
283 Ga0496104_0203818 3300048907 Unclassified 1890
284 Ga0496106_0651209 3300048909 Unclassified 842
285 Ga0496114_0012739 3300048917 Bacteria 6735
286 Ga0496116_0015678 3300048919 Bacteria 5979
287 Ga0496118_0109418 3300048921 Bacteria 1839
288 Ga0496118_0194282 3300048921 Bacteria 1210
289 Ga0496119_0222509 3300048922 Bacteria 965
290 Ga0496121_0108809 3300048924 Bacteria 2120
291 Ga0496126_0004688 3300048929 Bacteria 16151
292 Ga0496126_0406679 3300048929 Bacteria 1103
293 Ga0501040_0408575 3300049576 Bacteria 975
294 Ga0501042_0642914 3300049578 Bacteria 771
295 Ga0501083_0161465 3300049744 Unclassified 1466
296 Ga0501083_0250442 3300049744 Bacteria 1153
297 Ga0501035_0536471 3300049822 Bacteria 960
298 nmdc:mga0yw44_11016_c1 3300050492 Bacteria 4644
299 nmdc:mga0yw44_199538_c1 3300050492 Bacteria 1321
300 Ga0500583_0247649 3300053092 Bacteria 880
301 Ga0500556_0000763 3300053104 Bacteria 19092
302 Ga0466962_0000861 3300061719 Bacteria 13747
303 Ga0466969_0098537
304 Ga0065707_10082388
305 Ga0070658_10222700
306 Ga0070690_100303903
307 Ga0070670_100144063
308 Ga0068869_100168472
309 Ga0070666_10077153
310 Ga0070666_10189022
311 Ga0070680_100002922
312 Ga0070680_100012663
313 Ga0070680_100129698
314 Ga0070682_100095865
315 Ga0070682_100190176
316 Ga0070682_100297424
317 Ga0070682_100572514
318 Ga0070689_100000320
319 Ga0070689_100305702
320 Ga0070687_100065024
321 Ga0070661_100022319
322 Ga0070675_100017039
323 Ga0070675_100499568
324 Ga0070671_100588988
325 Ga0070674_100003174
326 Ga0070674_100053012
327 Ga0070673_100016275
328 Ga0070673_100285628
329 Ga0070688_100039997
330 Ga0070667_100000465
331 Ga0070710_10124215
332 Ga0070701_10014272
333 Ga0070705_100011259
334 Ga0070700_100307452
335 Ga0070694_100037736
336 Ga0070663_100550832
337 Ga0070678_100009306
338 Ga0070681_10007547
339 Ga0070681_10009243
340 Ga0070681_10012223
341 Ga0070681_10018465
342 Ga0070681_10078074
343 Ga0070681_10135117
344 Ga0070681_10190715
345 Ga0070681_10280097
346 Ga0070685_10253468
347 Ga0070679_100000821
348 Ga0070679_100012360
349 Ga0070679_100029547
350 Ga0070679_100033304
351 Ga0070679_100176762
352 Ga0070684_100034196
353 Ga0070672_100088794
354 Ga0070686_100079359
355 Ga0070686_100292963
356 Ga0070686_100348971
357 Ga0070665_100005809
358 Ga0070665_100079358
359 Ga0070665_100079428
360 Ga0068855_100002601
361 Ga0068855_100004359
362 Ga0068855_100106985
363 Ga0068855_100296683
364 Ga0070664_100362693
365 Ga0068854_100253282
366 Ga0068856_100303002
367 Ga0068856_100703498
368 Ga0070702_100004304
369 Ga0068859_100021523
370 Ga0068859_100463210
371 Ga0068866_10244441
372 Ga0068861_100028301
373 Ga0068861_100044200
374 Ga0068861_100054978
375 Ga0068861_100110994
376 Ga0068870_10006746
377 Ga0068863_100017447
378 Ga0068863_100093126
379 Ga0068863_100666728
380 Ga0068858_100003212
381 Ga0068858_100333646
382 Ga0068858_100516462
383 Ga0068860_100044952
384 Ga0068860_100106687
385 Ga0075365_10112716
386 Ga0075364_10013937
387 Ga0068871_100126753
388 Ga0068871_100299134
389 Ga0075430_100608934
390 Ga0068865_100029107
391 Ga0068865_100197797
392 Ga0097620_100021519
393 Ga0097620_100463196
394 Ga0105250_10047514
395 Ga0105240_10003362
396 Ga0105240_10071452
397 Ga0105240_10073808
398 Ga0105240_10095433
399 Ga0105240_10097651
400 Ga0105240_10261885
401 Ga0105240_10270833
402 Ga0105247_10006932
403 Ga0105242_10020231
404 Ga0105248_10080364
405 Ga0105237_10051595
406 Ga0105237_10120303
407 Ga0105237_10582779
408 Ga0105237_11090551
409 Ga0105238_10002269
410 Ga0105238_10134495
411 Ga0105238_10234024
412 Ga0105249_10114672
413 Ga0105249_10763760
414 Ga0105239_10332226
415 Ga0157370_10002673
416 Ga0157370_10597853
417 Ga0157369_10006474
418 Ga0157369_10050610
419 Ga0157369_10084376
420 Ga0157369_11231675
421 Ga0163162_10082468
422 Ga0157372_11032438
423 Ga0157375_10796640
424 Ga0163163_10025746
425 Ga0163163_10046679
426 Ga0163163_10051406
427 Ga0163163_10107330
428 Ga0163163_10472882
429 Ga0157380_10145605
