F396631

General Info

Members Datasets Scaffolds Average Seq Length
302 191 604 231

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0312616|Ga0451577_0312616_592_1410
Length 272
Sequence VGHPLRRGCCPQHDGDEGRQPGDRGERRQQSRAGGGVALKSPFTIETLRFLRALKRNNDRDWFRARRERYDAVVRAPMIALVERLSRDFRSFAPELVAAPKTSLYRIYRDTRFSDNKAPLKTHAAAGFPWRGLPRHEGAGLYLEVAGGWVWVGGGMWAPQPPQLHRVREHIAETYPEIDRLRRASAFKRMLGSLEGDRLTRVPRGFPRDHPAAEYLKHYRFVAGREFPAEFAIGDEFYPTVVRTFRALMPIVRFLNEPLVEMAGSGNRWAPS

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
141 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
142 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
143 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
144 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
147 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
148 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
149 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
150 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
151 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
152 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
153 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
154 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
155 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
156 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
157 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
158 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
159 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
160 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
161 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
162 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
163 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
167 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
168 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
174 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
175 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
176 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
177 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
178 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
179 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
180 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
181 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
182 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
183 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
184 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
185 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
186 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
187 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
188 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
189 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
190 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
191 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.62
Rhizosphere 93.05
Stem 0
Stem Tuber 0
Unclassified 23.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0312616 3300042876 Bacteria 1424
2 Ga0065712_10108683 3300005290 Bacteria 1867
3 Ga0065715_10004229 3300005293 Bacteria 5523
4 Ga0065715_10371178 3300005293 Unclassified 914
5 Ga0070676_10238510 3300005328 Unclassified 1208
6 Ga0070676_10267653 3300005328 Unclassified 1146
7 Ga0070690_100030912 3300005330 Bacteria 3332
8 Ga0070670_100096240 3300005331 Unclassified 2547
9 Ga0070677_10086657 3300005333 Bacteria 1353
10 Ga0068869_100067230 3300005334 Bacteria 2643
11 Ga0070682_100174024 3300005337 Unclassified 1498
12 Ga0070687_100315758 3300005343 Bacteria 996
13 Ga0070661_100094867 3300005344 Unclassified 2212
14 Ga0070668_100453447 3300005347 Unclassified 1103
15 Ga0070669_100119018 3300005353 Unclassified 2012
16 Ga0070675_100028020 3300005354 Bacteria 4530
17 Ga0070675_100077623 3300005354 Bacteria 2765
18 Ga0070675_100273920 3300005354 Unclassified 1482
19 Ga0070673_100008943 3300005364 Bacteria 6696
20 Ga0070673_100468800 3300005364 Unclassified 1135
21 Ga0070688_100168940 3300005365 Bacteria 1508
22 Ga0070688_100353718 3300005365 Bacteria 1076
23 Ga0070659_100127047 3300005366 Bacteria 2069
24 Ga0070659_100409189 3300005366 Bacteria 1146
25 Ga0070667_100567782 3300005367 Unclassified 1044
26 Ga0070709_10095161 3300005434 Bacteria 1972
27 Ga0070714_100294877 3300005435 Unclassified 1510
28 Ga0070713_100029234 3300005436 Bacteria 4362
29 Ga0070713_100045569 3300005436 Bacteria 3594
30 Ga0070701_10441780 3300005438 Bacteria 833
31 Ga0070705_100250633 3300005440 Unclassified 1243
32 Ga0070700_100004998 3300005441 Bacteria 6986
33 Ga0070700_100147428 3300005441 Unclassified 1606
34 Ga0070663_100020953 3300005455 Bacteria 4338
35 Ga0070678_100091358 3300005456 Unclassified 2336
36 Ga0070678_100362827 3300005456 Bacteria 1249
37 Ga0070678_100712309 3300005456 Bacteria 905
38 Ga0070662_100159608 3300005457 Unclassified 1763
39 Ga0070662_100439075 3300005457 Unclassified 1082
40 Ga0070662_100680888 3300005457 Bacteria 869
41 Ga0070681_10153341 3300005458 Bacteria 2229
42 Ga0070681_10436687 3300005458 Bacteria 1221
43 Ga0070707_100612638 3300005468 Unclassified 1051
44 Ga0070698_100107261 3300005471 Bacteria 2761
45 Ga0070698_100198508 3300005471 Bacteria 1942
46 Ga0070699_100160448 3300005518 Bacteria 1990
47 Ga0070679_100101222 3300005530 Bacteria 2868
48 Ga0070684_100000373 3300005535 Bacteria 30982
49 Ga0068853_100387387 3300005539 Bacteria 1306
50 Ga0068853_100912024 3300005539 Unclassified 844
51 Ga0070672_100018944 3300005543 Bacteria 4987
52 Ga0070672_100194252 3300005543 Bacteria 1696
53 Ga0070672_100291790 3300005543 Bacteria 1381
54 Ga0070696_100144720 3300005546 Unclassified 1740
55 Ga0070693_100041330 3300005547 Unclassified 2593
56 Ga0070665_100000992 3300005548 Bacteria 35958
57 Ga0068855_100300398 3300005563 Bacteria 1778
58 Ga0068855_100585260 3300005563 Bacteria 1205
59 Ga0070664_100017268 3300005564 Bacteria 5927
60 Ga0070664_100242402 3300005564 Bacteria 1618
61 Ga0070664_100892923 3300005564 Unclassified 833
62 Ga0068857_100279204 3300005577 Bacteria 1536
63 Ga0068854_100108887 3300005578 Bacteria 2087
64 Ga0070702_100163915 3300005615 Bacteria 1439
65 Ga0068852_100236883 3300005616 Bacteria 1742
66 Ga0068859_100081492 3300005617 Bacteria 3278
67 Ga0068859_100241530 3300005617 Bacteria 1895
68 Ga0068859_101104735 3300005617 Unclassified 872
69 Ga0068864_100043867 3300005618 Bacteria 3830
70 Ga0068866_10109258 3300005718 Unclassified 1540
71 Ga0068861_100363761 3300005719 Bacteria 1273
72 Ga0068861_100574705 3300005719 Bacteria 1031
73 Ga0068851_10051647 3300005834 Bacteria 2089
74 Ga0068858_100006120 3300005842 Bacteria 11739
75 Ga0068858_100061448 3300005842 Unclassified 3473