430 Ga0157380_10259856
431 Ga0157380_10329008
432 Ga0157379_10041121
433 Ga0157379_10066902
434 Ga0157379_10145768
435 Ga0157379_10242524
436 Ga0157379_10539402
437 Ga0163161_10072098
438 Ga0206356_10048077
439 Ga0207682_10001322
440 Ga0207692_10026500
441 Ga0207642_10187263
442 Ga0207688_10258410
443 Ga0207680_10059090
444 Ga0207645_10288915
445 Ga0207643_10006190
446 Ga0207707_10001109
447 Ga0207707_10002590
448 Ga0207707_10009848
449 Ga0207707_10009956
450 Ga0207707_10177233
451 Ga0207707_10224529
452 Ga0207695_10002304
453 Ga0207695_10063938
454 Ga0207695_10083961
455 Ga0207695_10169716
456 Ga0207695_10170622
457 Ga0207695_10214472
458 Ga0207671_10184831
459 Ga0207660_10002241
460 Ga0207660_10106925
461 Ga0207660_10598571
462 Ga0207662_10109829
463 Ga0207649_10021780
464 Ga0207652_10002344
465 Ga0207652_10041665
466 Ga0207652_10302191
467 Ga0207681_10159077
468 Ga0207694_10072587
469 Ga0207694_10188509
470 Ga0207694_10361246
471 Ga0207650_10166978
472 Ga0207659_10015969
473 Ga0207659_10035111
474 Ga0207669_10027994
475 Ga0207669_10124349
476 Ga0207704_10032098
477 Ga0207691_10004058
478 Ga0207691_10029123
479 Ga0207711_10031781
480 Ga0207689_10060753
481 Ga0207689_10138665
482 Ga0207661_10017977
483 Ga0207679_10026301
484 Ga0207679_10408335
485 Ga0207667_10002957
486 Ga0207667_10003279
487 Ga0207667_10040864
488 Ga0207651_10007926
489 Ga0207651_10025151
490 Ga0207712_10066545
491 Ga0207668_10231130
492 Ga0207640_10170969
493 Ga0207658_10001938
494 Ga0207658_10092576
495 Ga0207658_10227582
496 Ga0207678_10056212
497 Ga0207678_10159011
498 Ga0207708_10052480
499 Ga0207702_10665408
500 Ga0207641_10052723
501 Ga0207648_10627899
502 Ga0207675_100039411
503 Ga0207675_100045464
504 Ga0207675_100084418
505 Ga0207675_100090351
506 Ga0207675_100687915
507 Ga0207683_10007592
508 Ga0207683_10045065
509 Ga0268266_10002220
510 Ga0268266_10010338
511 Ga0268266_10075481
512 Ga0268266_10756668
513 Ga0268265_10057472
514 Ga0268264_10087978
515 Ga0268264_10329084
516 Ga0265338_10130599
517 Ga0307511_10022078
518 Ga0307511_10156048
519 Ga0265329_10130086
520 Ga0265340_10012878
521 Ga0265340_10052324
522 Ga0265331_10002995
523 Ga0265331_10117903
524 Ga0265316_10062593
525 Ga0307513_10019102
526 Ga0307513_10022236
527 Ga0307509_10000023
528 Ga0307509_10001822
529 Ga0307509_10201015
530 Ga0307508_10079510
531 Ga0307413_10011444
532 Ga0307410_10013601
533 Ga0307407_10006311
534 Ga0307409_100014761
535 Ga0307411_10004279
536 Ga0373955_0169558
537 Ga0373924_0114004
538 Ga0373927_0168671
539 Ga0373933_0199486
540 Ga0373947_0196982
541 Ga0395898_0025007
542 Ga0395898_0218121
543 Ga0451798_0581854
544 Ga0451802_0041577
545 Ga0451807_0138761
546 Ga0451577_0012331
547 Ga0466969_0000360
548 Ga0466969_0002731
549 Ga0466966_0002415
550 Ga0466966_0101104
551 Ga0466966_0190223
552 Ga0466966_0288544
553 Ga0466961_0004563
554 Ga0466964_0000255
555 Ga0466971_0000652
556 Ga0466968_0092190
557 Ga0466970_0000702
558 Ga0466957_0191719
559 Ga0466959_0000574
560 Ga0466959_0021361
561 Ga0466959_0022419
562 Ga0466959_0080888
563 Ga0466959_0272904
564 Ga0495590_0001214
565 Ga0495638_0025881
566 Ga0495638_0485532
567 Ga0495584_0055215
568 Ga0495596_0076513
569 Ga0495616_0005801
570 Ga0495630_0374779
571 Ga0495632_0014805
572 Ga0495632_0051773
573 Ga0495656_0365315
574 Ga0495668_0270681
575 Ga0495625_0005139
576 Ga0495625_0086947
577 Ga0495625_0222525
578 Ga0495613_0472607
579 Ga0495649_0037650
580 Ga0495672_0037514
581 Ga0495687_076901
582 Ga0495686_0215921
583 Ga0495626_0108707
584 Ga0496101_0455609
585 Ga0496104_0203818
586 Ga0496106_0651209
587 Ga0496114_0012739
588 Ga0496116_0015678
589 Ga0496118_0109418
590 Ga0496118_0194282
591 Ga0496119_0222509
592 Ga0496121_0108809
593 Ga0496126_0004688
594 Ga0496126_0406679
595 Ga0501040_0408575
596 Ga0501042_0642914
597 Ga0501083_0161465
598 Ga0501083_0250442
599 Ga0501035_0536471
600 nmdc:mga0yw44_11016_c1
601 nmdc:mga0yw44_199538_c1
602 Ga0500583_0247649
603 Ga0500556_0000763
604 Ga0466962_0000861