76 Ga0068858_100277619 3300005842 Unclassified 1595
77 Ga0068860_100123837 3300005843 Bacteria 2477
78 Ga0068860_100246809 3300005843 Bacteria 1737
79 Ga0068862_100236892 3300005844 Bacteria 1658
80 Ga0068862_100581311 3300005844 Unclassified 1073
81 Ga0081539_10000535 3300005985 Bacteria 78890
82 Ga0070716_100267361 3300006173 Bacteria 1173
83 Ga0097621_100072280 3300006237 Bacteria 2853
84 Ga0097621_100409502 3300006237 Bacteria 1215
85 Ga0097621_100543147 3300006237 Bacteria 1057
86 Ga0068871_100373270 3300006358 Bacteria 1266
87 Ga0075428_100013714 3300006844 Bacteria 9024
88 Ga0075430_100063332 3300006846 Bacteria 3106
89 Ga0075431_100017067 3300006847 Bacteria 7375
90 Ga0075433_10570827 3300006852 Bacteria 994
91 Ga0075434_100098345 3300006871 Bacteria 2931
92 Ga0075434_100332132 3300006871 Bacteria 1541
93 Ga0075434_100377886 3300006871 Bacteria 1438
94 Ga0068865_100253427 3300006881 Unclassified 1390
95 Ga0068865_100413208 3300006881 Bacteria 1108
96 Ga0075436_100017452 3300006914 Bacteria 4914
97 Ga0075436_100247534 3300006914 Unclassified 1269
98 Ga0097620_100081491 3300006931 Bacteria 3278
99 Ga0097620_100241546 3300006931 Bacteria 1895
100 Ga0075435_100011563 3300007076 Bacteria 6501
101 Ga0075435_100037923 3300007076 Bacteria 3841
102 Ga0075435_100052139 3300007076 Bacteria 3297
103 Ga0075435_100222407 3300007076 Bacteria 1603
104 Ga0099795_10117028 3300007788 Bacteria 1062
105 Ga0105240_10036758 3300009093 Bacteria 6297
106 Ga0105240_10116412 3300009093 Bacteria 3225
107 Ga0111539_10029633 3300009094 Bacteria 6662
108 Ga0111539_10049801 3300009094 Bacteria 4992
109 Ga0105245_10385351 3300009098 Unclassified 1397
110 Ga0105247_10004249 3300009101 Bacteria 9180
111 Ga0114129_10035129 3300009147 Bacteria 7083
112 Ga0114129_10053834 3300009147 Bacteria 5644
113 Ga0105243_10026720 3300009148 Bacteria 4420
114 Ga0105242_10010690 3300009176 Bacteria 7046
115 Ga0105242_10084202 3300009176 Bacteria 2664
116 Ga0105242_10639302 3300009176 Bacteria 1033
117 Ga0105248_10043492 3300009177 Bacteria 5035
118 Ga0105248_10067986 3300009177 Bacteria 4000
119 Ga0105248_10070654 3300009177 Bacteria 3920
120 Ga0105248_10588581 3300009177 Bacteria 1255
121 Ga0105248_10892744 3300009177 Bacteria 1003
122 Ga0105249_10014642 3300009553 Bacteria 6935
123 Ga0105249_10300122 3300009553 Bacteria 1611
124 Ga0105239_10246958 3300010375 Bacteria 2004
125 Ga0105239_10775759 3300010375 Unclassified 1098
126 Ga0105246_10251353 3300011119 Bacteria 1403
127 Ga0105246_10305062 3300011119 Bacteria 1287
128 Ga0157370_10552457 3300013104 Unclassified 1056
129 Ga0157374_10045064 3300013296 Unclassified 4081
130 Ga0157378_10994085 3300013297 Unclassified 873
131 Ga0163162_10279142 3300013306 Bacteria 1803
132 Ga0157372_10027399 3300013307 Bacteria 6204
133 Ga0163163_10018676 3300014325 Bacteria 6495
134 Ga0163163_10135025 3300014325 Bacteria 2508
135 Ga0157380_10110958 3300014326 Bacteria 2305
136 Ga0157380_10129509 3300014326 Bacteria 2150
137 Ga0157380_10265551 3300014326 Bacteria 1561
138 Ga0157380_10534664 3300014326 Bacteria 1146
139 Ga0157380_10977678 3300014326 Unclassified 878
140 Ga0157377_10027806 3300014745 Bacteria 3039
141 Ga0157379_10006000 3300014968 Bacteria 10474
142 Ga0157376_10092461 3300014969 Bacteria 2622
143 Ga0157376_10399807 3300014969 Unclassified 1328
144 Ga0157376_10788950 3300014969 Bacteria 962
145 Ga0207682_10085136 3300025893 Bacteria 1362
146 Ga0207642_10097436 3300025899 Bacteria 1468
147 Ga0207710_10046202 3300025900 Bacteria 1944
148 Ga0207680_10046265 3300025903 Bacteria 2571
149 Ga0207680_10151052 3300025903 Unclassified 1548
150 Ga0207647_10303412 3300025904 Bacteria 909
151 Ga0207699_10061530 3300025906 Bacteria 2259
152 Ga0207645_10079141 3300025907 Bacteria 2107
153 Ga0207645_10244957 3300025907 Unclassified 1185
154 Ga0207654_10439251 3300025911 Unclassified 913
155 Ga0207695_10078259 3300025913 Bacteria 3355
156 Ga0207695_10144088 3300025913 Bacteria 2328
157 Ga0207662_10077266 3300025918 Bacteria 2025
158 Ga0207662_10385271 3300025918 Unclassified 948
159 Ga0207657_10183328 3300025919 Bacteria 1691
160 Ga0207649_10147874 3300025920 Unclassified 1615
161 Ga0207652_10099850 3300025921 Bacteria 2562
162 Ga0207646_10031761 3300025922 Bacteria 4780
163 Ga0207646_10505873 3300025922 Unclassified 1088
164 Ga0207681_10017572 3300025923 Bacteria 4493
165 Ga0207681_10240340 3300025923 Unclassified 1409
166 Ga0207650_10095910 3300025925 Unclassified 2274
167 Ga0207650_10328101 3300025925 Bacteria 1255
168 Ga0207659_10119370 3300025926 Bacteria 2018
169 Ga0207659_10221162 3300025926 Bacteria 1523
170 Ga0207659_10221581 3300025926 Unclassified 1521
171 Ga0207687_10154976 3300025927 Bacteria 1752
172 Ga0207700_10016154 3300025928 Bacteria 4949
173 Ga0207700_10018876 3300025928 Bacteria 4646
174 Ga0207644_10015249 3300025931 Bacteria 5156
175 Ga0207644_10065606 3300025931 Bacteria 2640
176 Ga0207706_10133741 3300025933 Unclassified 2181
177 Ga0207706_10365895 3300025933 Bacteria 1253
178 Ga0207686_10005530 3300025934 Bacteria 6776
179 Ga0207670_10035765 3300025936 Bacteria 3224
180 Ga0207704_10329778 3300025938 Unclassified 1180
181 Ga0207691_10007328 3300025940 Bacteria 10640
182 Ga0207691_10022529 3300025940 Bacteria 5939
183 Ga0207691_10040888 3300025940 Bacteria 4283
184 Ga0207691_10251966 3300025940 Bacteria 1524
185 Ga0207711_10030766 3300025941 Bacteria 4528
186 Ga0207711_10094390 3300025941 Bacteria 2636
187 Ga0207711_10105918 3300025941 Unclassified 2494
188 Ga0207711_10162754 3300025941 Bacteria 2021
189 Ga0207689_10025208 3300025942 Bacteria 4985
190 Ga0207689_10142641 3300025942 Bacteria 1974
191 Ga0207689_10325732 3300025942 Unclassified 1275
192 Ga0207661_10002583 3300025944 Bacteria 12457
193 Ga0207679_10032503 3300025945 Unclassified 3663
194 Ga0207667_10507549 3300025949 Unclassified 1223
195 Ga0207651_10139085 3300025960 Bacteria 1873
196 Ga0207651_10159501 3300025960 Bacteria 1766
197 Ga0207651_10424581 3300025960 Unclassified 1136
198 Ga0207712_10028951 3300025961 Bacteria 3711
199 Ga0207668_10312693 3300025972 Bacteria 1301
200 Ga0207658_10133272 3300025986 Bacteria 1999
201 Ga0207677_10009777 3300026023 Bacteria 5405
202 Ga0207677_10641360 3300026023 Bacteria 936
203 Ga0207703_10019952 3300026035 Bacteria 5238
204 Ga0207703_10031162 3300026035 Unclassified 4215
205 Ga0207703_10174593 3300026035 Unclassified 1893
206 Ga0207678_10016888 3300026067 Bacteria 6410
207 Ga0207708_10008692 3300026075 Bacteria 7518
208 Ga0207708_10216884 3300026075 Bacteria 1531
209 Ga0207648_10026929 3300026089 Bacteria 5106
210 Ga0207676_10019553 3300026095 Bacteria 4943
211 Ga0207676_10679212 3300026095 Unclassified 996
212 Ga0207674_10395034 3300026116 Bacteria 1336