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10590

PNP_phzG_C

Pyridoxine 5'-phosphate oxidase C-terminal dimerisation region

201

251

0.95

PF01243

Putative_PNPOx

Pyridoxamine 5'-phosphate oxidase

48

135

0.94

PF12766

Pyridox_oxase_2

Pyridoxamine 5'-phosphate oxidase

42

131

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jnw-assembly1.cif.gz_A-2 active site structure of e. coli pyridoxine 5'-phosphate oxidase 0.9232 7 219
4hmx-assembly1.cif.gz_A crystal structure of phzg from burkholderia lata 383 in complex with tetrahydrophenazine-1-carboxylic acid 0.9193 13 219
6ylz-assembly1.cif.gz_AAA-2 x-ray structure of the k72i,y129f,r133l, h199a quadruple mutant of pnp-oxidase from e. coli 0.919 8 219
1wv4-assembly1.cif.gz_B x-ray structure of escherichia coli pyridoxine 5'-phosphate oxidase in tetragonal crystal form 0.9162 7 219
1ci0-assembly1.cif.gz_B pnp oxidase from saccharomyces cerevisiae 0.9157 8 219
ID Description Score Start End Superfamily
af_Q9UTQ1_28_231_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9407 15 219 2.30.110.10
af_Q54YS6_26_227_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9206 7 219 2.30.110.10
4hmxA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9193 13 219 2.30.110.10
1wv4B00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9162 7 219 2.30.110.10
af_A0A1R3LXN8_584_738_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9152 1 156 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A2V6W7U9-F1-model_v4 Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5) 0.9741 8 219 GO:0004733
GO:0008615
GO:0010181
AF-A0A2V6W7U9-F1-model_v4 Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5) 0.9694 8 219 GO:0004733
GO:0008615
GO:0010181
AF-A0A2W4MBX4-F1-model_v4 Pyridoxine/pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5) (PNP/PMP oxidase) (PNPOx) (Pyridoxal 5'-phosphate synthase) 0.9622 2 219 GO:0004733
GO:0008615
GO:0010181
AF-A0A2V6YFS1-F1-model_v4 Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5) 0.9616 7 219 GO:0004733
GO:0008615
GO:0010181
AF-A0A5Q4ETF4-F1-model_v4 Pyridoxal 5'-phosphate synthase (EC 1.4.3.5) 0.9602 2 143 GO:0004733
GO:0008615
GO:0010181

Map