213 Ga0207675_100078645 3300026118 Bacteria 3090
214 Ga0207675_100452723 3300026118 Bacteria 1272
215 Ga0207675_100483800 3300026118 Unclassified 1230
216 Ga0207675_100765810 3300026118 Bacteria 977
217 Ga0207683_10220028 3300026121 Bacteria 1730
218 Ga0207698_10092630 3300026142 Bacteria 2478
219 Ga0207428_10145888 3300027907 Bacteria 1804
220 Ga0268265_10141438 3300028380 Bacteria 2015
221 Ga0268265_10229048 3300028380 Unclassified 1632
222 Ga0268264_10092669 3300028381 Bacteria 2608
223 Ga0268264_10182202 3300028381 Unclassified 1908
224 Ga0265314_10083669 3300031711 Bacteria 2097
225 Ga0307410_10045252 3300031852 Bacteria 2929
226 Ga0307416_100079807 3300032002 Bacteria 2759
227 Ga0307414_10176422 3300032004 Bacteria 1714
228 Ga0307415_100055583 3300032126 Bacteria 2709
229 Ga0373928_0012980 3300035084 Bacteria 1668
230 Ga0373939_0089051 3300035114 Bacteria 1040
231 Ga0373943_0059682 3300035170 Unclassified 1902
232 Ga0373955_0155458 3300035172 Bacteria 1347
233 Ga0373935_0148895 3300035692 Bacteria 1587
234 Ga0373937_0009710 3300036401 Bacteria 8389
235 Ga0373925_0016301 3300037068 Bacteria 5380
236 Ga0436363_0474294 3300039450 Bacteria 1771
237 Ga0436362_0563135 3300039453 Bacteria 2296
238 Ga0439434_0069900 3300042435 Bacteria 1104
239 Ga0495603_0021184 3300046455 Bacteria 3936
240 Ga0495629_0002252 3300046459 Bacteria 14871
241 Ga0495594_0414920 3300046499 Bacteria 766
242 Ga0495621_0161294 3300046539 Bacteria 887
243 Ga0495676_0056978 3300047321 Bacteria 3086
244 Ga0495593_0107359 3300047673 Bacteria 1427
245 Ga0496102_0072633 3300048905 Bacteria 3162
246 Ga0496102_0287346 3300048905 Unclassified 1550
247 Ga0496104_0001117 3300048907 Bacteria 22960
248 Ga0496104_0121262 3300048907 Bacteria 2510
249 Ga0496105_0050381 3300048908 Bacteria 3439
250 Ga0496105_0150631 3300048908 Bacteria 1912
251 Ga0496106_0185919 3300048909 Bacteria 1651
252 Ga0496107_0306667 3300048910 Bacteria 1182
253 Ga0496108_0071387 3300048911 Bacteria 2930
254 Ga0496109_0002469 3300048912 Bacteria 15505
255 Ga0496109_0253070 3300048912 Bacteria 1659
256 Ga0496109_0833617 3300048912 Bacteria 860
257 Ga0496110_0133859 3300048913 Unclassified 2239
258 Ga0496110_0173952 3300048913 Bacteria 1954
259 Ga0496112_0003275 3300048915 Bacteria 13366
260 Ga0496112_0130181 3300048915 Bacteria 2487
261 Ga0496112_0214246 3300048915 Bacteria 1883
262 Ga0496112_0645247 3300048915 Unclassified 989
263 Ga0496113_0358393 3300048916 Unclassified 1170
264 Ga0496115_0063046 3300048918 Bacteria 2991
265 Ga0501292_017466 3300049515 Bacteria 1135
266 Ga0501036_0359408 3300049572 Bacteria 1216
267 Ga0501039_0083410 3300049575 Bacteria 2489
268 Ga0501041_0033536 3300049577 Bacteria 3107
269 Ga0501042_0101386 3300049578 Unclassified 2070
270 Ga0501048_0166007 3300049582 Bacteria 1563
271 Ga0501067_0376798 3300049583 Bacteria 791
272 Ga0501069_0205726 3300049585 Bacteria 1141
273 Ga0501071_0531700 3300049587 Unclassified 902
274 Ga0501072_0733685 3300049588 Unclassified 775
275 Ga0501075_0027915 3300049591 Bacteria 4162
276 Ga0501076_0004567 3300049592 Bacteria 9857
277 Ga0501080_0704791 3300049742 Bacteria 890
278 Ga0501045_0105162 3300049824 Bacteria 2092
279 Ga0501045_0251051 3300049824 Unclassified 1317
280 nmdc:mga05p37_109088_c1 3300050507 Bacteria 3405
281 nmdc:mga05p37_45906_c1 3300050507 Bacteria 5373
282 nmdc:mga05p37_647159_c1 3300050507 Bacteria 1184
283 nmdc:mga09592_186438_c1 3300050508 Unclassified 1795
284 nmdc:mga0qj67_22204_c1 3300050509 Bacteria 4874
285 nmdc:mga06r32_172725_c1 3300050510 Bacteria 2146
286 nmdc:mga06r32_329446_c1 3300050510 Bacteria 1512
287 nmdc:mga06r32_376184_c1 3300050510 Bacteria 1403
288 nmdc:mga08y16_136620_c1 3300050511 Bacteria 2548
289 nmdc:mga08y16_72308_c1 3300050511 Bacteria 3594
290 nmdc:mga0n895_152016_c1 3300050512 Bacteria 2345
291 nmdc:mga0n895_233349_c1 3300050512 Unclassified 1867
292 nmdc:mga0n895_24955_c1 3300050512 Bacteria 5642
293 nmdc:mga0n895_402503_c1 3300050512 Bacteria 1384
294 nmdc:mga0rr50_124779_c1 3300050513 Bacteria 2054
295 nmdc:mga0rr50_161131_c1 3300050513 Bacteria 1821
296 nmdc:mga0rr50_28717_c1 3300050513 Bacteria 3914
297 nmdc:mga0rr50_42965_c1 3300050513 Bacteria 3304
298 nmdc:mga08x19_268845_c1 3300050514 Bacteria 1180
299 nmdc:mga08x19_424569_c1 3300050514 Unclassified 934
300 nmdc:mga0a205_41888_c1 3300050515 Bacteria 4411
301 Ga0501084_0011682 3300054114 Bacteria 7271
302 Ga0501082_0084694 3300060353 Bacteria 2734
303 Ga0451577_0312616
304 Ga0065712_10108683
305 Ga0065715_10004229
306 Ga0065715_10371178
307 Ga0070676_10238510
308 Ga0070676_10267653
309 Ga0070690_100030912
310 Ga0070670_100096240
311 Ga0070677_10086657
312 Ga0068869_100067230
313 Ga0070682_100174024
314 Ga0070687_100315758
315 Ga0070661_100094867
316 Ga0070668_100453447
317 Ga0070669_100119018
318 Ga0070675_100028020
319 Ga0070675_100077623
320 Ga0070675_100273920
321 Ga0070673_100008943
322 Ga0070673_100468800
323 Ga0070688_100168940
324 Ga0070688_100353718
325 Ga0070659_100127047
326 Ga0070659_100409189
327 Ga0070667_100567782
328 Ga0070709_10095161
329 Ga0070714_100294877
330 Ga0070713_100029234
331 Ga0070713_100045569
332 Ga0070701_10441780
333 Ga0070705_100250633
334 Ga0070700_100004998
335 Ga0070700_100147428
336 Ga0070663_100020953
337 Ga0070678_100091358
338 Ga0070678_100362827
339 Ga0070678_100712309
340 Ga0070662_100159608
341 Ga0070662_100439075
342 Ga0070662_100680888
343 Ga0070681_10153341
344 Ga0070681_10436687
345 Ga0070707_100612638
346 Ga0070698_100107261
347 Ga0070698_100198508
348 Ga0070699_100160448
349 Ga0070679_100101222
350 Ga0070684_100000373
351 Ga0068853_100387387
352 Ga0068853_100912024
353 Ga0070672_100018944
354 Ga0070672_100194252
355 Ga0070672_100291790
356 Ga0070696_100144720
357 Ga0070693_100041330
358 Ga0070665_100000992
359 Ga0068855_100300398
360 Ga0068855_100585260
361 Ga0070664_100017268
362 Ga0070664_100242402
363 Ga0070664_100892923
364 Ga0068857_100279204
365 Ga0068854_100108887
366 Ga0070702_100163915
367 Ga0068852_100236883
368 Ga0068859_100081492
369 Ga0068859_100241530
370 Ga0068859_101104735
371 Ga0068864_100043867
372 Ga0068866_10109258
373 Ga0068861_100363761
374 Ga0068861_100574705
375 Ga0068851_10051647
376 Ga0068858_100006120
377 Ga0068858_100061448
378 Ga0068858_100277619
379 Ga0068860_100123837
380 Ga0068860_100246809
381 Ga0068862_100236892
382 Ga0068862_100581311
383 Ga0081539_10000535
384 Ga0070716_100267361
385 Ga0097621_100072280
386 Ga0097621_100409502
387 Ga0097621_100543147
388 Ga0068871_100373270
389 Ga0075428_100013714
390 Ga0075430_100063332
391 Ga0075431_100017067
392 Ga0075433_10570827
393 Ga0075434_100098345
394 Ga0075434_100332132
395 Ga0075434_100377886
396 Ga0068865_100253427
397 Ga0068865_100413208
398 Ga0075436_100017452
399 Ga0075436_100247534
400 Ga0097620_100081491
401 Ga0097620_100241546
402 Ga0075435_100011563
403 Ga0075435_100037923
404 Ga0075435_100052139
405 Ga0075435_100222407
406 Ga0099795_10117028
407 Ga0105240_10036758
408 Ga0105240_10116412
409 Ga0111539_10029633
410 Ga0111539_10049801
411 Ga0105245_10385351
412 Ga0105247_10004249
413 Ga0114129_10035129
414 Ga0114129_10053834
415 Ga0105243_10026720
416 Ga0105242_10010690
417 Ga0105242_10084202
418 Ga0105242_10639302
419 Ga0105248_10043492
420 Ga0105248_10067986
421 Ga0105248_10070654
422 Ga0105248_10588581
423 Ga0105248_10892744
424 Ga0105249_10014642
425 Ga0105249_10300122
426 Ga0105239_10246958
427 Ga0105239_10775759
428 Ga0105246_10251353
429 Ga0105246_10305062
430 Ga0157370_10552457
431 Ga0157374_10045064
432 Ga0157378_10994085
433 Ga0163162_10279142
434 Ga0157372_10027399
435 Ga0163163_10018676
436 Ga0163163_10135025
437 Ga0157380_10110958
438 Ga0157380_10129509
439 Ga0157380_10265551
440 Ga0157380_10534664
441 Ga0157380_10977678
442 Ga0157377_10027806
443 Ga0157379_10006000
444 Ga0157376_10092461
445 Ga0157376_10399807
446 Ga0157376_10788950
447 Ga0207682_10085136
448 Ga0207642_10097436
449 Ga0207710_10046202
450 Ga0207680_10046265
451 Ga0207680_10151052
452 Ga0207647_10303412
453 Ga0207699_10061530
454 Ga0207645_10079141
455 Ga0207645_10244957
456 Ga0207654_10439251
457 Ga0207695_10078259
458 Ga0207695_10144088
459 Ga0207662_10077266
460 Ga0207662_10385271
461 Ga0207657_10183328
462 Ga0207649_10147874
463 Ga0207652_10099850
464 Ga0207646_10031761
465 Ga0207646_10505873
466 Ga0207681_10017572
467 Ga0207681_10240340
468 Ga0207650_10095910
469 Ga0207650_10328101
470 Ga0207659_10119370
471 Ga0207659_10221162
472 Ga0207659_10221581
473 Ga0207687_10154976
474 Ga0207700_10016154
475 Ga0207700_10018876
476 Ga0207644_10015249
477 Ga0207644_10065606
478 Ga0207706_10133741
479 Ga0207706_10365895
480 Ga0207686_10005530
481 Ga0207670_10035765
482 Ga0207704_10329778
483 Ga0207691_10007328
484 Ga0207691_10022529
485 Ga0207691_10040888
486 Ga0207691_10251966
487 Ga0207711_10030766
488 Ga0207711_10094390
489 Ga0207711_10105918
490 Ga0207711_10162754
491 Ga0207689_10025208
492 Ga0207689_10142641
493 Ga0207689_10325732
494 Ga0207661_10002583
495 Ga0207679_10032503
496 Ga0207667_10507549
497 Ga0207651_10139085
498 Ga0207651_10159501
499 Ga0207651_10424581
500 Ga0207712_10028951
501 Ga0207668_10312693
502 Ga0207658_10133272
503 Ga0207677_10009777
504 Ga0207677_10641360
505 Ga0207703_10019952
506 Ga0207703_10031162
507 Ga0207703_10174593
508 Ga0207678_10016888
509 Ga0207708_10008692
510 Ga0207708_10216884
511 Ga0207648_10026929
512 Ga0207676_10019553
513 Ga0207676_10679212
514 Ga0207674_10395034
515 Ga0207675_100078645
516 Ga0207675_100452723
517 Ga0207675_100483800
518 Ga0207675_100765810
519 Ga0207683_10220028
520 Ga0207698_10092630
521 Ga0207428_10145888
522 Ga0268265_10141438
523 Ga0268265_10229048
524 Ga0268264_10092669
525 Ga0268264_10182202
526 Ga0265314_10083669
527 Ga0307410_10045252
528 Ga0307416_100079807
529 Ga0307414_10176422
530 Ga0307415_100055583
531 Ga0373928_0012980
532 Ga0373939_0089051
533 Ga0373943_0059682
534 Ga0373955_0155458
535 Ga0373935_0148895
536 Ga0373937_0009710
537 Ga0373925_0016301
538 Ga0436363_0474294
539 Ga0436362_0563135
540 Ga0439434_0069900
541 Ga0495603_0021184
542 Ga0495629_0002252
543 Ga0495594_0414920
544 Ga0495621_0161294
545 Ga0495676_0056978
546 Ga0495593_0107359
547 Ga0496102_0072633
548 Ga0496102_0287346
549 Ga0496104_0001117
550 Ga0496104_0121262
551 Ga0496105_0050381
552 Ga0496105_0150631
553 Ga0496106_0185919
554 Ga0496107_0306667
555 Ga0496108_0071387
556 Ga0496109_0002469
557 Ga0496109_0253070
558 Ga0496109_0833617
559 Ga0496110_0133859
560 Ga0496110_0173952
561 Ga0496112_0003275
562 Ga0496112_0130181
563 Ga0496112_0214246
564 Ga0496112_0645247
565 Ga0496113_0358393
566 Ga0496115_0063046
567 Ga0501292_017466
568 Ga0501036_0359408
569 Ga0501039_0083410
570 Ga0501041_0033536
571 Ga0501042_0101386
572 Ga0501048_0166007
573 Ga0501067_0376798
574 Ga0501069_0205726
575 Ga0501071_0531700
576 Ga0501072_0733685
577 Ga0501075_0027915
578 Ga0501076_0004567
579 Ga0501080_0704791
580 Ga0501045_0105162
581 Ga0501045_0251051
582 nmdc:mga05p37_109088_c1
583 nmdc:mga05p37_45906_c1
584 nmdc:mga05p37_647159_c1
585 nmdc:mga09592_186438_c1
586 nmdc:mga0qj67_22204_c1
587 nmdc:mga06r32_172725_c1
588 nmdc:mga06r32_329446_c1
589 nmdc:mga06r32_376184_c1
590 nmdc:mga08y16_136620_c1
591 nmdc:mga08y16_72308_c1
592 nmdc:mga0n895_152016_c1
593 nmdc:mga0n895_233349_c1
594 nmdc:mga0n895_24955_c1
595 nmdc:mga0n895_402503_c1
596 nmdc:mga0rr50_124779_c1
597 nmdc:mga0rr50_161131_c1
598 nmdc:mga0rr50_28717_c1
599 nmdc:mga0rr50_42965_c1
600 nmdc:mga08x19_268845_c1
601 nmdc:mga08x19_424569_c1
602 nmdc:mga0a205_41888_c1
603 Ga0501084_0011682
604 Ga0501082_0084694

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09365

DUF2461

Conserved hypothetical protein (DUF2461)

46

254

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8x2i-assembly1.cif.gz_A cryo-em structure of the tcsl at ph 5.0 in its open conformation 0.6462 83 121
2a8e-assembly1.cif.gz_A three-dimensional structure of bacillus subtilis q45498 putative protein at resolution 2.5a. northeast structural genomics consortium target sr204. 0.6401 2 217
2a8e-assembly1.cif.gz_A three-dimensional structure of bacillus subtilis q45498 putative protein at resolution 2.5a. northeast structural genomics consortium target sr204. 0.6218 2 217
2xga-assembly1.cif.gz_A mtsl spin-labelled shigella flexneri spa15 0.5418 85 214
5h2d-assembly1.cif.gz_A crystal structure of osh1 ord domain in complex with ergosterol 0.5255 62 116
ID Description Score Start End Superfamily
2a8eA00 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Protein of unknown function DUF1054 0.6511 2 217 3.30.930.20
af_Q4DFG8_2_268_2.40.160.10 Mainly Beta;Beta Barrel;Porin;Porin 0.6495 83 119 2.40.160.10
2a8eA00 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Protein of unknown function DUF1054 0.6346 2 217 3.30.930.20
af_A0A0B4LGH8_107_272_2.40.160.120 Mainly Beta;Beta Barrel;Porin; 0.633 83 116 2.40.160.120
af_Q2G2G7_1_204_3.30.930.20 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Protein of unknown function DUF1054 0.6016 24 210 3.30.930.20
ID Description Score Start End GO Terms
AF-A0A2V8KIA5-F1-model_v4 Uncharacterized protein 0.9741 115 221
AF-A0A2E6NII6-F1-model_v4 Uncharacterized protein 0.9727 132 219
AF-A0A2V8AY61-F1-model_v4 TIGR02453 family protein 0.9712 2 222
AF-A0A4Q3UV51-F1-model_v4 DUF2461 domain-containing protein 0.9702 109 218
AF-A0A7V8XZ77-F1-model_v4 DUF2461 domain-containing protein 0.9647 3 218

Map